F444359

General Info

Members Datasets Scaffolds Average Seq Length
440 196 880 98

Family's Representative Sequence

Representative Sequence 3300005344|Ga0070661_101557758|Ga0070661_1015577582
Length 104
Sequence VPVVTLGGMTRGDVADFLAALILVYTICIVGWVVLSLVFSLGVRMPYNRVLNAVMDFLRDVSNPFLALFRKLPLRVGPLDLSPMVAIIVLQVGGGIIVSLIRGS

Samples

Sample ID Description Type Environment
1 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
135 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
136 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
141 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
142 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
145 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
146 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
147 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
174 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
177 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
180 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
181 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
182 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
183 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
194 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
195 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
196 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 3.41
Rhizosphere 94.77
Stem 0
Stem Tuber 0
Unclassified 10.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070661_101557758 3300005344 Bacteria 558
2 Ga0070676_10812366 3300005328 Bacteria 691
3 Ga0070676_10994417 3300005328 Bacteria 629
4 Ga0070683_100392186 3300005329 Bacteria 1324
5 Ga0070683_100812341 3300005329 Bacteria 896
6 Ga0070683_101169821 3300005329 Bacteria 739
7 Ga0068869_101211915 3300005334 Bacteria 664
8 Ga0070682_100547296 3300005337 Bacteria 905
9 Ga0070682_100626163 3300005337 Bacteria 853
10 Ga0070682_100932544 3300005337 Bacteria 716
11 Ga0070682_101689791 3300005337 Bacteria 550
12 Ga0068868_100029160 3300005338 Bacteria 4226
13 Ga0068868_101033857 3300005338 Archaea 753
14 Ga0070660_100121846 3300005339 Bacteria 2081
15 Ga0070660_101642702 3300005339 Unclassified 547
16 Ga0070691_10117654 3300005341 Bacteria 1335
17 Ga0070687_100040159 3300005343 Bacteria 2356
18 Ga0070692_10222121 3300005345 Unclassified 1117
19 Ga0070692_10229014 3300005345 Bacteria 1102
20 Ga0070692_10810851 3300005345 Unclassified 640
21 Ga0070692_11302097 3300005345 Archaea 521
22 Ga0070668_102165714 3300005347 Unclassified 514
23 Ga0070675_100860582 3300005354 Bacteria 830
24 Ga0070674_100063520 3300005356 Bacteria 2584
25 Ga0070674_100495765 3300005356 Bacteria 1016
26 Ga0070659_100092007 3300005366 Bacteria 2431
27 Ga0070659_101079681 3300005366 Bacteria 707
28 Ga0070659_101978085 3300005366 Bacteria 523
29 Ga0070701_10022099 3300005438 Bacteria 3046
30 Ga0070701_10508261 3300005438 Unclassified 783
31 Ga0070705_100350767 3300005440 Bacteria 1076
32 Ga0070700_100069942 3300005441 Bacteria 2236
33 Ga0070700_100374547 3300005441 Bacteria 1063
34 Ga0070700_100928291 3300005441 Unclassified 710
35 Ga0070663_100191630 3300005455 Bacteria 1591
36 Ga0070663_100482397 3300005455 Bacteria 1027
37 Ga0070678_100433736 3300005456 Bacteria 1148
38 Ga0070678_100635552 3300005456 Bacteria 956
39 Ga0070662_100190621 3300005457 Bacteria 1621
40 Ga0070662_102008813 3300005457 Unclassified 500
41 Ga0068867_100088510 3300005459 Bacteria 2346
42 Ga0068867_100311085 3300005459 Bacteria 1302
43 Ga0068867_100346137 3300005459 Bacteria 1239
44 Ga0068867_101876807 3300005459 Bacteria 564
45 Ga0070679_100338788 3300005530 Bacteria 1452
46 Ga0070679_102095507 3300005530 Bacteria 515
47 Ga0070684_100236746 3300005535 Bacteria 1667
48 Ga0070684_101162682 3300005535 Bacteria 726
49 Ga0068853_100541492 3300005539 Unclassified 1102
50 Ga0068853_101554014 3300005539 Bacteria 641
51 Ga0070672_100291321 3300005543 Bacteria 1382
52 Ga0070672_100798897 3300005543 Bacteria 830
53 Ga0070686_100072226 3300005544 Bacteria 2262
54 Ga0070686_100505831 3300005544 Bacteria 938
55 Ga0070696_100368027 3300005546 Bacteria 1117
56 Ga0070693_100092161 3300005547 Bacteria 1829
57 Ga0070665_100248385 3300005548 Bacteria 1780
58 Ga0070665_101993539 3300005548 Bacteria 586
59 Ga0070704_100177840 3300005549 Bacteria 1699
