F444402

General Info

Members Datasets Scaffolds Average Seq Length
440 277 880 380

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10001217|Ga0099795_100012173
Length 417
Sequence MTRGRAAHVAIEAEEGNNCAIALWIRECSEHSYMGAGDHMSADRRSLNPLYSDNRLKLGVFGANVSNGCAATTAPGHLVMNWPNSRDIVTLADRAGFEAVVPVARWKGFGGATDFNGTCYETLAWAAGMGAVTNHASIFSTTHVPTIHPIVAAKQCTTVDHLTGGRFALNIVCGWYSQELRMFGLQTMDHDTRYAYADEWVEVVRKLWTEEEEFDYAGKFFNIEKGFHRPKPLQLPHPPIMNAGSSGIGARFAAKHADMAFIAFYEENLADGKAKLEEMRRIGREDFSREFQIWTSCRVVCRPTEKEAKEYAHYYIHEKGDFGAVETIIGEQGRKDPNLSPEVFERMKVRLAGGWGGYPLVGTPEQIVEELIALMKTGLDGVVLSWVNYHDEMRQWIAEIMPLVEQAGLRKPYRPPE

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
100 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
121 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
176 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
180 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
192 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
193 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
194 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
195 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
196 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
197 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
198 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
199 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
229 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
239 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
240 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
243 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
244 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
245 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
246 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
247 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
248 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
249 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
250 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
251 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
252 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
253 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
254 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
255 2791355256 Rhizobium sp. M10 Isolate Nodule
256 2791355266 Rhizobium sp. L43 Isolate Nodule
257 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
258 2802429637 Rhizobium anhuiense C15 Isolate Nodule
259 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
260 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
261 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
262 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
263 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
264 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
265 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
266 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
267 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
268 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
269 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
270 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
271 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
272 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
273 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
274 8005382845 Rhizobium sp. R634 Isolate Nodule
275 8005395548 Rhizobium sp. R339 Isolate Nodule
276 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
277 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.36
Metatranscriptomes 0.23
Isolates 8.41

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 3.18
Nodule 6.59
Rhizoplane 5.23
Rhizosphere 78.86
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10001217 3300007788 Bacteria 5441
2 LJQas_1005490 3300000549 Bacteria 1606
3 JGI24743J22301_10006860 3300001991 Bacteria 1957
4 JGI25405J52794_10002291 3300003911 Bacteria 3281
5 Ga0065707_10102908 3300005295 Bacteria 2778
6 Ga0070690_100098764 3300005330 Bacteria 1933
7 Ga0068869_100038884 3300005334 Bacteria 3393
8 Ga0070666_10016183 3300005335 Bacteria 4769
9 Ga0070682_100027143 3300005337 Bacteria 3434
10 Ga0070682_100104677 3300005337 Bacteria 1874
11 Ga0068868_100026771 3300005338 Bacteria 4397
12 Ga0068868_100070409 3300005338 Bacteria 2789
13 Ga0070660_100005561 3300005339 Bacteria 8730
14 Ga0070660_100044611 3300005339 Bacteria 3392
15 Ga0070660_100284030 3300005339 Bacteria 1354
16 Ga0070689_100039760 3300005340 Bacteria 3603
17 Ga0070689_100041960 3300005340 Bacteria 3513
18 Ga0070689_100126174 3300005340 Bacteria 2048
