F444472

General Info

Members Datasets Scaffolds Average Seq Length
440 265 880 274

Family's Representative Sequence

Representative Sequence 3300042002|Ga0439442_017997|Ga0439442_017997_15_905
Length 296
Sequence MHRAEGELMAIALPAGAVTRGRLRLPSLPNSSPMLMNWAAVSLVFVVTIVALAVPIISPHDPLVPAGIPLQAPGKGGFLLGTDAIGRDILSRVLYGIRASWFAALVVVAVGLFIGGLIGLIAGAAGGWIDSLLMRITDGFLSLPAPVLAIAVVAALGPGFVHTLIAVSIVWWPFYARLVRGEVARLAARPHIEAARLAGVGPIRLAGRHLLPGAVPNSLVAASLDIGTLILTLAALSFLGLGQAAPAPELGADTARNLTYFLQQWWVPVMPGLAVLVLALAANLAGDGLRNLMKTS

Samples

Sample ID Description Type Environment
1 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
149 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
155 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
156 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
157 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
158 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
159 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
160 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
167 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
172 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
173 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
182 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
188 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
214 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
215 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
216 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
217 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
228 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
229 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
230 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
231 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
239 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
240 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
243 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
244 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
245 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
246 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
247 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 2508501039 Frankia saprophytica CN3 Isolate Nodule
252 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
253 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
254 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
255 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
256 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
257 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
258 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
259 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
260 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
261 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
262 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
263 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
264 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
265 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.59
Metatranscriptomes 0
Isolates 3.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.14
Nodule 0.68
Rhizoplane 11.14
Rhizosphere 65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439442_017997 3300042002 Bacteria 1460
2 rootH2_10077252 3300003320 Bacteria 5129
3 Ga0055540_1000003 3300003792 Bacteria 428375
4 Ga0055540_1006143 3300003792 Bacteria 4838
5 Ga0055540_1011455 3300003792 Bacteria 2857
6 Ga0055540_1014638 3300003792 Bacteria 2325
7 Ga0070683_100085420 3300005329 Bacteria 2958
8 Ga0070690_100105874 3300005330 Bacteria 1870
9 Ga0068869_100012733 3300005334 Bacteria 5562
10 Ga0070666_10004051 3300005335 Bacteria 8895
11 Ga0070666_10095367 3300005335 Bacteria 2047
12 Ga0070680_100053118 3300005336 Bacteria 3307
13 Ga0070682_100058311 3300005337 Bacteria 2435
14 Ga0068868_100001869 3300005338 Bacteria 14460
15 Ga0068868_100200334 3300005338 Bacteria 1664
16 Ga0070660_100128690 3300005339 Bacteria 2025
17 Ga0070689_100013959 3300005340 Bacteria 5827
18 Ga0070668_100001504 3300005347 Bacteria 16848
19 Ga0070668_100002278 3300005347 Bacteria 14154
20 Ga0070668_100004475 3300005347 Bacteria 10360
21 Ga0070669_100001726 3300005353 Bacteria 15790
22 Ga0070671_100007550 3300005355 Bacteria 8693