60 Ga0070664_101776854 3300005564 Bacteria 585
61 Ga0068854_100064188 3300005578 Bacteria 2668
62 Ga0068854_101419929 3300005578 Bacteria 628
63 Ga0068854_101795593 3300005578 Unclassified 562
64 Ga0068856_100669926 3300005614 Bacteria 1058
65 Ga0068856_101398428 3300005614 Bacteria 714
66 Ga0068856_101880687 3300005614 Bacteria 610
67 Ga0070702_100027196 3300005615 Bacteria 3083
68 Ga0070702_100696813 3300005615 Bacteria 774
69 Ga0068852_100112055 3300005616 Bacteria 2482
70 Ga0068852_100186925 3300005616 Bacteria 1952
71 Ga0068852_101040066 3300005616 Bacteria 838
72 Ga0068852_101152840 3300005616 Bacteria 796
73 Ga0068859_100617111 3300005617 Bacteria 1177
74 Ga0068864_100026044 3300005618 Bacteria 4930
75 Ga0068866_10277000 3300005718 Bacteria 1038
76 Ga0068866_10291648 3300005718 Unclassified 1015
77 Ga0068866_10399639 3300005718 Bacteria 886
78 Ga0068861_100337334 3300005719 Bacteria 1318
79 Ga0068861_100798061 3300005719 Bacteria 886
80 Ga0068851_10528200 3300005834 Bacteria 711
81 Ga0068870_10304617 3300005840 Unclassified 1007
82 Ga0068863_102727148 3300005841 Unclassified 503
83 Ga0068858_100643333 3300005842 Bacteria 1030
84 Ga0068860_100412238 3300005843 Bacteria 1338
85 Ga0068860_102095485 3300005843 Bacteria 587
86 Ga0081455_10123172 3300005937 Bacteria 2040
87 Ga0081455_10169029 3300005937 Bacteria 1668
88 Ga0081455_10257745 3300005937 Bacteria 1272
89 Ga0081538_10006477 3300005981 Bacteria 10303
90 Ga0081538_10008122 3300005981 Bacteria 8959
91 Ga0081538_10030506 3300005981 Bacteria 3659
92 Ga0081538_10152734 3300005981 Bacteria 1042
93 Ga0081539_10002877 3300005985 Bacteria 22840
94 Ga0081539_10115732 3300005985 Bacteria 1341
95 Ga0075365_10882063 3300006038 Bacteria 631
96 Ga0075363_100690777 3300006048 Bacteria 616
97 Ga0075432_10149482 3300006058 Bacteria 897
98 Ga0075432_10489884 3300006058 Unclassified 546
99 Ga0075367_10378096 3300006178 Bacteria 895
100 Ga0097621_100198119 3300006237 Bacteria 1742
101 Ga0097621_101528812 3300006237 Bacteria 634
102 Ga0075428_101487286 3300006844 Unclassified 710
103 Ga0075428_102284005 3300006844 Unclassified 557
104 Ga0075431_101093235 3300006847 Bacteria 762
105 Ga0075433_10667448 3300006852 Unclassified 911
106 Ga0075434_101313984 3300006871 Bacteria 734
107 Ga0075434_102138114 3300006871 Bacteria 564
108 Ga0075429_100404823 3300006880 Bacteria 1195
109 Ga0075429_100998650 3300006880 Bacteria 732
110 Ga0075429_101177655 3300006880 Bacteria 669
111 Ga0068865_100017959 3300006881 Bacteria 4558
112 Ga0097620_100617094 3300006931 Bacteria 1177
113 Ga0075435_101638148 3300007076 Unclassified 565
114 Ga0075435_101975380 3300007076 Bacteria 512
115 Ga0111539_10115764 3300009094 Bacteria 3143
116 Ga0111539_10495442 3300009094 Bacteria 1423
117 Ga0111539_10760416 3300009094 Unclassified 1128
118 Ga0111539_10899995 3300009094 Unclassified 1029
119 Ga0111539_11561359 3300009094 Bacteria 765
120 Ga0111539_12231387 3300009094 Bacteria 635
121 Ga0105245_10023779 3300009098 Bacteria 5379
122 Ga0105245_10292431 3300009098 Bacteria 1596
123 Ga0105245_10493357 3300009098 Bacteria 1240
124 Ga0105245_10550623 3300009098 Bacteria 1175
125 Ga0105245_10727701 3300009098 Bacteria 1027
126 Ga0105245_11250067 3300009098 Bacteria 791
127 Ga0105245_11632828 3300009098 Unclassified 696
128 Ga0105245_12631319 3300009098 Bacteria 556
129 Ga0114129_11080846 3300009147 Bacteria 1005
130 Ga0114129_11974830 3300009147 Bacteria 706
131 Ga0105243_10101669 3300009148 Bacteria 2387
132 Ga0105243_10244179 3300009148 Bacteria 1600
133 Ga0105243_11377377 3300009148 Bacteria 725
134 Ga0105243_11410053 3300009148 Unclassified 717
135 Ga0105242_11109341 3300009176 Bacteria 806
136 Ga0105242_12680961 3300009176 Bacteria 548
137 Ga0105248_10695714 3300009177 Bacteria 1147
138 Ga0105238_10918284 3300009551 Bacteria 894
139 Ga0105238_12484413 3300009551 Bacteria 554
140 Ga0105239_10434187 3300010375 Bacteria 1489
141 Ga0105239_11217905 3300010375 Bacteria 868
142 Ga0105246_10208548 3300011119 Bacteria 1524
143 Ga0105246_12603881 3300011119 Bacteria 500
144 Ga0157369_10870788 3300013105 Bacteria 924
145 Ga0157378_12154172 3300013297 Bacteria 608
146 Ga0163162_11072428 3300013306 Unclassified 912
147 Ga0157372_10736174 3300013307 Bacteria 1147
148 Ga0157372_13359666 3300013307 Bacteria 509
149 Ga0157375_10190520 3300013308 Bacteria 2205