19 Ga0070689_100277010 3300005340 Bacteria 1390
20 Ga0070687_100013386 3300005343 Bacteria 3655
21 Ga0070687_100054661 3300005343 Bacteria 2081
22 Ga0070661_100107894 3300005344 Bacteria 2077
23 Ga0070692_10025642 3300005345 Bacteria 2908
24 Ga0070692_10166646 3300005345 Bacteria 1267
25 Ga0070668_100009944 3300005347 Bacteria 7047
26 Ga0070669_100025161 3300005353 Bacteria 4274
27 Ga0070669_100095360 3300005353 Bacteria 2237
28 Ga0070669_100118956 3300005353 Bacteria 2013
29 Ga0070671_100015954 3300005355 Bacteria 6069
30 Ga0070671_100035878 3300005355 Bacteria 4110
31 Ga0070671_100301417 3300005355 Bacteria 1364
32 Ga0070674_100035451 3300005356 Bacteria 3341
33 Ga0070674_100054821 3300005356 Bacteria 2758
34 Ga0070673_100109323 3300005364 Bacteria 2290
35 Ga0070673_100229635 3300005364 Bacteria 1609
36 Ga0070688_100038505 3300005365 Bacteria 2920
37 Ga0070688_100071668 3300005365 Bacteria 2219
38 Ga0070659_100024975 3300005366 Bacteria 4585
39 Ga0070659_100088827 3300005366 Bacteria 2475
40 Ga0070703_10001340 3300005406 Bacteria 7466
41 Ga0070709_10194575 3300005434 Bacteria 1432
42 Ga0070713_100025071 3300005436 Bacteria 4657
43 Ga0070713_100326192 3300005436 Bacteria 1419
44 Ga0070701_10049905 3300005438 Bacteria 2165
45 Ga0070711_100079163 3300005439 Bacteria 2337
46 Ga0070705_100036820 3300005440 Bacteria 2754
47 Ga0070705_100206555 3300005440 Bacteria 1351
48 Ga0070700_100046742 3300005441 Bacteria 2676
49 Ga0070700_100048595 3300005441 Bacteria 2630
50 Ga0070694_100010199 3300005444 Bacteria 5785
51 Ga0070708_100006235 3300005445 Bacteria 9479
52 Ga0070708_100009334 3300005445 Bacteria 7905
53 Ga0070663_100012433 3300005455 Bacteria 5384
54 Ga0070663_100030212 3300005455 Bacteria 3710
55 Ga0070678_100009334 3300005456 Bacteria 5936
56 Ga0070678_100010931 3300005456 Bacteria 5572
57 Ga0070678_100178359 3300005456 Bacteria 1737
58 Ga0068867_100070298 3300005459 Bacteria 2616
59 Ga0070685_10105583 3300005466 Bacteria 1727
60 Ga0070685_10106152 3300005466 Bacteria 1723
61 Ga0070706_100038564 3300005467 Bacteria 4409
62 Ga0070707_100012596 3300005468 Bacteria 7899
63 Ga0070707_100117822 3300005468 Bacteria 2577
64 Ga0070698_100095061 3300005471 Unclassified 2958
65 Ga0070699_100025256 3300005518 Bacteria 5123
66 Ga0070699_100043329 3300005518 Unclassified 3896
67 Ga0070679_100266861 3300005530 Bacteria 1667
68 Ga0070684_100082007 3300005535 Bacteria 2855
69 Ga0070697_100019807 3300005536 Bacteria 5316
70 Ga0070697_100314345 3300005536 Bacteria 1348
71 Ga0068853_100003774 3300005539 Bacteria 11612
72 Ga0068853_100242424 3300005539 Bacteria 1653
73 Ga0070686_100054525 3300005544 Bacteria 2557
74 Ga0070686_100272135 3300005544 Bacteria 1246
75 Ga0070695_100019322 3300005545 Bacteria 4148
76 Ga0070693_100001812 3300005547 Bacteria 9748
77 Ga0070665_100003842 3300005548 Bacteria 15893
78 Ga0070665_100011748 3300005548 Bacteria 8842
79 Ga0070665_100035776 3300005548 Bacteria 4996
80 Ga0070665_100068404 3300005548 Bacteria 3561
81 Ga0070665_100139344 3300005548 Bacteria 2429
82 Ga0070704_100003651 3300005549 Bacteria 8851
83 Ga0068855_100027382 3300005563 Bacteria 6819
84 Ga0068855_100375665 3300005563 Bacteria 1561
85 Ga0068854_100010730 3300005578 Bacteria 5946
86 Ga0068856_100005140 3300005614 Bacteria 12921
87 Ga0068856_100058828 3300005614 Bacteria 3796
88 Ga0068856_100068695 3300005614 Bacteria 3503
89 Ga0068856_100086806 3300005614 Bacteria 3109
90 Ga0068856_100138306 3300005614 Bacteria 2442
91 Ga0070702_100004157 3300005615 Bacteria 6582
92 Ga0068852_100005363 3300005616 Bacteria 9164
93 Ga0068852_100019385 3300005616 Bacteria 5382
94 Ga0068859_100041561 3300005617 Bacteria 4618
95 Ga0068864_100181864 3300005618 Bacteria 1922
96 Ga0068866_10059307 3300005718 Bacteria 1980
97 Ga0068866_10073805 3300005718 Bacteria 1811
98 Ga0068866_10137143 3300005718 Bacteria 1400
99 Ga0068861_100007932 3300005719 Bacteria 7305
100 Ga0068861_100038120 3300005719 Bacteria 3576
101 Ga0068870_10025117 3300005840 Bacteria 2955
102 Ga0068870_10058412 3300005840 Bacteria 2065
103 Ga0068863_100008223 3300005841 Bacteria 10193
104 Ga0068863_100099525 3300005841 Bacteria 2762
105 Ga0068863_100282938 3300005841 Bacteria 1607
106 Ga0068858_100098888 3300005842 Bacteria 2720
107 Ga0068858_100122991 3300005842 Bacteria 2428
108 Ga0068860_100014355 3300005843 Bacteria 7764
109 Ga0068860_100015949 3300005843 Bacteria 7333
110 Ga0068862_100051389 3300005844 Bacteria 3525
111 Ga0068862_100217254 3300005844 Bacteria 1730
112 Ga0081455_10000475 3300005937 Bacteria 52041