23 Ga0070671_100147360 3300005355 Bacteria 1987
24 Ga0070674_100002621 3300005356 Bacteria 9945
25 Ga0070688_100033642 3300005365 Bacteria 3100
26 Ga0070659_100050600 3300005366 Bacteria 3266
27 Ga0070667_100000042 3300005367 Bacteria 168902
28 Ga0070667_100000650 3300005367 Bacteria 33738
29 Ga0070667_100000768 3300005367 Bacteria 30544
30 Ga0070667_100017660 3300005367 Bacteria 5911
31 Ga0070714_100021991 3300005435 Bacteria 5224
32 Ga0070714_100202066 3300005435 Bacteria 1818
33 Ga0070714_100548916 3300005435 Bacteria 1106
34 Ga0070713_100017414 3300005436 Bacteria 5433
35 Ga0070710_10013660 3300005437 Bacteria 4074
36 Ga0070710_10070817 3300005437 Bacteria 2009
37 Ga0070701_10032828 3300005438 Bacteria 2588
38 Ga0070711_100000419 3300005439 Bacteria 22017
39 Ga0070711_100240165 3300005439 Bacteria 1416
40 Ga0070700_100001312 3300005441 Bacteria 12347
41 Ga0070694_100132428 3300005444 Bacteria 1803
42 Ga0070708_100002663 3300005445 Bacteria 13830
43 Ga0070708_100068189 3300005445 Bacteria 3197
44 Ga0070708_100072883 3300005445 Bacteria 3095
45 Ga0070663_100215765 3300005455 Bacteria 1504
46 Ga0070663_100504257 3300005455 Bacteria 1005
47 Ga0070678_100002163 3300005456 Bacteria 10666
48 Ga0070678_100051783 3300005456 Bacteria 2978
49 Ga0068867_100000571 3300005459 Bacteria 24434
50 Ga0070685_10017765 3300005466 Bacteria 3813
51 Ga0070685_10147027 3300005466 Bacteria 1490
52 Ga0070706_100040725 3300005467 Bacteria 4289
53 Ga0070706_100077000 3300005467 Bacteria 3087
54 Ga0070707_100013720 3300005468 Bacteria 7587
55 Ga0070699_100001345 3300005518 Bacteria 22648
56 Ga0068853_100002225 3300005539 Bacteria 14501
57 Ga0068853_100067744 3300005539 Bacteria 3102
58 Ga0070672_100129333 3300005543 Bacteria 2074
59 Ga0070686_100036755 3300005544 Bacteria 3035
60 Ga0070695_100003874 3300005545 Bacteria 8727
61 Ga0070696_100020834 3300005546 Bacteria 4443
62 Ga0070693_100013983 3300005547 Bacteria 4100
63 Ga0070665_100001305 3300005548 Bacteria 29768
64 Ga0070665_100004672 3300005548 Bacteria 14302
65 Ga0070665_100087375 3300005548 Bacteria 3123
66 Ga0070704_100000452 3300005549 Bacteria 19343
67 Ga0068855_100509868 3300005563 Bacteria 1306
68 Ga0068854_100001292 3300005578 Bacteria 15079
69 Ga0070702_100003101 3300005615 Bacteria 7358
70 Ga0068859_100005227 3300005617 Bacteria 13189
71 Ga0068859_100009539 3300005617 Bacteria 9800
72 Ga0068864_100273402 3300005618 Bacteria 1575
73 Ga0068864_100390960 3300005618 Bacteria 1320
74 Ga0068866_10001461 3300005718 Bacteria 10099
75 Ga0068861_100000589 3300005719 Bacteria 21515
76 Ga0068851_10198630 3300005834 Bacteria 1118
77 Ga0068863_100006978 3300005841 Bacteria 11075
78 Ga0068863_100017563 3300005841 Bacteria 6855
79 Ga0068863_100344930 3300005841 Bacteria 1449
80 Ga0068858_100004407 3300005842 Bacteria 13810
81 Ga0068858_100209642 3300005842 Bacteria 1844
82 Ga0068860_100000020 3300005843 Bacteria 283324
83 Ga0068860_100000314 3300005843 Bacteria 66294
84 Ga0068860_100009123 3300005843 Bacteria 9865
85 Ga0068860_100128292 3300005843 Bacteria 2432
86 Ga0068862_100000013 3300005844 Bacteria 263115
87 Ga0068862_100004826 3300005844 Bacteria 11357
88 Ga0081455_10038468 3300005937 Bacteria 4237
89 Ga0070717_10025894 3300006028 Bacteria 4674
90 Ga0075365_10023155 3300006038 Bacteria 3903
91 Ga0075365_10044050 3300006038 Bacteria 2923
92 Ga0075365_10169441 3300006038 Bacteria 1524
93 Ga0075365_10245805 3300006038 Bacteria 1257
94 Ga0075363_100001845 3300006048 Bacteria 8333
95 Ga0075363_100047655 3300006048 Bacteria 2277
96 Ga0075364_10014319 3300006051 Bacteria 4900
97 Ga0075364_10073219 3300006051 Bacteria 2258
98 Ga0075364_10087828 3300006051 Bacteria 2061
99 Ga0075364_10090233 3300006051 Bacteria 2033
100 Ga0070716_100009967 3300006173 Bacteria 4752
101 Ga0070712_100000143 3300006175 Bacteria 37372
102 Ga0075362_10033833 3300006177 Bacteria 2225
103 Ga0075367_10104070 3300006178 Bacteria 1737
104 Ga0075369_10000248 3300006186 Bacteria 16027
105 Ga0075369_10003278 3300006186 Bacteria 5881
106 Ga0097621_100156700 3300006237 Bacteria 1955
107 Ga0075370_10038879 3300006353 Bacteria 2679
108 Ga0075370_10082629 3300006353 Bacteria 1848
109 Ga0068871_100160551 3300006358 Bacteria 1922
110 Ga0075428_100004591 3300006844 Bacteria 15273
111 Ga0075430_100068215 3300006846 Bacteria 2984