150 Ga0157375_11415019 3300013308 Bacteria 819
151 Ga0163163_10100675 3300014325 Bacteria 2912
152 Ga0163163_11324233 3300014325 Bacteria 782
153 Ga0157380_10026774 3300014326 Bacteria 4381
154 Ga0157380_10260307 3300014326 Bacteria 1575
155 Ga0157380_10336176 3300014326 Bacteria 1407
156 Ga0157380_10467868 3300014326 Bacteria 1215
157 Ga0157380_12682999 3300014326 Bacteria 565
158 Ga0182008_10081264 3300014497 Bacteria 1595
159 Ga0157377_10128889 3300014745 Bacteria 1542
160 Ga0157377_10535888 3300014745 Unclassified 824
161 Ga0157377_10727560 3300014745 Bacteria 723
162 Ga0157377_10961817 3300014745 Bacteria 643
163 Ga0157379_10224981 3300014968 Bacteria 1700
164 Ga0157379_10456252 3300014968 Bacteria 1181
165 Ga0157379_10972637 3300014968 Unclassified 808
166 Ga0163161_10360707 3300017792 Bacteria 1157
167 Ga0163161_11676650 3300017792 Unclassified 562
168 Ga0207426_1068865 3300025302 Bacteria 993
169 Ga0207642_10428026 3300025899 Unclassified 797
170 Ga0207642_10970822 3300025899 Archaea 546
171 Ga0207688_10020943 3300025901 Bacteria 3570
172 Ga0207688_10178745 3300025901 Bacteria 1265
173 Ga0207688_10430564 3300025901 Bacteria 821
174 Ga0207645_10459476 3300025907 Bacteria 860
175 Ga0207643_10226704 3300025908 Bacteria 1145
176 Ga0207705_10670815 3300025909 Unclassified 806
177 Ga0207707_10378276 3300025912 Bacteria 1218
178 Ga0207660_10056545 3300025917 Bacteria 2807
179 Ga0207662_10141238 3300025918 Bacteria 1525
180 Ga0207662_10204197 3300025918 Bacteria 1280
181 Ga0207657_10087102 3300025919 Bacteria 2613
182 Ga0207694_10881808 3300025924 Bacteria 756
183 Ga0207694_10916077 3300025924 Bacteria 741
184 Ga0207687_10139942 3300025927 Bacteria 1835
185 Ga0207687_11495930 3300025927 Bacteria 580
186 Ga0207687_11572923 3300025927 Bacteria 564
187 Ga0207644_10280081 3300025931 Bacteria 1339
188 Ga0207690_10930917 3300025932 Bacteria 721
189 Ga0207706_10896930 3300025933 Unclassified 749
190 Ga0207686_10268883 3300025934 Bacteria 1253
191 Ga0207686_10388963 3300025934 Bacteria 1060
192 Ga0207709_10031467 3300025935 Bacteria 3099
193 Ga0207669_10396403 3300025937 Bacteria 1080
194 Ga0207704_10037783 3300025938 Bacteria 2793
195 Ga0207704_10357753 3300025938 Bacteria 1139
196 Ga0207704_11584782 3300025938 Bacteria 562
197 Ga0207691_10220847 3300025940 Bacteria 1643
198 Ga0207691_10265509 3300025940 Bacteria 1479
199 Ga0207689_10305132 3300025942 Bacteria 1320
200 Ga0207661_10194427 3300025944 Bacteria 1780
201 Ga0207661_10291128 3300025944 Bacteria 1462
202 Ga0207661_11016650 3300025944 Bacteria 763
203 Ga0207661_11338428 3300025944 Unclassified 658
204 Ga0207712_10195582 3300025961 Bacteria 1599
205 Ga0207712_10318806 3300025961 Bacteria 1282
206 Ga0207712_10394792 3300025961 Bacteria 1161
207 Ga0207640_10028071 3300025981 Bacteria 3436
208 Ga0207640_10136064 3300025981 Bacteria 1784
209 Ga0207677_10350864 3300026023 Bacteria 1236
210 Ga0207677_10770426 3300026023 Unclassified 859
211 Ga0207677_10892865 3300026023 Archaea 801
212 Ga0207677_11013194 3300026023 Bacteria 753
213 Ga0207703_10031040 3300026035 Bacteria 4224
214 Ga0207703_11207724 3300026035 Bacteria 727
215 Ga0207703_11366693 3300026035 Bacteria 681
216 Ga0207678_10200733 3300026067 Bacteria 1705
217 Ga0207678_10528165 3300026067 Bacteria 1030
218 Ga0207678_10619066 3300026067 Bacteria 950
219 Ga0207708_10013832 3300026075 Bacteria 6031
220 Ga0207708_10062470 3300026075 Bacteria 2845
221 Ga0207708_10069948 3300026075 Bacteria 2688
222 Ga0207708_10478625 3300026075 Bacteria 1041
223 Ga0207702_11492630 3300026078 Bacteria 669
224 Ga0207641_10549042 3300026088 Bacteria 1127
225 Ga0207648_10109587 3300026089 Bacteria 2424
226 Ga0207648_10158825 3300026089 Unclassified 1996
227 Ga0207648_10184238 3300026089 Bacteria 1849
228 Ga0207648_10194242 3300026089 Bacteria 1799
229 Ga0207676_10345793 3300026095 Bacteria 1374
230 Ga0207676_10912243 3300026095 Bacteria 862
231 Ga0207674_10742746 3300026116 Bacteria 947
232 Ga0207675_100014978 3300026118 Bacteria 7238
233 Ga0207675_100022239 3300026118 Bacteria 5905
234 Ga0207683_10654940 3300026121 Bacteria 973
235 Ga0207683_10780399 3300026121 Bacteria 887
236 Ga0207683_11229407 3300026121 Bacteria 694
237 Ga0207698_10090064 3300026142 Bacteria 2508
238 Ga0207698_10119731 3300026142 Bacteria 2225