113 Ga0081455_10027126 3300005937 Bacteria 5252
114 Ga0081538_10019809 3300005981 Unclassified 4978
115 Ga0081540_1002495 3300005983 Bacteria 14979
116 Ga0081539_10000721 3300005985 Bacteria 66220
117 Ga0081539_10021880 3300005985 Bacteria 4253
118 Ga0070717_10002138 3300006028 Bacteria 13849
119 Ga0070717_10012028 3300006028 Bacteria 6591
120 Ga0070717_10039082 3300006028 Bacteria 3860
121 Ga0070717_10081275 3300006028 Bacteria 2720
122 Ga0075365_10028833 3300006038 Bacteria 3542
123 Ga0075363_100016802 3300006048 Bacteria 3618
124 Ga0075363_100033395 3300006048 Bacteria 2679
125 Ga0075432_10011113 3300006058 Bacteria 3056
126 Ga0070716_100017460 3300006173 Bacteria 3720
127 Ga0070712_100008465 3300006175 Bacteria 6474
128 Ga0075367_10080681 3300006178 Bacteria 1968
129 Ga0097621_100144588 3300006237 Bacteria 2035
130 Ga0075370_10122829 3300006353 Bacteria 1513
131 Ga0068871_100017910 3300006358 Bacteria 5371
132 Ga0075428_100152959 3300006844 Bacteria 2506
133 Ga0075431_100424023 3300006847 Unclassified 1329
134 Ga0075433_10003189 3300006852 Bacteria 12640
135 Ga0075434_100013828 3300006871 Bacteria 7696
136 Ga0075434_100185933 3300006871 Bacteria 2098
137 Ga0075429_100174016 3300006880 Bacteria 1886
138 Ga0068865_100274113 3300006881 Bacteria 1340
139 Ga0075436_100028579 3300006914 Bacteria 3835
140 Ga0097620_100041561 3300006931 Bacteria 4618
141 Ga0075435_100004222 3300007076 Bacteria 9865
142 Ga0075435_100331299 3300007076 Bacteria 1304
143 Ga0105251_10059275 3300009011 Bacteria 1806
144 Ga0105240_10001767 3300009093 Bacteria 36501
145 Ga0105240_10116493 3300009093 Bacteria 3223
146 Ga0105240_10319403 3300009093 Bacteria 1770
147 Ga0111539_10043118 3300009094 Bacteria 5411
148 Ga0111539_10106537 3300009094 Bacteria 3288
149 Ga0105245_10012978 3300009098 Bacteria 7261
150 Ga0105245_10014678 3300009098 Bacteria 6821
151 Ga0105245_10033074 3300009098 Bacteria 4580
152 Ga0105245_10248052 3300009098 Bacteria 1729
153 Ga0105247_10033883 3300009101 Bacteria 3109
154 Ga0114129_10100646 3300009147 Bacteria 3999
155 Ga0114129_10207176 3300009147 Bacteria 2653
156 Ga0114129_10512728 3300009147 Bacteria 1564
157 Ga0105243_10007381 3300009148 Bacteria 8450
158 Ga0105243_10018455 3300009148 Bacteria 5285
159 Ga0105243_10213408 3300009148 Bacteria 1701
160 Ga0105241_10017602 3300009174 Bacteria 5254
161 Ga0105242_10394088 3300009176 Bacteria 1290
162 Ga0105248_10001432 3300009177 Bacteria 26594
163 Ga0105248_10027678 3300009177 Bacteria 6314
164 Ga0105248_10084286 3300009177 Bacteria 3575
165 Ga0105237_10058747 3300009545 Bacteria 3849
166 Ga0105238_10032065 3300009551 Bacteria 5347
167 Ga0105238_10038921 3300009551 Bacteria 4827
168 Ga0105238_10110714 3300009551 Bacteria 2726
169 Ga0105249_10025125 3300009553 Bacteria 5361
170 Ga0105249_10031870 3300009553 Bacteria 4769
171 Ga0105249_10075779 3300009553 Bacteria 3116
172 Ga0123341_1015351 3300009765 Bacteria 6822
173 Ga0099796_10011134 3300010159 Unclassified 2499
174 Ga0105239_10001135 3300010375 Bacteria 36722
175 Ga0105239_10031716 3300010375 Bacteria 5807
176 Ga0105239_10374050 3300010375 Bacteria 1610
177 Ga0157373_10164527 3300013100 Bacteria 1561
178 Ga0157371_10089087 3300013102 Bacteria 2185
179 Ga0157370_10049461 3300013104 Bacteria 4023
180 Ga0157370_10295067 3300013104 Bacteria 1497
181 Ga0157369_10039446 3300013105 Bacteria 5160
182 Ga0157369_10365103 3300013105 Bacteria 1499
183 Ga0157374_10010323 3300013296 Bacteria 8033
184 Ga0157374_10267107 3300013296 Bacteria 1686
185 Ga0157374_10290934 3300013296 Bacteria 1615
186 Ga0157378_10003758 3300013297 Bacteria 13456
187 Ga0157378_10075323 3300013297 Bacteria 3038
188 Ga0163162_10030924 3300013306 Bacteria 5308
189 Ga0163162_10033151 3300013306 Bacteria 5131
190 Ga0163162_10059510 3300013306 Bacteria 3852
191 Ga0163162_10159284 3300013306 Unclassified 2379
192 Ga0163162_10184430 3300013306 Bacteria 2213
193 Ga0163162_10427368 3300013306 Bacteria 1457
194 Ga0157372_10380776 3300013307 Bacteria 1644
195 Ga0157375_10030889 3300013308 Bacteria 5056
196 Ga0157375_10151774 3300013308 Unclassified 2453
197 Ga0163163_10036820 3300014325 Bacteria 4755
198 Ga0163163_10095929 3300014325 Bacteria 2986
199 Ga0163163_10188969 3300014325 Bacteria 2108
200 Ga0157380_10101654 3300014326 Bacteria 2396
201 Ga0157380_10191842 3300014326 Bacteria 1805
202 Ga0182008_10001013 3300014497 Bacteria 19519
203 Ga0157379_10058676 3300014968 Bacteria 3442
204 Ga0157379_10095531 3300014968 Bacteria 2667
205 Ga0157379_10148740 3300014968 Bacteria 2112
206 Ga0157379_10203867 3300014968 Bacteria 1789