112 Ga0075431_100027332 3300006847 Bacteria 5853
113 Ga0097620_100005227 3300006931 Bacteria 13189
114 Ga0097620_100009539 3300006931 Bacteria 9800
115 Ga0105250_10009506 3300009092 Bacteria 4092
116 Ga0105245_10001387 3300009098 Bacteria 21932
117 Ga0105247_10000009 3300009101 Bacteria 385991
118 Ga0105247_10002287 3300009101 Bacteria 13124
119 Ga0114129_10008594 3300009147 Bacteria 14562
120 Ga0105243_10004603 3300009148 Bacteria 10874
121 Ga0105241_10064039 3300009174 Bacteria 2838
122 Ga0105242_10001007 3300009176 Bacteria 22102
123 Ga0105248_10000109 3300009177 Bacteria 93114
124 Ga0105248_10000140 3300009177 Bacteria 82939
125 Ga0105248_10017859 3300009177 Bacteria 7829
126 Ga0105248_10070283 3300009177 Bacteria 3932
127 Ga0105237_10001176 3300009545 Bacteria 34973
128 Ga0105237_10049126 3300009545 Bacteria 4242
129 Ga0105237_10077271 3300009545 Bacteria 3319
130 Ga0105237_10115278 3300009545 Bacteria 2680
131 Ga0105249_10000011 3300009553 Bacteria 292812
132 Ga0105249_10001549 3300009553 Bacteria 20175
133 Ga0105239_10002958 3300010375 Bacteria 21184
134 Ga0105239_10027179 3300010375 Bacteria 6299
135 Ga0105239_10295403 3300010375 Bacteria 1824
136 Ga0157378_10000796 3300013297 Bacteria 29352
137 Ga0163162_10022203 3300013306 Bacteria 6256
138 Ga0163162_10292661 3300013306 Bacteria 1760
139 Ga0163162_10574435 3300013306 Bacteria 1255
140 Ga0157372_10004408 3300013307 Bacteria 15011
141 Ga0157375_10001335 3300013308 Bacteria 21261
142 Ga0163163_10252962 3300014325 Bacteria 1812
143 Ga0157380_10003506 3300014326 Bacteria 10780
144 Ga0157377_10020337 3300014745 Bacteria 3476
145 Ga0157379_10017729 3300014968 Bacteria 6273
146 Ga0157379_10129609 3300014968 Bacteria 2270
147 Ga0157376_10377967 3300014969 Bacteria 1364
148 Ga0163161_10008818 3300017792 Bacteria 6971
149 Ga0209051_1000011 3300025303 Bacteria 610828
150 Ga0209051_1000659 3300025303 Bacteria 38923
151 Ga0209051_1000937 3300025303 Bacteria 28811
152 Ga0209051_1004062 3300025303 Bacteria 9225
153 Ga0209051_1009928 3300025303 Bacteria 4855
154 Ga0209051_1011810 3300025303 Bacteria 4277
155 Ga0207692_10048125 3300025898 Bacteria 2145
156 Ga0207692_10058357 3300025898 Bacteria 1988
157 Ga0207692_10063681 3300025898 Bacteria 1917
158 Ga0207642_10006160 3300025899 Bacteria 3972
159 Ga0207710_10000014 3300025900 Bacteria 408072
160 Ga0207688_10002532 3300025901 Bacteria 9863
161 Ga0207680_10025636 3300025903 Bacteria 3255
162 Ga0207699_10079152 3300025906 Bacteria 2032
163 Ga0207684_10011933 3300025910 Bacteria 7569
164 Ga0207654_10158486 3300025911 Bacteria 1460
165 Ga0207671_10026698 3300025914 Bacteria 4323
166 Ga0207671_10027531 3300025914 Bacteria 4249
167 Ga0207693_10001399 3300025915 Bacteria 21384
168 Ga0207693_10007746 3300025915 Bacteria 8813
169 Ga0207663_10003364 3300025916 Bacteria 7814
170 Ga0207660_10126521 3300025917 Bacteria 1941
171 Ga0207662_10070899 3300025918 Bacteria 2109
172 Ga0207646_10018789 3300025922 Bacteria 6440
173 Ga0207681_10004651 3300025923 Bacteria 8438
174 Ga0207687_10008883 3300025927 Bacteria 6569
175 Ga0207664_10080746 3300025929 Bacteria 2644
176 Ga0207664_10143617 3300025929 Bacteria 2022
177 Ga0207644_10037069 3300025931 Bacteria 3428
178 Ga0207644_10209573 3300025931 Bacteria 1540
179 Ga0207690_10041634 3300025932 Bacteria 3011
180 Ga0207706_10009448 3300025933 Bacteria 8956
181 Ga0207686_10090403 3300025934 Bacteria 2020
182 Ga0207709_10035829 3300025935 Bacteria 2937
183 Ga0207709_10400201 3300025935 Bacteria 1049
184 Ga0207669_10080096 3300025937 Bacteria 2087
185 Ga0207704_10002883 3300025938 Bacteria 7774
186 Ga0207665_10015428 3300025939 Bacteria 5015
187 Ga0207691_10102897 3300025940 Bacteria 2547
188 Ga0207711_10000182 3300025941 Bacteria 67307
189 Ga0207711_10000322 3300025941 Bacteria 51422
190 Ga0207711_10062921 3300025941 Bacteria 3202
191 Ga0207711_10190012 3300025941 Bacteria 1871
192 Ga0207689_10020340 3300025942 Bacteria 5589
193 Ga0207661_10067182 3300025944 Bacteria 2915
194 Ga0207667_10047705 3300025949 Bacteria 4532
195 Ga0207712_10000020 3300025961 Bacteria 292796
196 Ga0207712_10077464 3300025961 Bacteria 2410
197 Ga0207668_10005393 3300025972 Bacteria 7528
198 Ga0207668_10189293 3300025972 Bacteria 1629
199 Ga0207658_10000055 3300025986 Bacteria 125014
200 Ga0207658_10003822 3300025986 Bacteria 10607