239 Ga0207698_10268720 3300026142 Bacteria 1571
240 Ga0207698_10543190 3300026142 Bacteria 1138
241 Ga0207428_10030831 3300027907 Bacteria 4430
242 Ga0207428_10233950 3300027907 Bacteria 1374
243 Ga0207428_10329470 3300027907 Bacteria 1126
244 Ga0268266_10365141 3300028379 Bacteria 1359
245 Ga0268264_12677852 3300028381 Bacteria 503
246 Ga0307408_100357761 3300031548 Bacteria 1241
247 Ga0307408_101593586 3300031548 Bacteria 620
248 Ga0307405_10130231 3300031731 Bacteria 1737
249 Ga0307405_10380414 3300031731 Bacteria 1099
250 Ga0307405_12158051 3300031731 Bacteria 501
251 Ga0307413_10150777 3300031824 Bacteria 1620
252 Ga0307413_10206144 3300031824 Bacteria 1424
253 Ga0307413_10331794 3300031824 Bacteria 1166
254 Ga0307413_10561881 3300031824 Bacteria 927
255 Ga0307413_10942894 3300031824 Bacteria 736
256 Ga0307413_11220506 3300031824 Bacteria 655
257 Ga0307410_10759848 3300031852 Bacteria 821
258 Ga0307410_10792697 3300031852 Bacteria 805
259 Ga0307410_11513366 3300031852 Bacteria 591
260 Ga0307410_11663799 3300031852 Unclassified 565
261 Ga0307406_10214573 3300031901 Unclassified 1426
262 Ga0307406_10272701 3300031901 Bacteria 1286
263 Ga0307406_10738463 3300031901 Unclassified 825
264 Ga0307406_11425200 3300031901 Bacteria 608
265 Ga0307406_11490580 3300031901 Bacteria 595
266 Ga0307406_11659824 3300031901 Unclassified 566
267 Ga0307407_10169693 3300031903 Bacteria 1436
268 Ga0307407_10225301 3300031903 Bacteria 1270
269 Ga0307407_10254902 3300031903 Bacteria 1204
270 Ga0307407_10681368 3300031903 Unclassified 773
271 Ga0307407_10868971 3300031903 Bacteria 690
272 Ga0307412_11217926 3300031911 Bacteria 675
273 Ga0307412_11730134 3300031911 Bacteria 574
274 Ga0307409_100060661 3300031995 Bacteria 2951
275 Ga0307409_100104992 3300031995 Bacteria 2354
276 Ga0307409_100106509 3300031995 Bacteria 2340
277 Ga0307409_100284860 3300031995 Bacteria 1529
278 Ga0307409_100302582 3300031995 Bacteria 1488
279 Ga0307409_100305160 3300031995 Bacteria 1483
280 Ga0307409_101164283 3300031995 Bacteria 794
281 Ga0307409_101241156 3300031995 Bacteria 769
282 Ga0307409_102203839 3300031995 Bacteria 580
283 Ga0307409_102405641 3300031995 Bacteria 556
284 Ga0307409_102892009 3300031995 Bacteria 507
285 Ga0307416_100021666 3300032002 Bacteria 4620
286 Ga0307416_100123272 3300032002 Bacteria 2316
287 Ga0307416_100357281 3300032002 Bacteria 1481
288 Ga0307416_100381109 3300032002 Bacteria 1440
289 Ga0307416_100425022 3300032002 Bacteria 1374
290 Ga0307416_101137968 3300032002 Bacteria 886
291 Ga0307416_102755864 3300032002 Bacteria 588
292 Ga0307416_103231415 3300032002 Bacteria 545
293 Ga0307414_10445304 3300032004 Bacteria 1135
294 Ga0307414_11222516 3300032004 Bacteria 696
295 Ga0307414_11413297 3300032004 Bacteria 647
296 Ga0307411_10251481 3300032005 Bacteria 1390
297 Ga0307411_11701241 3300032005 Bacteria 584
298 Ga0307415_100040901 3300032126 Bacteria 3074
299 Ga0307415_100049783 3300032126 Bacteria 2835
300 Ga0307415_100063687 3300032126 Bacteria 2563
301 Ga0307415_100179868 3300032126 Bacteria 1658
302 Ga0307415_100373220 3300032126 Bacteria 1209
303 Ga0307415_100526539 3300032126 Bacteria 1038
304 Ga0307415_100655192 3300032126 Bacteria 942
305 Ga0307415_101388660 3300032126 Bacteria 668
306 Ga0395898_0093764 3300037466 Bacteria 2885
307 Ga0395901_0244461 3300038443 Bacteria 1871
308 Ga0395901_0308662 3300038443 Bacteria 1639
309 Ga0395901_1069830 3300038443 Bacteria 779
310 Ga0451802_0856517 3300041460 Bacteria 792
311 Ga0466972_0636665 3300044658 Unclassified 505
312 Ga0466965_0193264 3300044683 Bacteria 1077
313 Ga0466963_0075502 3300044694 Bacteria 2275
314 Ga0466963_0169865 3300044694 Bacteria 1520
315 Ga0466963_0348896 3300044694 Bacteria 1042
316 Ga0466964_0131111 3300044706 Unclassified 1142
317 Ga0466957_0758882 3300044842 Bacteria 687
318 Ga0466957_1415983 3300044842 Bacteria 506
319 Ga0466960_0027604 3300044901 Bacteria 2591
320 Ga0466960_0443997 3300044901 Bacteria 753
321 Ga0466960_0625729 3300044901 Bacteria 641
322 Ga0466967_0009711 3300045976 Bacteria 7163
323 Ga0466967_0051999 3300045976 Bacteria 3593
324 Ga0466967_0064350 3300045976 Bacteria 3261
325 Ga0466967_0070691 3300045976 Bacteria 3123
326 Ga0466967_0089214 3300045976 Bacteria 2799
327 Ga0466967_0124369 3300045976 Bacteria 2388