207 Ga0157379_10265366 3300014968 Bacteria 1561
208 Ga0157376_10010403 3300014969 Bacteria 6803
209 Ga0182007_10001065 3300015262 Bacteria 14966
210 Ga0163161_10001511 3300017792 Bacteria 17213
211 Ga0163161_10172991 3300017792 Bacteria 1652
212 Ga0206353_10932685 3300020082 Bacteria 1819
213 Ga0213876_10046842 3300021384 Bacteria 2286
214 Ga0213875_10008235 3300021388 Bacteria 5350
215 Ga0207426_1023380 3300025302 Bacteria 2109
216 Ga0207656_10038566 3300025321 Bacteria 2016
217 Ga0207653_10002888 3300025885 Bacteria 5456
218 Ga0207692_10025625 3300025898 Bacteria 2757
219 Ga0207710_10042179 3300025900 Bacteria 2026
220 Ga0207710_10042784 3300025900 Bacteria 2013
221 Ga0207688_10001251 3300025901 Bacteria 13201
222 Ga0207688_10065597 3300025901 Bacteria 2052
223 Ga0207680_10071594 3300025903 Bacteria 2150
224 Ga0207699_10011274 3300025906 Bacteria 4508
225 Ga0207645_10009286 3300025907 Bacteria 6810
226 Ga0207643_10017284 3300025908 Bacteria 3943
227 Ga0207684_10075279 3300025910 Bacteria 2869
228 Ga0207654_10102589 3300025911 Bacteria 1765
229 Ga0207695_10001621 3300025913 Bacteria 36491
230 Ga0207695_10034274 3300025913 Bacteria 5524
231 Ga0207693_10000561 3300025915 Bacteria 33553
232 Ga0207660_10138168 3300025917 Bacteria 1861
233 Ga0207660_10178453 3300025917 Bacteria 1648
234 Ga0207662_10008003 3300025918 Bacteria 5764
235 Ga0207662_10047649 3300025918 Bacteria 2538
236 Ga0207662_10052386 3300025918 Unclassified 2428
237 Ga0207657_10033533 3300025919 Bacteria 4628
238 Ga0207657_10081613 3300025919 Bacteria 2715
239 Ga0207652_10282765 3300025921 Bacteria 1497
240 Ga0207646_10029259 3300025922 Bacteria 5008
241 Ga0207694_10045205 3300025924 Bacteria 3401
242 Ga0207687_10010077 3300025927 Bacteria 6180
243 Ga0207687_10016746 3300025927 Bacteria 4819
244 Ga0207687_10043408 3300025927 Bacteria 3098
245 Ga0207700_10022204 3300025928 Bacteria 4349
246 Ga0207700_10074202 3300025928 Bacteria 2630
247 Ga0207700_10104648 3300025928 Bacteria 2265
248 Ga0207700_10240850 3300025928 Unclassified 1542
249 Ga0207706_10017871 3300025933 Bacteria 6386
250 Ga0207706_10067172 3300025933 Bacteria 3155
251 Ga0207709_10019104 3300025935 Bacteria 3846
252 Ga0207670_10054049 3300025936 Bacteria 2708
253 Ga0207670_10058769 3300025936 Bacteria 2613
254 Ga0207670_10181123 3300025936 Bacteria 1587
255 Ga0207669_10014433 3300025937 Bacteria 3959
256 Ga0207704_10010597 3300025938 Bacteria 4503
257 Ga0207665_10004366 3300025939 Bacteria 9388
258 Ga0207691_10214501 3300025940 Bacteria 1671
259 Ga0207711_10094331 3300025941 Bacteria 2637
260 Ga0207689_10070289 3300025942 Bacteria 2876
261 Ga0207661_10063609 3300025944 Bacteria 2989
262 Ga0207667_10378585 3300025949 Bacteria 1442
263 Ga0207651_10106423 3300025960 Bacteria 2094
264 Ga0207712_10002484 3300025961 Bacteria 11883
265 Ga0207712_10024661 3300025961 Bacteria 3987
266 Ga0207668_10005845 3300025972 Bacteria 7244
267 Ga0207668_10051955 3300025972 Bacteria 2834
268 Ga0207668_10478200 3300025972 Bacteria 1068
269 Ga0207640_10031153 3300025981 Bacteria 3292
270 Ga0207677_10091664 3300026023 Bacteria 2211
271 Ga0207677_10142232 3300026023 Bacteria 1839
272 Ga0207703_10291078 3300026035 Bacteria 1486
273 Ga0207678_10002838 3300026067 Bacteria 15705
274 Ga0207678_10017300 3300026067 Bacteria 6329
275 Ga0207678_10055616 3300026067 Bacteria 3408
276 Ga0207708_10010934 3300026075 Bacteria 6750
277 Ga0207708_10043917 3300026075 Bacteria 3406
278 Ga0207702_10034674 3300026078 Bacteria 4220
279 Ga0207702_10334864 3300026078 Bacteria 1445
280 Ga0207702_10361866 3300026078 Bacteria 1391
281 Ga0207648_10072667 3300026089 Bacteria 2998
282 Ga0207648_10082203 3300026089 Bacteria 2809
283 Ga0207676_10094629 3300026095 Bacteria 2462
284 Ga0207674_10116485 3300026116 Bacteria 2643
285 Ga0207674_10145694 3300026116 Bacteria 2327
286 Ga0207675_100004204 3300026118 Bacteria 13932
287 Ga0207675_100023833 3300026118 Bacteria 5692
288 Ga0207675_100033785 3300026118 Bacteria 4766
289 Ga0207675_100036161 3300026118 Bacteria 4606
290 Ga0207675_100054993 3300026118 Bacteria 3713
291 Ga0207675_100059941 3300026118 Bacteria 3552
292 Ga0207683_10021759 3300026121 Bacteria 5497
293 Ga0207683_10021781 3300026121 Bacteria 5494
294 Ga0207683_10059033 3300026121 Bacteria 3369
295 Ga0207683_10269114 3300026121 Bacteria 1556
296 Ga0207698_10064020 3300026142 Bacteria 2880
297 Ga0207698_10344900 3300026142 Bacteria 1404
298 Ga0209813_10036718 3300027866 Bacteria 1473
299 Ga0207428_10217822 3300027907 Bacteria 1432
300 Ga0268266_10019475 3300028379 Bacteria 5781