201 Ga0207658_10016981 3300025986 Bacteria 5009
202 Ga0207658_10032552 3300025986 Bacteria 3711
203 Ga0207658_10123799 3300025986 Bacteria 2066
204 Ga0207677_10005043 3300026023 Bacteria 7136
205 Ga0207703_10002325 3300026035 Bacteria 16599
206 Ga0207703_10069055 3300026035 Bacteria 2913
207 Ga0207639_10045381 3300026041 Bacteria 3309
208 Ga0207678_10011737 3300026067 Bacteria 7690
209 Ga0207678_10103527 3300026067 Bacteria 2430
210 Ga0207708_10000900 3300026075 Bacteria 22311
211 Ga0207641_10001784 3300026088 Bacteria 20714
212 Ga0207641_10012543 3300026088 Bacteria 6947
213 Ga0207648_10000503 3300026089 Bacteria 43631
214 Ga0207675_100001926 3300026118 Bacteria 20704
215 Ga0207683_10001009 3300026121 Bacteria 25708
216 Ga0207683_10133041 3300026121 Bacteria 2237
217 Ga0268266_10001251 3300028379 Bacteria 31039
218 Ga0268266_10004799 3300028379 Bacteria 12836
219 Ga0268265_10000004 3300028380 Bacteria 648376
220 Ga0268265_10211976 3300028380 Bacteria 1688
221 Ga0268264_10000024 3300028381 Bacteria 470081
222 Ga0268264_10007499 3300028381 Bacteria 9101
223 Ga0268264_10093481 3300028381 Bacteria 2598
224 Ga0265338_10016457 3300028800 Bacteria 8046
225 Ga0265325_10043865 3300031241 Bacteria 2331
226 Ga0265339_10006820 3300031249 Bacteria 7445
227 Ga0265327_10006118 3300031251 Bacteria 9744
228 Ga0307509_10095503 3300031507 Bacteria 3028
229 Ga0265313_10027484 3300031595 Bacteria 2976
230 Ga0265314_10022916 3300031711 Bacteria 4774
231 Ga0307406_10384981 3300031901 Bacteria 1107
232 Ga0307416_100376677 3300032002 Bacteria 1448
233 Ga0373949_0042225 3300035090 Bacteria 1125
234 Ga0373932_0010565 3300035112 Bacteria 2238
235 Ga0373955_0192195 3300035172 Bacteria 1214
236 Ga0373937_0196657 3300036401 Bacteria 1895
237 Ga0373925_0002280 3300037068 Bacteria 15535
238 Ga0373925_0007388 3300037068 Bacteria 8015
239 Ga0395901_0333483 3300038443 Bacteria 1568
240 Ga0439461_0000866 3300041410 Bacteria 4471
241 Ga0439466_0000104 3300041411 Bacteria 32322
242 Ga0439466_0015010 3300041411 Bacteria 2815
243 Ga0439465_0005821 3300041413 Bacteria 3924
244 Ga0439465_0005989 3300041413 Bacteria 3865
245 Ga0439465_0006985 3300041413 Bacteria 3586
246 Ga0439431_0000052 3300041997 Bacteria 17596
247 Ga0439431_0057240 3300041997 Bacteria 1020
248 Ga0439445_0008346 3300042004 Bacteria 2422
249 Ga0439434_0063194 3300042435 Bacteria 1160
250 Ga0466969_0034755 3300044656 Bacteria 2553
251 Ga0466972_0013935 3300044658 Bacteria 4032
252 Ga0466972_0026133 3300044658 Bacteria 2892
253 Ga0466965_0006710 3300044683 Bacteria 5250
254 Ga0466965_0025448 3300044683 Bacteria 2864
255 Ga0466966_0020386 3300044684 Bacteria 4360
256 Ga0466961_0034654 3300044693 Bacteria 3240
257 Ga0466963_0209790 3300044694 Bacteria 1363
258 Ga0466964_0062824 3300044706 Bacteria 1549
259 Ga0466971_0003460 3300044719 Bacteria 6741
260 Ga0466971_0024234 3300044719 Bacteria 2708
261 Ga0466968_0005872 3300044735 Bacteria 4607
262 Ga0466968_0008636 3300044735 Bacteria 3905
263 Ga0466970_0026130 3300044765 Bacteria 3060
264 Ga0466970_0043794 3300044765 Bacteria 2382
265 Ga0466970_0205594 3300044765 Bacteria 1096
266 Ga0466957_0003237 3300044842 Bacteria 8909
267 Ga0466957_0020636 3300044842 Bacteria 3877
268 Ga0466960_0014152 3300044901 Bacteria 3406
269 Ga0466960_0017754 3300044901 Bacteria 3109
270 Ga0466959_0034292 3300045049 Bacteria 3753
271 Ga0466958_0005205 3300045836 Bacteria 6967
272 Ga0466967_0034025 3300045976 Bacteria 4320
273 Ga0466967_0118747 3300045976 Bacteria 2440
274 Ga0466967_0156589 3300045976 Bacteria 2135
275 Ga0495592_0203697 3300046454 Bacteria 1334
276 Ga0495603_0084079 3300046455 Bacteria 1864
277 Ga0495629_0015692 3300046459 Bacteria 5437
278 Ga0495638_0007619 3300046460 Bacteria 7739
279 Ga0495638_0024975 3300046460 Bacteria 3889
280 Ga0495628_0037152 3300046516 Bacteria 3906
281 Ga0495630_0000664 3300046517 Bacteria 24831
282 Ga0495648_0002096 3300046524 Bacteria 18833
283 Ga0495666_0102531 3300046526 Bacteria 1348
284 Ga0495640_0028596 3300046533 Bacteria 4012
285 Ga0495587_0175344 3300046536 Bacteria 1217
286 Ga0495668_0031056 3300046616 Bacteria 3011
287 Ga0495634_0006881 3300046642 Bacteria 8597
288 Ga0495611_0065361 3300046648 Bacteria 1657
289 Ga0495649_0081401 3300046694 Bacteria 1731
290 Ga0495604_0170832 3300047317 Bacteria 1529