328 Ga0466967_0182848 3300045976 Bacteria 1978
329 Ga0466967_0283025 3300045976 Bacteria 1591
330 Ga0466967_0509906 3300045976 Bacteria 1181
331 Ga0466967_0622989 3300045976 Bacteria 1066
332 Ga0466967_0801627 3300045976 Unclassified 935
333 Ga0466967_0954203 3300045976 Bacteria 853
334 Ga0466967_0976555 3300045976 Unclassified 843
335 Ga0466967_1205022 3300045976 Bacteria 754
336 Ga0466967_1229879 3300045976 Bacteria 746
337 Ga0466967_1318220 3300045976 Bacteria 719
338 Ga0466967_2287148 3300045976 Bacteria 536
339 Ga0466967_2567529 3300045976 Bacteria 504
340 Ga0495605_0476797 3300046474 Unclassified 512
341 Ga0495584_0525988 3300046491 Bacteria 603
342 Ga0495596_0355950 3300046500 Bacteria 570
343 Ga0495620_0246378 3300046515 Bacteria 682
344 Ga0495631_0237121 3300046518 Bacteria 778
345 Ga0495643_0339027 3300046522 Bacteria 676
346 Ga0496102_0058176 3300048905 Bacteria 3532
347 Ga0496103_0386494 3300048906 Bacteria 899
348 Ga0496106_0045506 3300048909 Bacteria 3296
349 Ga0496107_0207214 3300048910 Bacteria 1458
350 Ga0496108_0357962 3300048911 Bacteria 1274
351 Ga0496108_0516512 3300048911 Bacteria 1043
352 Ga0496108_0796201 3300048911 Bacteria 816
353 Ga0496109_0176120 3300048912 Bacteria 2008
354 Ga0496110_0230076 3300048913 Bacteria 1686
355 Ga0496110_0807600 3300048913 Bacteria 842
356 Ga0496111_0980000 3300048914 Bacteria 606
357 Ga0496112_0055591 3300048915 Bacteria 3893
358 Ga0496112_1256292 3300048915 Bacteria 657
359 Ga0496115_1419429 3300048918 Bacteria 512
360 Ga0496121_0354728 3300048924 Bacteria 976
361 Ga0496123_0494184 3300048926 Bacteria 536
362 Ga0496126_0558282 3300048929 Bacteria 908
363 Ga0501031_0107307 3300049568 Bacteria 1823
364 Ga0501032_0131437 3300049569 Bacteria 1652
365 Ga0501032_0205751 3300049569 Bacteria 1284
366 Ga0501036_0045204 3300049572 Bacteria 3731
367 Ga0501036_0059758 3300049572 Bacteria 3230
368 Ga0501036_0082269 3300049572 Bacteria 2721
369 Ga0501037_0381248 3300049573 Bacteria 969
370 Ga0501038_0271530 3300049574 Bacteria 1337
371 Ga0501038_0317791 3300049574 Bacteria 1219
372 Ga0501039_0050132 3300049575 Bacteria 3229
373 Ga0501039_0070813 3300049575 Bacteria 2709
374 Ga0501039_0144620 3300049575 Bacteria 1868
375 Ga0501039_0321039 3300049575 Bacteria 1217
376 Ga0501039_1046624 3300049575 Bacteria 633
377 Ga0501040_0048664 3300049576 Bacteria 2897
378 Ga0501041_0021775 3300049577 Bacteria 3839
379 Ga0501041_0023877 3300049577 Bacteria 3668
380 Ga0501041_0131829 3300049577 Bacteria 1557
381 Ga0501042_0041125 3300049578 Bacteria 3286
382 Ga0501042_0153003 3300049578 Bacteria 1663
383 Ga0501042_0755067 3300049578 Bacteria 707
384 Ga0501042_0918667 3300049578 Bacteria 637
385 Ga0501043_0601237 3300049579 Bacteria 812
386 Ga0501043_0729716 3300049579 Bacteria 722
387 Ga0501046_0124874 3300049580 Bacteria 1956
388 Ga0501048_0082899 3300049582 Bacteria 2261
389 Ga0501048_0087614 3300049582 Bacteria 2196
390 Ga0501048_0119050 3300049582 Bacteria 1866
391 Ga0501067_0567550 3300049583 Bacteria 636
392 Ga0501068_0849635 3300049584 Unclassified 600
393 Ga0501069_0471707 3300049585 Bacteria 747
394 Ga0501070_0783642 3300049586 Bacteria 750
395 Ga0501071_0023032 3300049587 Bacteria 4346
396 Ga0501071_0038878 3300049587 Bacteria 3402
397 Ga0501071_0068833 3300049587 Bacteria 2576
398 Ga0501071_0111034 3300049587 Bacteria 2026
399 Ga0501072_0021239 3300049588 Bacteria 5035
400 Ga0501072_0057707 3300049588 Bacteria 3059
401 Ga0501072_0085042 3300049588 Bacteria 2508
402 Ga0501072_0237541 3300049588 Bacteria 1451
403 Ga0501074_0120658 3300049590 Bacteria 1875
404 Ga0501074_0144592 3300049590 Bacteria 1701
405 Ga0501075_0060488 3300049591 Bacteria 2854
406 Ga0501075_0122044 3300049591 Bacteria 1983
407 Ga0501075_0186447 3300049591 Bacteria 1582
408 Ga0501076_0026474 3300049592 Bacteria 4493
409 Ga0501076_0070279 3300049592 Bacteria 2799
410 Ga0501076_0248242 3300049592 Bacteria 1456
411 Ga0501076_0252164 3300049592 Bacteria 1444
412 Ga0501076_1092859 3300049592 Unclassified 657
413 Ga0501077_0345036 3300049593 Bacteria 950
414 Ga0501079_0179177 3300049741 Bacteria 1653
415 Ga0501079_0267822 3300049741 Bacteria 1335
416 Ga0501079_0299042 3300049741 Bacteria 1259
417 Ga0501080_0574097 3300049742 Bacteria 1003
418 Ga0501081_0028099 3300049743 Bacteria 3794
419 Ga0501081_0200993 3300049743 Bacteria 1445