301 Ga0268266_10023021 3300028379 Bacteria 5302
302 Ga0268266_10026846 3300028379 Bacteria 4899
303 Ga0268266_10054973 3300028379 Bacteria 3422
304 Ga0268266_10067889 3300028379 Bacteria 3087
305 Ga0268266_10167416 3300028379 Bacteria 1992
306 Ga0268265_10145997 3300028380 Bacteria 1988
307 Ga0268265_10188626 3300028380 Bacteria 1778
308 Ga0268264_10010003 3300028381 Bacteria 7852
309 Ga0268264_10015293 3300028381 Bacteria 6293
310 Ga0307515_10206916 3300028794 Bacteria 1819
311 Ga0265338_10024100 3300028800 Bacteria 6228
312 Ga0265332_10021658 3300031238 Bacteria 2839
313 Ga0265325_10000143 3300031241 Bacteria 50228
314 Ga0265325_10027291 3300031241 Bacteria 3086
315 Ga0265313_10000568 3300031595 Bacteria 38455
316 Ga0373938_0006025 3300034957 Bacteria 2079
317 Ga0373951_0012293 3300035091 Bacteria 1925
318 Ga0373931_0001594 3300035691 Bacteria 9807
319 Ga0373927_0173853 3300035695 Bacteria 1412
320 Ga0373925_0204002 3300037068 Bacteria 1573
321 Ga0373925_0222541 3300037068 Bacteria 1507
322 Ga0395899_0014364 3300037312 Bacteria 6045
323 Ga0395899_0068528 3300037312 Bacteria 2601
324 Ga0395900_0056762 3300037418 Bacteria 4030
325 Ga0395905_0004438 3300037471 Bacteria 14584
326 Ga0436364_0118331 3300037853 Bacteria 5101
327 Ga0436364_0272850 3300037853 Bacteria 4088
328 Ga0436364_0738835 3300037853 Bacteria 40799
329 Ga0436365_1042555 3300039437 Bacteria 63963
330 Ga0436365_1412134 3300039437 Bacteria 3002
331 Ga0436365_1525263 3300039437 Bacteria 2484
332 Ga0436365_1550976 3300039437 Bacteria 2230
333 Ga0436365_1883198 3300039437 Bacteria 2136
334 Ga0436360_0655839 3300039438 Bacteria 3845
335 Ga0436361_0652348 3300039447 Bacteria 2193
336 Ga0436363_0958888 3300039450 Bacteria 1515
337 Ga0436363_1415965 3300039450 Bacteria 1358
338 Ga0439436_0004164 3300041404 Bacteria 4432
339 Ga0439465_0000771 3300041413 Bacteria 9971
340 Ga0451833_1410512 3300041491 Bacteria 1902
341 Ga0451837_0599785 3300041494 Bacteria 2416
342 Ga0451841_0690309 3300041498 Bacteria 1549
343 Ga0439445_0009650 3300042004 Bacteria 2277
344 Ga0439449_0024929 3300042007 Bacteria 2235
345 Ga0439452_029705 3300042010 Bacteria 1354
346 Ga0466972_0001864 3300044658 Bacteria 10333
347 Ga0466973_0067901 3300044659 Bacteria 3191
348 Ga0466965_0010106 3300044683 Bacteria 4395
349 Ga0466965_0016694 3300044683 Bacteria 3498
350 Ga0466970_0011243 3300044765 Bacteria 4561
351 Ga0466957_0142136 3300044842 Bacteria 1547
352 Ga0466957_0213928 3300044842 Bacteria 1270
353 Ga0466960_0001509 3300044901 Bacteria 8473
354 Ga0495650_0001963 3300046471 Bacteria 18162
355 Ga0495673_0000142 3300047469 Bacteria 128538
356 Ga0495593_0000031 3300047673 Bacteria 59051
357 Ga0496100_0040547 3300048903 Bacteria 2963
358 Ga0496102_0144917 3300048905 Bacteria 2229
359 Ga0496102_0245578 3300048905 Bacteria 1688
360 Ga0496102_0293513 3300048905 Bacteria 1532
361 Ga0496105_0014836 3300048908 Bacteria 6203
362 Ga0496107_0257266 3300048910 Bacteria 1299
363 Ga0496108_0053038 3300048911 Bacteria 3399
364 Ga0496108_0058793 3300048911 Bacteria 3232
365 Ga0496108_0148079 3300048911 Bacteria 2025
366 Ga0496108_0182144 3300048911 Bacteria 1819
367 Ga0496109_0080177 3300048912 Bacteria 3007
368 Ga0496109_0218846 3300048912 Bacteria 1791
369 Ga0496109_0383089 3300048912 Bacteria 1328
370 Ga0496110_0028639 3300048913 Bacteria 4786
371 Ga0496110_0490014 3300048913 Bacteria 1120
372 Ga0496111_0146569 3300048914 Bacteria 1750
373 Ga0496112_0101007 3300048915 Bacteria 2854
374 Ga0496112_0180577 3300048915 Bacteria 2074
375 Ga0496113_0061250 3300048916 Bacteria 2839
376 Ga0496113_0118806 3300048916 Bacteria 2065
377 Ga0496114_0058210 3300048917 Bacteria 3226
378 Ga0496115_0009181 3300048918 Bacteria 7340
379 Ga0496115_0213164 3300048918 Bacteria 1595
380 Ga0496117_0024037 3300048920 Bacteria 4834
381 Ga0496121_0106034 3300048924 Bacteria 2155
382 Ga0496124_0050750 3300048927 Bacteria 3533
383 Ga0496126_0053150 3300048929 Bacteria 3677
384 Ga0501034_0002553 3300049571 Bacteria 21723
385 Ga0501034_0003758 3300049571 Bacteria 17151
386 Ga0501047_0000197 3300049581 Bacteria 72751
387 Ga0501044_0026648 3300049823 Bacteria 6118
388 nmdc:mga03n38_3525_c1 3300050490 Bacteria 5046
389 nmdc:mga0yw44_83094_c1 3300050492 Bacteria 2011
390 nmdc:mga05p37_380467_c1 3300050507 Bacteria 1654
391 nmdc:mga0qj67_243082_c1 3300050509 Unclassified 1460
392 nmdc:mga06r32_171627_c1 3300050510 Bacteria 2153
393 nmdc:mga06r32_468786_c1 3300050510 Unclassified 1238
394 nmdc:mga08y16_382869_c1 3300050511 Bacteria 1442
395 nmdc:mga0n895_5377_c1 3300050512 Bacteria 10686