291 Ga0495674_0253696 3300047319 Bacteria 1447
292 Ga0495672_0006245 3300047320 Bacteria 9293
293 Ga0495672_0008828 3300047320 Bacteria 7379
294 Ga0495672_0103987 3300047320 Bacteria 1535
295 Ga0495673_0002089 3300047469 Bacteria 14576
296 Ga0495686_0002065 3300047472 Bacteria 19761
297 Ga0495593_0046029 3300047673 Bacteria 2326
298 Ga0496100_0000141 3300048903 Bacteria 40067
299 Ga0496100_0001248 3300048903 Bacteria 12390
300 Ga0496100_0007329 3300048903 Bacteria 6076
301 Ga0496100_0008961 3300048903 Bacteria 5598
302 Ga0496100_0116599 3300048903 Bacteria 1864
303 Ga0496100_0398176 3300048903 Bacteria 1048
304 Ga0496101_0000084 3300048904 Bacteria 104071
305 Ga0496101_0000113 3300048904 Bacteria 81197
306 Ga0496101_0007073 3300048904 Bacteria 7255
307 Ga0496101_0010297 3300048904 Bacteria 6174
308 Ga0496102_0000035 3300048905 Bacteria 213557
309 Ga0496102_0001636 3300048905 Bacteria 19753
310 Ga0496102_0004291 3300048905 Bacteria 12051
311 Ga0496102_0021143 3300048905 Bacteria 5753
312 Ga0496102_0241464 3300048905 Bacteria 1703
313 Ga0496103_0000028 3300048906 Bacteria 213660
314 Ga0496103_0000268 3300048906 Bacteria 49469
315 Ga0496103_0001230 3300048906 Bacteria 17506
316 Ga0496103_0011308 3300048906 Bacteria 5284
317 Ga0496103_0071166 3300048906 Bacteria 2176
318 Ga0496104_0001475 3300048907 Bacteria 20308
319 Ga0496104_0007211 3300048907 Bacteria 9806
320 Ga0496104_0157607 3300048907 Bacteria 2178
321 Ga0496104_0498260 3300048907 Bacteria 1129
322 Ga0496105_0003064 3300048908 Bacteria 12290
323 Ga0496106_0001164 3300048909 Bacteria 19536
324 Ga0496106_0007063 3300048909 Bacteria 8295
325 Ga0496106_0011641 3300048909 Bacteria 6502
326 Ga0496106_0012304 3300048909 Bacteria 6314
327 Ga0496106_0464207 3300048909 Bacteria 1017
328 Ga0496107_0010855 3300048910 Bacteria 6338
329 Ga0496107_0135577 3300048910 Bacteria 1818
330 Ga0496108_0099664 3300048911 Bacteria 2477
331 Ga0496109_0000098 3300048912 Bacteria 90126
332 Ga0496109_0448981 3300048912 Bacteria 1218
333 Ga0496109_0516972 3300048912 Bacteria 1127
334 Ga0496110_0000051 3300048913 Bacteria 58778
335 Ga0496110_0294995 3300048913 Bacteria 1477
336 Ga0496110_0648911 3300048913 Bacteria 955
337 Ga0496112_0016810 3300048915 Bacteria 6862
338 Ga0496112_0028671 3300048915 Bacteria 5376
339 Ga0496112_0186795 3300048915 Bacteria 2036
340 Ga0496113_0030452 3300048916 Bacteria 3906
341 Ga0496113_0035484 3300048916 Bacteria 3647
342 Ga0496114_0000070 3300048917 Bacteria 73843
343 Ga0496114_0043702 3300048917 Bacteria 3715
344 Ga0496115_0004872 3300048918 Bacteria 9742
345 Ga0496115_0007213 3300048918 Bacteria 8167
346 Ga0496115_0008587 3300048918 Bacteria 7561
347 Ga0496116_0000090 3300048919 Bacteria 212651
348 Ga0496116_0010287 3300048919 Bacteria 7858
349 Ga0496116_0016882 3300048919 Bacteria 5692
350 Ga0496117_0000051 3300048920 Bacteria 285716
351 Ga0496117_0000280 3300048920 Bacteria 95337
352 Ga0496117_0067244 3300048920 Bacteria 2426
353 Ga0496117_0113743 3300048920 Bacteria 1679
354 Ga0496118_0000043 3300048921 Bacteria 285716
355 Ga0496118_0002025 3300048921 Bacteria 28652
356 Ga0496118_0012393 3300048921 Bacteria 8192
357 Ga0496118_0014235 3300048921 Bacteria 7459
358 Ga0496119_0003710 3300048922 Bacteria 15638
359 Ga0496119_0005337 3300048922 Bacteria 12367
360 Ga0496119_0036135 3300048922 Bacteria 3228
361 Ga0496119_0048824 3300048922 Bacteria 2621
362 Ga0496119_0056091 3300048922 Bacteria 2388
363 Ga0496119_0137282 3300048922 Bacteria 1325
364 Ga0496120_0003953 3300048923 Bacteria 12902
365 Ga0496120_0011607 3300048923 Bacteria 6046
366 Ga0496120_0059688 3300048923 Bacteria 2137
367 Ga0496121_0000016 3300048924 Bacteria 562911
368 Ga0496121_0000080 3300048924 Bacteria 230195
369 Ga0496121_0001795 3300048924 Bacteria 34679
370 Ga0496122_0000470 3300048925 Bacteria 84015
371 Ga0496122_0023492 3300048925 Bacteria 5432
372 Ga0496123_0009618 3300048926 Bacteria 8676
373 Ga0496123_0070294 3300048926 Bacteria 2191
374 Ga0496124_0000015 3300048927 Bacteria 460700
375 Ga0496124_0074018 3300048927 Bacteria 2816
376 Ga0496124_0161089 3300048927 Bacteria 1749
377 Ga0496125_0000021 3300048928 Bacteria 460688
378 Ga0496125_0017422 3300048928 Bacteria 6848
379 Ga0496125_0175368 3300048928 Bacteria 1435
380 Ga0496125_0227584 3300048928 Bacteria 1196