420 Ga0501081_0371972 3300049743 Bacteria 1055
421 Ga0501035_0672163 3300049822 Unclassified 838
422 Ga0501044_0574718 3300049823 Bacteria 1022
423 Ga0501045_0016962 3300049824 Bacteria 5173
424 Ga0501045_0071643 3300049824 Bacteria 2551
425 Ga0501045_0548435 3300049824 Bacteria 858
426 nmdc:mga0yw44_929040_c1 3300050492 Bacteria 590
427 nmdc:mga05p37_870974_c1 3300050507 Unclassified 975
428 nmdc:mga08y16_125160_c1 3300050511 Bacteria 2674
429 nmdc:mga08y16_1543350_c1 3300050511 Bacteria 623
430 nmdc:mga08y16_976799_c1 3300050511 Unclassified 828
431 Ga0495655_0134790 3300053083 Bacteria 764
432 Ga0495655_0235264 3300053083 Unclassified 611
433 Ga0501084_0026793 3300054114 Bacteria 4814
434 Ga0501084_0034306 3300054114 Bacteria 4243
435 Ga0501084_0208874 3300054114 Bacteria 1647
436 Ga0590071_121462 3300059421 Bacteria 667
437 Ga0501082_0567041 3300060353 Bacteria 993
438 Ga0501082_0764657 3300060353 Bacteria 845
439 Ga0530510_0012011 3300061734 Bacteria 6074
440 Ga0530510_0115692 3300061734 Bacteria 1966
441 Ga0070661_101557758
442 Ga0070676_10812366
443 Ga0070676_10994417
444 Ga0070683_100392186
445 Ga0070683_100812341
446 Ga0070683_101169821
447 Ga0068869_101211915
448 Ga0070682_100547296
449 Ga0070682_100626163
450 Ga0070682_100932544
451 Ga0070682_101689791
452 Ga0068868_100029160
453 Ga0068868_101033857
454 Ga0070660_100121846
455 Ga0070660_101642702
456 Ga0070691_10117654
457 Ga0070687_100040159
458 Ga0070692_10222121
459 Ga0070692_10229014
460 Ga0070692_10810851
461 Ga0070692_11302097
462 Ga0070668_102165714
463 Ga0070675_100860582
464 Ga0070674_100063520
465 Ga0070674_100495765
466 Ga0070659_100092007
467 Ga0070659_101079681
468 Ga0070659_101978085
469 Ga0070701_10022099
470 Ga0070701_10508261
471 Ga0070705_100350767
472 Ga0070700_100069942
473 Ga0070700_100374547
474 Ga0070700_100928291
475 Ga0070663_100191630
476 Ga0070663_100482397
477 Ga0070678_100433736
478 Ga0070678_100635552
479 Ga0070662_100190621
480 Ga0070662_102008813
481 Ga0068867_100088510
482 Ga0068867_100311085
483 Ga0068867_100346137
484 Ga0068867_101876807
485 Ga0070679_100338788
486 Ga0070679_102095507
487 Ga0070684_100236746
488 Ga0070684_101162682
489 Ga0068853_100541492
490 Ga0068853_101554014
491 Ga0070672_100291321
492 Ga0070672_100798897
493 Ga0070686_100072226
494 Ga0070686_100505831
495 Ga0070696_100368027
496 Ga0070693_100092161
497 Ga0070665_100248385
498 Ga0070665_101993539
499 Ga0070704_100177840
500 Ga0070664_101776854
501 Ga0068854_100064188
502 Ga0068854_101419929
503 Ga0068854_101795593
504 Ga0068856_100669926
505 Ga0068856_101398428
506 Ga0068856_101880687
507 Ga0070702_100027196
508 Ga0070702_100696813
509 Ga0068852_100112055
510 Ga0068852_100186925
511 Ga0068852_101040066
512 Ga0068852_101152840
513 Ga0068859_100617111
514 Ga0068864_100026044
515 Ga0068866_10277000
516 Ga0068866_10291648
517 Ga0068866_10399639
518 Ga0068861_100337334
519 Ga0068861_100798061
520 Ga0068851_10528200
521 Ga0068870_10304617
522 Ga0068863_102727148
523 Ga0068858_100643333
524 Ga0068860_100412238
525 Ga0068860_102095485
526 Ga0081455_10123172
527 Ga0081455_10169029
528 Ga0081455_10257745
529 Ga0081538_10006477
530 Ga0081538_10008122
531 Ga0081538_10030506
532 Ga0081538_10152734
533 Ga0081539_10002877
534 Ga0081539_10115732
535 Ga0075365_10882063
536 Ga0075363_100690777
537 Ga0075432_10149482
538 Ga0075432_10489884
539 Ga0075367_10378096
540 Ga0097621_100198119
541 Ga0097621_101528812
542 Ga0075428_101487286
543 Ga0075428_102284005
544 Ga0075431_101093235
545 Ga0075433_10667448
546 Ga0075434_101313984
547 Ga0075434_102138114
548 Ga0075429_100404823
549 Ga0075429_100998650
550 Ga0075429_101177655
551 Ga0068865_100017959
552 Ga0097620_100617094
553 Ga0075435_101638148
554 Ga0075435_101975380
555 Ga0111539_10115764
556 Ga0111539_10495442
557 Ga0111539_10760416
558 Ga0111539_10899995
559 Ga0111539_11561359
560 Ga0111539_12231387
561 Ga0105245_10023779
562 Ga0105245_10292431
563 Ga0105245_10493357
564 Ga0105245_10550623
565 Ga0105245_10727701
566 Ga0105245_11250067
567 Ga0105245_11632828
568 Ga0105245_12631319
569 Ga0114129_11080846
570 Ga0114129_11974830
571 Ga0105243_10101669
572 Ga0105243_10244179
573 Ga0105243_11377377
574 Ga0105243_11410053
575 Ga0105242_11109341
576 Ga0105242_12680961
577 Ga0105248_10695714
578 Ga0105238_10918284