396 nmdc:mga0rr50_55173_c1 3300050513 Bacteria 2964
397 nmdc:mga08x19_23684_c1 3300050514 Bacteria 3810
398 nmdc:mga0a205_12421_c1 3300050515 Bacteria 7877
399 Ga0500643_000283 3300053087 Bacteria 43805
400 Ga0500641_0002069 3300053096 Bacteria 7123
401 Ga0500559_0005376 3300053136 Bacteria 5894
402 Ga0500616_0000501 3300053153 Bacteria 50041
403 Ga0500552_001675 3300053733 Bacteria 2117
404 2513639954 2513237094 Bacteria 8789602
405 2513998812 2513237159 Bacteria 6810126
406 2524460788 2524023209 Bacteria 6679728
407 2530649575 2529292951 Bacteria 6916614
408 2616309937 2615840626 Bacteria 7921970
409 2643729799 2643221541 Bacteria 5498788
410 2644044160 2643221606 Bacteria 5588032
411 2644392627 2643221671 Bacteria 5496681
412 2720617040 2718218233 Bacteria 6662049
413 2778180036 2775507266 Bacteria 7392367
414 2778180342 2775507266 Bacteria 7392367
415 2792623693 2791355091 Bacteria 6135441
416 2792630075 2791355092 Bacteria 6248105
417 2793298014 2791355256 Bacteria 6798008
418 2793363078 2791355266 Bacteria 7116587
419 2805937440 2802429606 Bacteria 6346811
420 2806073435 2802429637 Bacteria 7067217
421 2838033428 2838029111 Bacteria 6603031
422 2841856442 2841851746 Bacteria 7532261
423 2841870071 2841864319 Bacteria 6742987
424 2842407816 2842402390 Bacteria 6681310
425 2842414395 2842409023 Bacteria 6687331
426 2842421244 2842415677 Bacteria 6596907
427 2842480302 2842475841 Bacteria 6603183
428 2842507714 2842502639 Bacteria 6604161
429 2842524030 2842521101 Bacteria 6569494
430 2881644818 2881644220 Bacteria 5302661
431 2895517200 2895511927 Bacteria 6802080
432 2902797818 2902792274 Bacteria 7270173
433 2933598315 2933594066 Bacteria 5594265
434 2990267620 2990265787 Bacteria 3943888
435 2993695144 2993693658 Bacteria 4040749
436 8005386622 8005382845 Bacteria 6732062
437 8005386888 8005382845 Bacteria 6732062
438 8005402114 8005395548 Bacteria 6806915
439 8054476839 8054472261 Bacteria 7464355
440 8056378881 8056375014 Bacteria 7006639
441 Ga0099795_10001217
442 LJQas_1005490
443 JGI24743J22301_10006860
444 JGI25405J52794_10002291
445 Ga0065707_10102908
446 Ga0070690_100098764
447 Ga0068869_100038884
448 Ga0070666_10016183
449 Ga0070682_100027143
450 Ga0070682_100104677
451 Ga0068868_100026771
452 Ga0068868_100070409
453 Ga0070660_100005561
454 Ga0070660_100044611
455 Ga0070660_100284030
456 Ga0070689_100039760
457 Ga0070689_100041960
458 Ga0070689_100126174
459 Ga0070689_100277010
460 Ga0070687_100013386
461 Ga0070687_100054661
462 Ga0070661_100107894
463 Ga0070692_10025642
464 Ga0070692_10166646
465 Ga0070668_100009944
466 Ga0070669_100025161
467 Ga0070669_100095360
468 Ga0070669_100118956
469 Ga0070671_100015954
470 Ga0070671_100035878
471 Ga0070671_100301417
472 Ga0070674_100035451
473 Ga0070674_100054821
474 Ga0070673_100109323
475 Ga0070673_100229635
476 Ga0070688_100038505
477 Ga0070688_100071668
478 Ga0070659_100024975
479 Ga0070659_100088827
480 Ga0070703_10001340
481 Ga0070709_10194575
482 Ga0070713_100025071
483 Ga0070713_100326192
484 Ga0070701_10049905
485 Ga0070711_100079163
486 Ga0070705_100036820
487 Ga0070705_100206555
488 Ga0070700_100046742
489 Ga0070700_100048595
490 Ga0070694_100010199
491 Ga0070708_100006235
492 Ga0070708_100009334
493 Ga0070663_100012433
494 Ga0070663_100030212
495 Ga0070678_100009334
496 Ga0070678_100010931
497 Ga0070678_100178359
498 Ga0068867_100070298
499 Ga0070685_10105583
500 Ga0070685_10106152
501 Ga0070706_100038564
502 Ga0070707_100012596
503 Ga0070707_100117822
504 Ga0070698_100095061
505 Ga0070699_100025256
506 Ga0070699_100043329
507 Ga0070679_100266861
508 Ga0070684_100082007
509 Ga0070697_100019807
510 Ga0070697_100314345
511 Ga0068853_100003774
512 Ga0068853_100242424
513 Ga0070686_100054525
514 Ga0070686_100272135
515 Ga0070695_100019322
516 Ga0070693_100001812
517 Ga0070665_100003842
518 Ga0070665_100011748
519 Ga0070665_100035776
520 Ga0070665_100068404
521 Ga0070665_100139344
522 Ga0070704_100003651
523 Ga0068855_100027382
524 Ga0068855_100375665
525 Ga0068854_100010730
526 Ga0068856_100005140
527 Ga0068856_100058828
528 Ga0068856_100068695
529 Ga0068856_100086806
530 Ga0068856_100138306
531 Ga0070702_100004157
532 Ga0068852_100005363
533 Ga0068852_100019385
534 Ga0068859_100041561
535 Ga0068864_100181864
536 Ga0068866_10059307
537 Ga0068866_10073805
538 Ga0068866_10137143
539 Ga0068861_100007932
540 Ga0068861_100038120
541 Ga0068870_10025117
542 Ga0068870_10058412
543 Ga0068863_100008223
544 Ga0068863_100099525
545 Ga0068863_100282938
546 Ga0068858_100098888
547 Ga0068858_100122991