381 Ga0496126_0000015 3300048929 Bacteria 663212
382 Ga0496126_0000104 3300048929 Bacteria 200735
383 Ga0496126_0006262 3300048929 Bacteria 13293
384 Ga0496126_0011462 3300048929 Bacteria 9173
385 Ga0496126_0023248 3300048929 Bacteria 6008
386 Ga0496126_0061944 3300048929 Bacteria 3358
387 Ga0496126_0279409 3300048929 Bacteria 1383
388 Ga0501031_0036486 3300049568 Bacteria 3207
389 Ga0501032_0033214 3300049569 Bacteria 3535
390 Ga0501033_0110841 3300049570 Bacteria 1997
391 Ga0501034_0152767 3300049571 Bacteria 2284
392 Ga0501034_0430149 3300049571 Bacteria 1240
393 Ga0501043_0121319 3300049579 Bacteria 2050
394 Ga0501047_0055058 3300049581 Bacteria 3847
395 nmdc:mga03683_17829_c1 3300050489 Bacteria 2692
396 nmdc:mga03n38_142570_c1 3300050490 Bacteria 1198
397 nmdc:mga03n38_2954_c1 3300050490 Bacteria 5369
398 nmdc:mga00v17_63391_c1 3300050491 Bacteria 2276
399 nmdc:mga00v17_79967_c1 3300050491 Bacteria 2039
400 nmdc:mga0yw44_16528_c1 3300050492 Bacteria 3988
401 nmdc:mga0yw44_53707_c1 3300050492 Bacteria 2447
402 nmdc:mga0yw44_76885_c1 3300050492 Bacteria 2084
403 nmdc:mga04h51_52721_c1 3300050495 Bacteria 1370
404 nmdc:mga07m45_65228_c1 3300050496 Bacteria 2067
405 nmdc:mga05p37_37357_c1 3300050507 Bacteria 5954
406 nmdc:mga06r32_25940_c1 3300050510 Bacteria 5458
407 nmdc:mga0sz30_264_c1 3300050516 Bacteria 20089
408 nmdc:mga0sz30_61507_c1 3300050516 Bacteria 1604
409 Ga0495601_0017567 3300053077 Bacteria 4345
410 Ga0495612_0000722 3300053078 Bacteria 13428
411 Ga0500610_0031378 3300053079 Bacteria 2699
412 Ga0500635_0000473 3300053080 Bacteria 11436
413 Ga0500635_0037488 3300053080 Bacteria 1603
414 Ga0495655_0027529 3300053083 Bacteria 1349
415 Ga0495619_0045963 3300053085 Bacteria 2870
416 Ga0495619_0065473 3300053085 Bacteria 2424
417 Ga0500643_004085 3300053087 Bacteria 6726
418 Ga0500556_0042988 3300053104 Bacteria 1601
419 Ga0500562_011570 3300053108 Bacteria 2240
420 Ga0500652_000675 3300053131 Bacteria 11588
421 Ga0500559_0103919 3300053136 Bacteria 1311
422 Ga0500588_0094547 3300053146 Bacteria 1021
423 Ga0500616_0047382 3300053153 Bacteria 2282
424 Ga0500645_000006 3300053730 Bacteria 276677
425 Ga0466962_0024305 3300061719 Bacteria 2910
426 2508677535 2508501039 Bacteria 9978592
427 2643850200 2643221567 Bacteria 4163945
428 2644136181 2643221624 Bacteria 4384879
429 2644486591 2643221687 Bacteria 6500351
430 2729905918 2728369276 Bacteria 5610032
431 2738665214 2738541264 Bacteria 5935393
432 2738704234 2738541274 Bacteria 6909446
433 2739144348 2738541356 Bacteria 5935017
434 2739331282 2738543028 Bacteria 6917070
435 2774844078 2773857921 Bacteria 9435764
436 2842138607 2842134933 Bacteria 5847019
437 2902793516 2902792274 Bacteria 7270173
438 2902838995 2902837492 Bacteria 6697721
439 2939586568 2939582691 Bacteria 7088898
440 2989349522 2989349275 Bacteria 6349068
441 Ga0439442_017997
442 rootH2_10077252
443 Ga0055540_1000003
444 Ga0055540_1006143
445 Ga0055540_1011455
446 Ga0055540_1014638
447 Ga0070683_100085420
448 Ga0070690_100105874
449 Ga0068869_100012733
450 Ga0070666_10004051
451 Ga0070666_10095367
452 Ga0070680_100053118
453 Ga0070682_100058311
454 Ga0068868_100001869
455 Ga0068868_100200334
456 Ga0070660_100128690
457 Ga0070689_100013959
458 Ga0070668_100001504
459 Ga0070668_100002278
460 Ga0070668_100004475
461 Ga0070669_100001726
462 Ga0070671_100007550
463 Ga0070671_100147360
464 Ga0070674_100002621
465 Ga0070688_100033642
466 Ga0070659_100050600
467 Ga0070667_100000042
468 Ga0070667_100000650
469 Ga0070667_100000768
470 Ga0070667_100017660
471 Ga0070714_100021991
472 Ga0070714_100202066
473 Ga0070714_100548916
474 Ga0070713_100017414
475 Ga0070710_10013660
476 Ga0070710_10070817
477 Ga0070701_10032828
478 Ga0070711_100000419
479 Ga0070711_100240165
480 Ga0070700_100001312
481 Ga0070694_100132428
482 Ga0070708_100002663
483 Ga0070708_100068189
484 Ga0070708_100072883
485 Ga0070663_100215765
486 Ga0070663_100504257
487 Ga0070678_100002163
488 Ga0070678_100051783
489 Ga0068867_100000571
490 Ga0070685_10017765
491 Ga0070685_10147027
492 Ga0070706_100040725
493 Ga0070706_100077000
494 Ga0070707_100013720
495 Ga0070699_100001345
496 Ga0068853_100002225
497 Ga0068853_100067744
498 Ga0070672_100129333
499 Ga0070686_100036755
500 Ga0070695_100003874
501 Ga0070696_100020834