579 Ga0105238_12484413
580 Ga0105239_10434187
581 Ga0105239_11217905
582 Ga0105246_10208548
583 Ga0105246_12603881
584 Ga0157369_10870788
585 Ga0157378_12154172
586 Ga0163162_11072428
587 Ga0157372_10736174
588 Ga0157372_13359666
589 Ga0157375_10190520
590 Ga0157375_11415019
591 Ga0163163_10100675
592 Ga0163163_11324233
593 Ga0157380_10026774
594 Ga0157380_10260307
595 Ga0157380_10336176
596 Ga0157380_10467868
597 Ga0157380_12682999
598 Ga0182008_10081264
599 Ga0157377_10128889
600 Ga0157377_10535888
601 Ga0157377_10727560
602 Ga0157377_10961817
603 Ga0157379_10224981
604 Ga0157379_10456252
605 Ga0157379_10972637
606 Ga0163161_10360707
607 Ga0163161_11676650
608 Ga0207426_1068865
609 Ga0207642_10428026
610 Ga0207642_10970822
611 Ga0207688_10020943
612 Ga0207688_10178745
613 Ga0207688_10430564
614 Ga0207645_10459476
615 Ga0207643_10226704
616 Ga0207705_10670815
617 Ga0207707_10378276
618 Ga0207660_10056545
619 Ga0207662_10141238
620 Ga0207662_10204197
621 Ga0207657_10087102
622 Ga0207694_10881808
623 Ga0207694_10916077
624 Ga0207687_10139942
625 Ga0207687_11495930
626 Ga0207687_11572923
627 Ga0207644_10280081
628 Ga0207690_10930917
629 Ga0207706_10896930
630 Ga0207686_10268883
631 Ga0207686_10388963
632 Ga0207709_10031467
633 Ga0207669_10396403
634 Ga0207704_10037783
635 Ga0207704_10357753
636 Ga0207704_11584782
637 Ga0207691_10220847
638 Ga0207691_10265509
639 Ga0207689_10305132
640 Ga0207661_10194427
641 Ga0207661_10291128
642 Ga0207661_11016650
643 Ga0207661_11338428
644 Ga0207712_10195582
645 Ga0207712_10318806
646 Ga0207712_10394792
647 Ga0207640_10028071
648 Ga0207640_10136064
649 Ga0207677_10350864
650 Ga0207677_10770426
651 Ga0207677_10892865
652 Ga0207677_11013194
653 Ga0207703_10031040
654 Ga0207703_11207724
655 Ga0207703_11366693
656 Ga0207678_10200733
657 Ga0207678_10528165
658 Ga0207678_10619066
659 Ga0207708_10013832
660 Ga0207708_10062470
661 Ga0207708_10069948
662 Ga0207708_10478625
663 Ga0207702_11492630
664 Ga0207641_10549042
665 Ga0207648_10109587
666 Ga0207648_10158825
667 Ga0207648_10184238
668 Ga0207648_10194242
669 Ga0207676_10345793
670 Ga0207676_10912243
671 Ga0207674_10742746
672 Ga0207675_100014978
673 Ga0207675_100022239
674 Ga0207683_10654940
675 Ga0207683_10780399
676 Ga0207683_11229407
677 Ga0207698_10090064
678 Ga0207698_10119731
679 Ga0207698_10268720
680 Ga0207698_10543190
681 Ga0207428_10030831
682 Ga0207428_10233950
683 Ga0207428_10329470
684 Ga0268266_10365141
685 Ga0268264_12677852
686 Ga0307408_100357761
687 Ga0307408_101593586
688 Ga0307405_10130231
689 Ga0307405_10380414
690 Ga0307405_12158051
691 Ga0307413_10150777
692 Ga0307413_10206144
693 Ga0307413_10331794
694 Ga0307413_10561881
695 Ga0307413_10942894
696 Ga0307413_11220506
697 Ga0307410_10759848
698 Ga0307410_10792697
699 Ga0307410_11513366
700 Ga0307410_11663799
701 Ga0307406_10214573
702 Ga0307406_10272701
703 Ga0307406_10738463
704 Ga0307406_11425200
705 Ga0307406_11490580
706 Ga0307406_11659824
707 Ga0307407_10169693
708 Ga0307407_10225301
709 Ga0307407_10254902
710 Ga0307407_10681368
711 Ga0307407_10868971
712 Ga0307412_11217926
713 Ga0307412_11730134
714 Ga0307409_100060661
715 Ga0307409_100104992
716 Ga0307409_100106509
717 Ga0307409_100284860
718 Ga0307409_100302582
719 Ga0307409_100305160
720 Ga0307409_101164283
721 Ga0307409_101241156
722 Ga0307409_102203839
723 Ga0307409_102405641
724 Ga0307409_102892009
725 Ga0307416_100021666
726 Ga0307416_100123272
727 Ga0307416_100357281
728 Ga0307416_100381109
729 Ga0307416_100425022
730 Ga0307416_101137968
731 Ga0307416_102755864
732 Ga0307416_103231415
733 Ga0307414_10445304
734 Ga0307414_11222516
735 Ga0307414_11413297
736 Ga0307411_10251481
737 Ga0307411_11701241
738 Ga0307415_100040901
739 Ga0307415_100049783
740 Ga0307415_100063687
741 Ga0307415_100179868
742 Ga0307415_100373220
743 Ga0307415_100526539
744 Ga0307415_100655192
745 Ga0307415_101388660
746 Ga0395898_0093764
747 Ga0395901_0244461
748 Ga0395901_0308662
749 Ga0395901_1069830
750 Ga0451802_0856517
751 Ga0466972_0636665
752 Ga0466965_0193264
753 Ga0466963_0075502
754 Ga0466963_0169865
755 Ga0466963_0348896
756 Ga0466964_0131111
757 Ga0466957_0758882
758 Ga0466957_1415983
759 Ga0466960_0027604
760 Ga0466960_0443997
761 Ga0466960_0625729
762 Ga0466967_0009711
763 Ga0466967_0051999
764 Ga0466967_0064350