548 Ga0068860_100014355
549 Ga0068860_100015949
550 Ga0068862_100051389
551 Ga0068862_100217254
552 Ga0081455_10000475
553 Ga0081455_10027126
554 Ga0081538_10019809
555 Ga0081540_1002495
556 Ga0081539_10000721
557 Ga0081539_10021880
558 Ga0070717_10002138
559 Ga0070717_10012028
560 Ga0070717_10039082
561 Ga0070717_10081275
562 Ga0075365_10028833
563 Ga0075363_100016802
564 Ga0075363_100033395
565 Ga0075432_10011113
566 Ga0070716_100017460
567 Ga0070712_100008465
568 Ga0075367_10080681
569 Ga0097621_100144588
570 Ga0075370_10122829
571 Ga0068871_100017910
572 Ga0075428_100152959
573 Ga0075431_100424023
574 Ga0075433_10003189
575 Ga0075434_100013828
576 Ga0075434_100185933
577 Ga0075429_100174016
578 Ga0068865_100274113
579 Ga0075436_100028579
580 Ga0097620_100041561
581 Ga0075435_100004222
582 Ga0075435_100331299
583 Ga0105251_10059275
584 Ga0105240_10001767
585 Ga0105240_10116493
586 Ga0105240_10319403
587 Ga0111539_10043118
588 Ga0111539_10106537
589 Ga0105245_10012978
590 Ga0105245_10014678
591 Ga0105245_10033074
592 Ga0105245_10248052
593 Ga0105247_10033883
594 Ga0114129_10100646
595 Ga0114129_10207176
596 Ga0114129_10512728
597 Ga0105243_10007381
598 Ga0105243_10018455
599 Ga0105243_10213408
600 Ga0105241_10017602
601 Ga0105242_10394088
602 Ga0105248_10001432
603 Ga0105248_10027678
604 Ga0105248_10084286
605 Ga0105237_10058747
606 Ga0105238_10032065
607 Ga0105238_10038921
608 Ga0105238_10110714
609 Ga0105249_10025125
610 Ga0105249_10031870
611 Ga0105249_10075779
612 Ga0123341_1015351
613 Ga0099796_10011134
614 Ga0105239_10001135
615 Ga0105239_10031716
616 Ga0105239_10374050
617 Ga0157373_10164527
618 Ga0157371_10089087
619 Ga0157370_10049461
620 Ga0157370_10295067
621 Ga0157369_10039446
622 Ga0157369_10365103
623 Ga0157374_10010323
624 Ga0157374_10267107
625 Ga0157374_10290934
626 Ga0157378_10003758
627 Ga0157378_10075323
628 Ga0163162_10030924
629 Ga0163162_10033151
630 Ga0163162_10059510
631 Ga0163162_10159284
632 Ga0163162_10184430
633 Ga0163162_10427368
634 Ga0157372_10380776
635 Ga0157375_10030889
636 Ga0157375_10151774
637 Ga0163163_10036820
638 Ga0163163_10095929
639 Ga0163163_10188969
640 Ga0157380_10101654
641 Ga0157380_10191842
642 Ga0182008_10001013
643 Ga0157379_10058676
644 Ga0157379_10095531
645 Ga0157379_10148740
646 Ga0157379_10203867
647 Ga0157379_10265366
648 Ga0157376_10010403
649 Ga0182007_10001065
650 Ga0163161_10001511
651 Ga0163161_10172991
652 Ga0206353_10932685
653 Ga0213876_10046842
654 Ga0213875_10008235
655 Ga0207426_1023380
656 Ga0207656_10038566
657 Ga0207653_10002888
658 Ga0207692_10025625
659 Ga0207710_10042179
660 Ga0207710_10042784
661 Ga0207688_10001251
662 Ga0207688_10065597
663 Ga0207680_10071594
664 Ga0207699_10011274
665 Ga0207645_10009286
666 Ga0207643_10017284
667 Ga0207684_10075279
668 Ga0207654_10102589
669 Ga0207695_10001621
670 Ga0207695_10034274
671 Ga0207693_10000561
672 Ga0207660_10138168
673 Ga0207660_10178453
674 Ga0207662_10008003
675 Ga0207662_10047649
676 Ga0207662_10052386
677 Ga0207657_10033533
678 Ga0207657_10081613
679 Ga0207652_10282765
680 Ga0207646_10029259
681 Ga0207694_10045205
682 Ga0207687_10010077
683 Ga0207687_10016746
684 Ga0207687_10043408
685 Ga0207700_10022204
686 Ga0207700_10074202
687 Ga0207700_10104648
688 Ga0207700_10240850
689 Ga0207706_10017871
690 Ga0207706_10067172
691 Ga0207709_10019104
692 Ga0207670_10054049
693 Ga0207670_10058769
694 Ga0207670_10181123
695 Ga0207669_10014433
696 Ga0207704_10010597
697 Ga0207665_10004366
698 Ga0207691_10214501
699 Ga0207711_10094331
700 Ga0207689_10070289
701 Ga0207661_10063609
702 Ga0207667_10378585
703 Ga0207651_10106423
704 Ga0207712_10002484
705 Ga0207712_10024661
706 Ga0207668_10005845
707 Ga0207668_10051955
708 Ga0207668_10478200
709 Ga0207640_10031153
710 Ga0207677_10091664
711 Ga0207677_10142232
712 Ga0207703_10291078
713 Ga0207678_10002838
714 Ga0207678_10017300
715 Ga0207678_10055616
716 Ga0207708_10010934
717 Ga0207708_10043917
718 Ga0207702_10034674
719 Ga0207702_10334864
720 Ga0207702_10361866
721 Ga0207648_10072667
722 Ga0207648_10082203
723 Ga0207676_10094629
724 Ga0207674_10116485
725 Ga0207674_10145694
726 Ga0207675_100004204
727 Ga0207675_100023833
728 Ga0207675_100033785
729 Ga0207675_100036161
730 Ga0207675_100054993
731 Ga0207675_100059941
732 Ga0207683_10021759
733 Ga0207683_10021781
734 Ga0207683_10059033
735 Ga0207683_10269114
736 Ga0207698_10064020
737 Ga0207698_10344900
738 Ga0209813_10036718
739 Ga0207428_10217822
740 Ga0268266_10019475
741 Ga0268266_10023021
742 Ga0268266_10026846
743 Ga0268266_10054973
744 Ga0268266_10067889