502 Ga0070693_100013983
503 Ga0070665_100001305
504 Ga0070665_100004672
505 Ga0070665_100087375
506 Ga0070704_100000452
507 Ga0068855_100509868
508 Ga0068854_100001292
509 Ga0070702_100003101
510 Ga0068859_100005227
511 Ga0068859_100009539
512 Ga0068864_100273402
513 Ga0068864_100390960
514 Ga0068866_10001461
515 Ga0068861_100000589
516 Ga0068851_10198630
517 Ga0068863_100006978
518 Ga0068863_100017563
519 Ga0068863_100344930
520 Ga0068858_100004407
521 Ga0068858_100209642
522 Ga0068860_100000020
523 Ga0068860_100000314
524 Ga0068860_100009123
525 Ga0068860_100128292
526 Ga0068862_100000013
527 Ga0068862_100004826
528 Ga0081455_10038468
529 Ga0070717_10025894
530 Ga0075365_10023155
531 Ga0075365_10044050
532 Ga0075365_10169441
533 Ga0075365_10245805
534 Ga0075363_100001845
535 Ga0075363_100047655
536 Ga0075364_10014319
537 Ga0075364_10073219
538 Ga0075364_10087828
539 Ga0075364_10090233
540 Ga0070716_100009967
541 Ga0070712_100000143
542 Ga0075362_10033833
543 Ga0075367_10104070
544 Ga0075369_10000248
545 Ga0075369_10003278
546 Ga0097621_100156700
547 Ga0075370_10038879
548 Ga0075370_10082629
549 Ga0068871_100160551
550 Ga0075428_100004591
551 Ga0075430_100068215
552 Ga0075431_100027332
553 Ga0097620_100005227
554 Ga0097620_100009539
555 Ga0105250_10009506
556 Ga0105245_10001387
557 Ga0105247_10000009
558 Ga0105247_10002287
559 Ga0114129_10008594
560 Ga0105243_10004603
561 Ga0105241_10064039
562 Ga0105242_10001007
563 Ga0105248_10000109
564 Ga0105248_10000140
565 Ga0105248_10017859
566 Ga0105248_10070283
567 Ga0105237_10001176
568 Ga0105237_10049126
569 Ga0105237_10077271
570 Ga0105237_10115278
571 Ga0105249_10000011
572 Ga0105249_10001549
573 Ga0105239_10002958
574 Ga0105239_10027179
575 Ga0105239_10295403
576 Ga0157378_10000796
577 Ga0163162_10022203
578 Ga0163162_10292661
579 Ga0163162_10574435
580 Ga0157372_10004408
581 Ga0157375_10001335
582 Ga0163163_10252962
583 Ga0157380_10003506
584 Ga0157377_10020337
585 Ga0157379_10017729
586 Ga0157379_10129609
587 Ga0157376_10377967
588 Ga0163161_10008818
589 Ga0209051_1000011
590 Ga0209051_1000659
591 Ga0209051_1000937
592 Ga0209051_1004062
593 Ga0209051_1009928
594 Ga0209051_1011810
595 Ga0207692_10048125
596 Ga0207692_10058357
597 Ga0207692_10063681
598 Ga0207642_10006160
599 Ga0207710_10000014
600 Ga0207688_10002532
601 Ga0207680_10025636
602 Ga0207699_10079152
603 Ga0207684_10011933
604 Ga0207654_10158486
605 Ga0207671_10026698
606 Ga0207671_10027531
607 Ga0207693_10001399
608 Ga0207693_10007746
609 Ga0207663_10003364
610 Ga0207660_10126521
611 Ga0207662_10070899
612 Ga0207646_10018789
613 Ga0207681_10004651
614 Ga0207687_10008883
615 Ga0207664_10080746
616 Ga0207664_10143617
617 Ga0207644_10037069
618 Ga0207644_10209573
619 Ga0207690_10041634
620 Ga0207706_10009448
621 Ga0207686_10090403
622 Ga0207709_10035829
623 Ga0207709_10400201
624 Ga0207669_10080096
625 Ga0207704_10002883
626 Ga0207665_10015428
627 Ga0207691_10102897
628 Ga0207711_10000182
629 Ga0207711_10000322
630 Ga0207711_10062921
631 Ga0207711_10190012
632 Ga0207689_10020340
633 Ga0207661_10067182
634 Ga0207667_10047705
635 Ga0207712_10000020
636 Ga0207712_10077464
637 Ga0207668_10005393
638 Ga0207668_10189293
639 Ga0207658_10000055
640 Ga0207658_10003822
641 Ga0207658_10016981
642 Ga0207658_10032552
643 Ga0207658_10123799
644 Ga0207677_10005043
645 Ga0207703_10002325
646 Ga0207703_10069055
647 Ga0207639_10045381
648 Ga0207678_10011737
649 Ga0207678_10103527
650 Ga0207708_10000900
651 Ga0207641_10001784
652 Ga0207641_10012543
653 Ga0207648_10000503
654 Ga0207675_100001926
655 Ga0207683_10001009
656 Ga0207683_10133041
657 Ga0268266_10001251
658 Ga0268266_10004799
659 Ga0268265_10000004
660 Ga0268265_10211976
661 Ga0268264_10000024
662 Ga0268264_10007499
663 Ga0268264_10093481
664 Ga0265338_10016457
665 Ga0265325_10043865
666 Ga0265339_10006820
667 Ga0265327_10006118
668 Ga0307509_10095503
669 Ga0265313_10027484
670 Ga0265314_10022916
671 Ga0307406_10384981
672 Ga0307416_100376677
673 Ga0373949_0042225
674 Ga0373932_0010565
675 Ga0373955_0192195
676 Ga0373937_0196657
677 Ga0373925_0002280
678 Ga0373925_0007388
679 Ga0395901_0333483
680 Ga0439461_0000866
681 Ga0439466_0000104
682 Ga0439466_0015010
683 Ga0439465_0005821
684 Ga0439465_0005989
685 Ga0439465_0006985
686 Ga0439431_0000052
687 Ga0439431_0057240