765 Ga0466967_0070691
766 Ga0466967_0089214
767 Ga0466967_0124369
768 Ga0466967_0182848
769 Ga0466967_0283025
770 Ga0466967_0509906
771 Ga0466967_0622989
772 Ga0466967_0801627
773 Ga0466967_0954203
774 Ga0466967_0976555
775 Ga0466967_1205022
776 Ga0466967_1229879
777 Ga0466967_1318220
778 Ga0466967_2287148
779 Ga0466967_2567529
780 Ga0495605_0476797
781 Ga0495584_0525988
782 Ga0495596_0355950
783 Ga0495620_0246378
784 Ga0495631_0237121
785 Ga0495643_0339027
786 Ga0496102_0058176
787 Ga0496103_0386494
788 Ga0496106_0045506
789 Ga0496107_0207214
790 Ga0496108_0357962
791 Ga0496108_0516512
792 Ga0496108_0796201
793 Ga0496109_0176120
794 Ga0496110_0230076
795 Ga0496110_0807600
796 Ga0496111_0980000
797 Ga0496112_0055591
798 Ga0496112_1256292
799 Ga0496115_1419429
800 Ga0496121_0354728
801 Ga0496123_0494184
802 Ga0496126_0558282
803 Ga0501031_0107307
804 Ga0501032_0131437
805 Ga0501032_0205751
806 Ga0501036_0045204
807 Ga0501036_0059758
808 Ga0501036_0082269
809 Ga0501037_0381248
810 Ga0501038_0271530
811 Ga0501038_0317791
812 Ga0501039_0050132
813 Ga0501039_0070813
814 Ga0501039_0144620
815 Ga0501039_0321039
816 Ga0501039_1046624
817 Ga0501040_0048664
818 Ga0501041_0021775
819 Ga0501041_0023877
820 Ga0501041_0131829
821 Ga0501042_0041125
822 Ga0501042_0153003
823 Ga0501042_0755067
824 Ga0501042_0918667
825 Ga0501043_0601237
826 Ga0501043_0729716
827 Ga0501046_0124874
828 Ga0501048_0082899
829 Ga0501048_0087614
830 Ga0501048_0119050
831 Ga0501067_0567550
832 Ga0501068_0849635
833 Ga0501069_0471707
834 Ga0501070_0783642
835 Ga0501071_0023032
836 Ga0501071_0038878
837 Ga0501071_0068833
838 Ga0501071_0111034
839 Ga0501072_0021239
840 Ga0501072_0057707
841 Ga0501072_0085042
842 Ga0501072_0237541
843 Ga0501074_0120658
844 Ga0501074_0144592
845 Ga0501075_0060488
846 Ga0501075_0122044
847 Ga0501075_0186447
848 Ga0501076_0026474
849 Ga0501076_0070279
850 Ga0501076_0248242
851 Ga0501076_0252164
852 Ga0501076_1092859
853 Ga0501077_0345036
854 Ga0501079_0179177
855 Ga0501079_0267822
856 Ga0501079_0299042
857 Ga0501080_0574097
858 Ga0501081_0028099
859 Ga0501081_0200993
860 Ga0501081_0371972
861 Ga0501035_0672163
862 Ga0501044_0574718
863 Ga0501045_0016962
864 Ga0501045_0071643
865 Ga0501045_0548435
866 nmdc:mga0yw44_929040_c1
867 nmdc:mga05p37_870974_c1
868 nmdc:mga08y16_125160_c1
869 nmdc:mga08y16_1543350_c1
870 nmdc:mga08y16_976799_c1
871 Ga0495655_0134790
872 Ga0495655_0235264
873 Ga0501084_0026793
874 Ga0501084_0034306
875 Ga0501084_0208874
876 Ga0590071_121462
877 Ga0501082_0567041
878 Ga0501082_0764657
879 Ga0530510_0012011
880 Ga0530510_0115692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02325

YGGT

YGGT family

19

98

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xzi-assembly1.cif.gz_D cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.5227 9 96
7xzi-assembly1.cif.gz_D cryo-em structure of toc-tic supercomplex from chlamydomonas reinhardtii 0.4569 9 96
5mto-assembly1.cif.gz_A n-terminal domain of the human tumor suppressor ing5 c19s mutant 0.4283 2 92
5m4y-assembly1.cif.gz_A crystal structure of the sec3/sso2 complex at 2.20 angstrom resolution 0.3946 3 90
5m4y-assembly2.cif.gz_C crystal structure of the sec3/sso2 complex at 2.20 angstrom resolution 0.393 3 90
ID Description Score Start End Superfamily
af_P38865_59_172_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5781 1 89 1.20.1070.10
af_P38865_59_172_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5369 1 89 1.20.1070.10
4i9qB04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.5052 6 96 1.10.287.690
4i9qB04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;B family DNA polymerase, finger domain 0.4788 6 96 1.10.287.690
af_P70452_38_164_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4542 1 94 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A6J4SDA6-F1-model_v4 Cell division integral membrane protein, YggT and half-length relatives 0.9593 2 96 GO:0016020
GO:0051301
AF-A0A6J4SDA6-F1-model_v4 Cell division integral membrane protein, YggT and half-length relatives 0.9401 2 96 GO:0016020
GO:0051301
AF-A0A7J9YTC2-F1-model_v4 YggT family protein 0.9311 4 96 GO:0016020
AF-A0A2T4UBE6-F1-model_v4 Cell division protein ZapA 0.927 2 95 GO:0016020
GO:0051301
AF-A0A538KMQ1-F1-model_v4 YggT family protein 0.9151 2 94 GO:0016020

Map