745 Ga0268266_10167416
746 Ga0268265_10145997
747 Ga0268265_10188626
748 Ga0268264_10010003
749 Ga0268264_10015293
750 Ga0307515_10206916
751 Ga0265338_10024100
752 Ga0265332_10021658
753 Ga0265325_10000143
754 Ga0265325_10027291
755 Ga0265313_10000568
756 Ga0373938_0006025
757 Ga0373951_0012293
758 Ga0373931_0001594
759 Ga0373927_0173853
760 Ga0373925_0204002
761 Ga0373925_0222541
762 Ga0395899_0014364
763 Ga0395899_0068528
764 Ga0395900_0056762
765 Ga0395905_0004438
766 Ga0436364_0118331
767 Ga0436364_0272850
768 Ga0436364_0738835
769 Ga0436365_1042555
770 Ga0436365_1412134
771 Ga0436365_1525263
772 Ga0436365_1550976
773 Ga0436365_1883198
774 Ga0436360_0655839
775 Ga0436361_0652348
776 Ga0436363_0958888
777 Ga0436363_1415965
778 Ga0439436_0004164
779 Ga0439465_0000771
780 Ga0451833_1410512
781 Ga0451837_0599785
782 Ga0451841_0690309
783 Ga0439445_0009650
784 Ga0439449_0024929
785 Ga0439452_029705
786 Ga0466972_0001864
787 Ga0466973_0067901
788 Ga0466965_0010106
789 Ga0466965_0016694
790 Ga0466970_0011243
791 Ga0466957_0142136
792 Ga0466957_0213928
793 Ga0466960_0001509
794 Ga0495650_0001963
795 Ga0495673_0000142
796 Ga0495593_0000031
797 Ga0496100_0040547
798 Ga0496102_0144917
799 Ga0496102_0245578
800 Ga0496102_0293513
801 Ga0496105_0014836
802 Ga0496107_0257266
803 Ga0496108_0053038
804 Ga0496108_0058793
805 Ga0496108_0148079
806 Ga0496108_0182144
807 Ga0496109_0080177
808 Ga0496109_0218846
809 Ga0496109_0383089
810 Ga0496110_0028639
811 Ga0496110_0490014
812 Ga0496111_0146569
813 Ga0496112_0101007
814 Ga0496112_0180577
815 Ga0496113_0061250
816 Ga0496113_0118806
817 Ga0496114_0058210
818 Ga0496115_0009181
819 Ga0496115_0213164
820 Ga0496117_0024037
821 Ga0496121_0106034
822 Ga0496124_0050750
823 Ga0496126_0053150
824 Ga0501034_0002553
825 Ga0501034_0003758
826 Ga0501047_0000197
827 Ga0501044_0026648
828 nmdc:mga03n38_3525_c1
829 nmdc:mga0yw44_83094_c1
830 nmdc:mga05p37_380467_c1
831 nmdc:mga0qj67_243082_c1
832 nmdc:mga06r32_171627_c1
833 nmdc:mga06r32_468786_c1
834 nmdc:mga08y16_382869_c1
835 nmdc:mga0n895_5377_c1
836 nmdc:mga0rr50_55173_c1
837 nmdc:mga08x19_23684_c1
838 nmdc:mga0a205_12421_c1
839 Ga0500643_000283
840 Ga0500641_0002069
841 Ga0500559_0005376
842 Ga0500616_0000501
843 Ga0500552_001675
844 2513639954
845 2513998812
846 2524460788
847 2530649575
848 2616309937
849 2643729799
850 2644044160
851 2644392627
852 2720617040
853 2778180036
854 2778180342
855 2792623693
856 2792630075
857 2793298014
858 2793363078
859 2805937440
860 2806073435
861 2838033428
862 2841856442
863 2841870071
864 2842407816
865 2842414395
866 2842421244
867 2842480302
868 2842507714
869 2842524030
870 2881644818
871 2895517200
872 2902797818
873 2933598315
874 2990267620
875 2993695144
876 8005386622
877 8005386888
878 8005402114
879 8054476839
880 8056378881

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

57

381

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sgn-assembly1.cif.gz_AAA crystal structure of monooxygenase ruta complexed with 2,4-dimethoxypyrimidine. 0.9138 40 386
6sgn-assembly1.cif.gz_AAA crystal structure of monooxygenase ruta complexed with 2,4-dimethoxypyrimidine. 0.9007 40 386
5wan-assembly1.cif.gz_A crystal structure of a flavoenzyme ruta in the pyrimidine catabolic pathway 0.8964 37 386
5w4z-assembly1.cif.gz_A crystal structure of riboflavin lyase (rcae) with modified fmn and substrate riboflavin 0.8828 39 391
5wan-assembly1.cif.gz_A crystal structure of a flavoenzyme ruta in the pyrimidine catabolic pathway 0.8791 37 386
ID Description Score Start End Superfamily
af_P75898_18_373_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8906 39 386 3.20.20.30
5w4zA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8828 39 391 3.20.20.30
af_P75898_18_373_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8689 39 386 3.20.20.30
1m41A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8669 40 385 3.20.20.30
af_A0A1D8PNW3_15_484_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8581 39 392 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A1E4IBN5-F1-model_v4 Monooxygenase 0.9871 36 392 GO:0004497
GO:0016705
AF-A0A1E4IBN5-F1-model_v4 Monooxygenase 0.9789 36 392 GO:0004497
GO:0016705
AF-B2IIZ9-F1-model_v4 Alkanesulfonate monooxygenase (EC 1.14.14.5) 0.9776 24 391 GO:0008726
GO:0046306
AF-A0A436IBG2-F1-model_v4 deleted 0.975 31 292
AF-A0A4R6VGH1-F1-model_v4 Alkanesulfonate monooxygenase SsuD/methylene tetrahydromethanopterin reductase-like flavin-dependent oxidoreductase (Luciferase family) 0.9748 28 391 GO:0004497
GO:0016705

Map