688 Ga0439445_0008346
689 Ga0439434_0063194
690 Ga0466969_0034755
691 Ga0466972_0013935
692 Ga0466972_0026133
693 Ga0466965_0006710
694 Ga0466965_0025448
695 Ga0466966_0020386
696 Ga0466961_0034654
697 Ga0466963_0209790
698 Ga0466964_0062824
699 Ga0466971_0003460
700 Ga0466971_0024234
701 Ga0466968_0005872
702 Ga0466968_0008636
703 Ga0466970_0026130
704 Ga0466970_0043794
705 Ga0466970_0205594
706 Ga0466957_0003237
707 Ga0466957_0020636
708 Ga0466960_0014152
709 Ga0466960_0017754
710 Ga0466959_0034292
711 Ga0466958_0005205
712 Ga0466967_0034025
713 Ga0466967_0118747
714 Ga0466967_0156589
715 Ga0495592_0203697
716 Ga0495603_0084079
717 Ga0495629_0015692
718 Ga0495638_0007619
719 Ga0495638_0024975
720 Ga0495628_0037152
721 Ga0495630_0000664
722 Ga0495648_0002096
723 Ga0495666_0102531
724 Ga0495640_0028596
725 Ga0495587_0175344
726 Ga0495668_0031056
727 Ga0495634_0006881
728 Ga0495611_0065361
729 Ga0495649_0081401
730 Ga0495604_0170832
731 Ga0495674_0253696
732 Ga0495672_0006245
733 Ga0495672_0008828
734 Ga0495672_0103987
735 Ga0495673_0002089
736 Ga0495686_0002065
737 Ga0495593_0046029
738 Ga0496100_0000141
739 Ga0496100_0001248
740 Ga0496100_0007329
741 Ga0496100_0008961
742 Ga0496100_0116599
743 Ga0496100_0398176
744 Ga0496101_0000084
745 Ga0496101_0000113
746 Ga0496101_0007073
747 Ga0496101_0010297
748 Ga0496102_0000035
749 Ga0496102_0001636
750 Ga0496102_0004291
751 Ga0496102_0021143
752 Ga0496102_0241464
753 Ga0496103_0000028
754 Ga0496103_0000268
755 Ga0496103_0001230
756 Ga0496103_0011308
757 Ga0496103_0071166
758 Ga0496104_0001475
759 Ga0496104_0007211
760 Ga0496104_0157607
761 Ga0496104_0498260
762 Ga0496105_0003064
763 Ga0496106_0001164
764 Ga0496106_0007063
765 Ga0496106_0011641
766 Ga0496106_0012304
767 Ga0496106_0464207
768 Ga0496107_0010855
769 Ga0496107_0135577
770 Ga0496108_0099664
771 Ga0496109_0000098
772 Ga0496109_0448981
773 Ga0496109_0516972
774 Ga0496110_0000051
775 Ga0496110_0294995
776 Ga0496110_0648911
777 Ga0496112_0016810
778 Ga0496112_0028671
779 Ga0496112_0186795
780 Ga0496113_0030452
781 Ga0496113_0035484
782 Ga0496114_0000070
783 Ga0496114_0043702
784 Ga0496115_0004872
785 Ga0496115_0007213
786 Ga0496115_0008587
787 Ga0496116_0000090
788 Ga0496116_0010287
789 Ga0496116_0016882
790 Ga0496117_0000051
791 Ga0496117_0000280
792 Ga0496117_0067244
793 Ga0496117_0113743
794 Ga0496118_0000043
795 Ga0496118_0002025
796 Ga0496118_0012393
797 Ga0496118_0014235
798 Ga0496119_0003710
799 Ga0496119_0005337
800 Ga0496119_0036135
801 Ga0496119_0048824
802 Ga0496119_0056091
803 Ga0496119_0137282
804 Ga0496120_0003953
805 Ga0496120_0011607
806 Ga0496120_0059688
807 Ga0496121_0000016
808 Ga0496121_0000080
809 Ga0496121_0001795
810 Ga0496122_0000470
811 Ga0496122_0023492
812 Ga0496123_0009618
813 Ga0496123_0070294
814 Ga0496124_0000015
815 Ga0496124_0074018
816 Ga0496124_0161089
817 Ga0496125_0000021
818 Ga0496125_0017422
819 Ga0496125_0175368
820 Ga0496125_0227584
821 Ga0496126_0000015
822 Ga0496126_0000104
823 Ga0496126_0006262
824 Ga0496126_0011462
825 Ga0496126_0023248
826 Ga0496126_0061944
827 Ga0496126_0279409
828 Ga0501031_0036486
829 Ga0501032_0033214
830 Ga0501033_0110841
831 Ga0501034_0152767
832 Ga0501034_0430149
833 Ga0501043_0121319
834 Ga0501047_0055058
835 nmdc:mga03683_17829_c1
836 nmdc:mga03n38_142570_c1
837 nmdc:mga03n38_2954_c1
838 nmdc:mga00v17_63391_c1
839 nmdc:mga00v17_79967_c1
840 nmdc:mga0yw44_16528_c1
841 nmdc:mga0yw44_53707_c1
842 nmdc:mga0yw44_76885_c1
843 nmdc:mga04h51_52721_c1
844 nmdc:mga07m45_65228_c1
845 nmdc:mga05p37_37357_c1
846 nmdc:mga06r32_25940_c1
847 nmdc:mga0sz30_264_c1
848 nmdc:mga0sz30_61507_c1
849 Ga0495601_0017567
850 Ga0495612_0000722
851 Ga0500610_0031378
852 Ga0500635_0000473
853 Ga0500635_0037488
854 Ga0495655_0027529
855 Ga0495619_0045963
856 Ga0495619_0065473
857 Ga0500643_004085
858 Ga0500556_0042988
859 Ga0500562_011570
860 Ga0500652_000675
861 Ga0500559_0103919
862 Ga0500588_0094547
863 Ga0500616_0047382
864 Ga0500645_000006
865 Ga0466962_0024305
866 2508677535
867 2643850200
868 2644136181
869 2644486591
870 2729905918
871 2738665214
872 2738704234
873 2739144348
874 2739331282
875 2774844078
876 2842138607
877 2902793516
878 2902838995
879 2939586568
880 2989349522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

115

294

0.92

Map