F444281

General Info

Members Datasets Scaffolds Average Seq Length
439 237 417 84

Family's Representative Sequence

Representative Sequence 3300046674|Ga0495588_0004432|Ga0495588_0004432_2356_2652
Length 98
Sequence MAAQNAPQGNEPLMAISQYDQFLQESTTKDPGSDHALGRDCLYGLYTSWCFLKQITPRPEDAFWAAMKEKQIHPKRTGLRMKGPAAADYILASYPGLV

Samples

Sample ID Description Type Environment
1 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
2 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
3 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
4 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
5 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
6 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
7 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
8 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
9 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
10 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
11 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
12 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
13 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
14 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
15 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
16 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
17 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
18 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
19 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
39 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
40 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
58 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
88 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
95 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
96 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
97 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
98 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
99 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
100 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
101 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
102 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
103 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
104 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
105 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
108 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
120 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
126 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
165 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
195 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
196 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
197 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
198 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
199 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
200 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
201 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059603 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 62R_AD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.95
Metatranscriptomes 15.03
Isolates 5.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.91
Nodule 0
Rhizoplane 7.97
Rhizosphere 86.79
Stem 0
Stem Tuber 0
Unclassified 4.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000937 3300000549 Bacteria 4523
2 LJQas_1002118 3300000549 Bacteria 2819
3 LJQas_1002313 3300000549 Bacteria 2673
4 JGI24035J26624_1015286 3300002126 Bacteria 786
5 Ga0055542_1006566 3300003762 Bacteria 2472
6 Ga0065714_10003943 3300005288 Bacteria 15011
7 Ga0065714_10024863 3300005288 Bacteria 1595
8 Ga0065714_10120012 3300005288 Bacteria 1359
9 Ga0065712_10160454 3300005290 Bacteria 1306
10 Ga0065712_10486088 3300005290 Bacteria 659
11 Ga0070676_10001684 3300005328 Bacteria 11221
12 Ga0070676_10461311 3300005328 Bacteria 895
13 Ga0070670_100233907 3300005331 Bacteria 1599
14 Ga0070670_100420586 3300005331 Bacteria 1181
15 Ga0070677_10015796 3300005333 Bacteria 2679
16 Ga0070677_10221001 3300005333 Bacteria 925
17 Ga0070666_10002892 3300005335 Bacteria 10367
18 Ga0070668_100018591 3300005347 Bacteria 5218
19 Ga0070669_100006953 3300005353 Bacteria 8128
20 Ga0070675_100003219 3300005354 Bacteria 12367
21 Ga0070673_100022905 3300005364 Bacteria 4556
22 Ga0070667_100022662 3300005367 Bacteria 5207
23 Ga0070663_100845947 3300005455 Bacteria 787
24 Ga0070678_100056435 3300005456 Bacteria 2872
25 Ga0070678_102325647 3300005456 Bacteria 509
26 Ga0070672_100598044 3300005543 Bacteria 960
27 Ga0070665_100128784 3300005548 Bacteria 2533
28 Ga0068870_10129486 3300005840 Bacteria 1464
29 Ga0075436_100219437 3300006914 Bacteria 1349
30 Ga0105251_10020828 3300009011 Bacteria 3438
31 Ga0105244_10288666 3300009036 Bacteria 760
32 Ga0105250_10472983 3300009092 Bacteria 565
33 Ga0105245_10191583 3300009098 Bacteria 1959
34 Ga0105245_11871984 3300009098 Bacteria 653
35 Ga0105247_10211026 3300009101 Bacteria 1310
36 Ga0105243_10003959 3300009148 Bacteria 11818
37 Ga0105243_11002729 3300009148 Unclassified 838
38 Ga0105243_11501217 3300009148 Bacteria 698
39 Ga0105243_11572292 3300009148 Bacteria 683
40 Ga0105248_10011701 3300009177 Bacteria 9673
41 Ga0105238_12590639 3300009551 Bacteria 543
42 Ga0105249_10441172 3300009553 Bacteria 1339
43 Ga0105246_10020612 3300011119 Bacteria 4230
44 Ga0105246_10036133 3300011119 Bacteria 3308
45 Ga0105246_12058074 3300011119 Bacteria 552
46 Ga0157373_10046707 3300013100 Bacteria 3089
47 Ga0157373_10559366 3300013100 Bacteria 830
48 Ga0157371_10038200 3300013102 Bacteria 3435
49 Ga0157369_10012352 3300013105 Bacteria 9695
50 Ga0157369_10033455 3300013105 Bacteria 5648
51 Ga0157369_10058431 3300013105 Bacteria 4160
52 Ga0157374_10826940 3300013296 Bacteria 943
53 Ga0163162_10007835 3300013306 Bacteria 10410
54 Ga0157375_10582912 3300013308 Bacteria 1279
55 Ga0157376_13096207 3300014969 Bacteria 504
56 Ga0163161_10180760 3300017792 Bacteria 1617
57 Ga0209148_1003508 3300025254 Bacteria 4292
58 Ga0207673_1044433 3300025290 Bacteria 626
59 Ga0207697_10000359 3300025315 Bacteria 25470
60 Ga0207697_10408611 3300025315 Unclassified 603
61 Ga0207655_1041465 3300025728 Bacteria 1972
62 Ga0207713_1007465 3300025735 Bacteria 6445
63 Ga0207682_10000797 3300025893 Bacteria 14552
64 Ga0207688_10071083 3300025901 Bacteria 1975
65 Ga0207645_10004818 3300025907 Bacteria 9914
66 Ga0207643_10239401 3300025908 Bacteria 1115
67 Ga0207650_10011546 3300025925 Bacteria 6084
68 Ga0207650_10333973 3300025925 Bacteria 1243
69 Ga0207659_10019126 3300025926 Bacteria 4501
70 Ga0207687_10453510 3300025927 Bacteria 1064
71 Ga0207709_10004550 3300025935 Bacteria 7993
72 Ga0207709_10620713 3300025935 Unclassified 858
73 Ga0207669_11360240 3300025937 Bacteria 604
74 Ga0207691_10221083 3300025940 Bacteria 1642
75 Ga0207711_10033419 3300025941 Bacteria 4352
76 Ga0207651_10507357 3300025960 Bacteria 1043
77 Ga0207668_10051447 3300025972 Bacteria 2845
78 Ga0207658_10135866 3300025986 Bacteria 1983
79 Ga0207678_10686883 3300026067 Bacteria 900
80 Ga0316181_1151807 3300030744 Bacteria 617
81 Ga0307408_100003688 3300031548 Bacteria 10438
82 Ga0307408_100016111 3300031548 Bacteria 4984
83 Ga0307408_100041724 3300031548 Bacteria 3254
84 Ga0307408_100091280 3300031548 Bacteria 2300
85 Ga0307408_100155032 3300031548 Bacteria 1812
86 Ga0307408_100214528 3300031548 Bacteria 1566
87 Ga0307408_100260643 3300031548 Bacteria 1434
88 Ga0307408_100271797 3300031548 Bacteria 1407
89 Ga0307408_100279605 3300031548 Bacteria 1389
90 Ga0307408_100334426 3300031548 Bacteria 1280
91 Ga0307408_100442348 3300031548 Bacteria 1126
92 Ga0307408_100574265 3300031548 Bacteria 998
93 Ga0307408_101247725 3300031548 Bacteria 695
94 Ga0307405_10044752 3300031731 Bacteria 2708
95 Ga0307405_10056264 3300031731 Bacteria 2466
96 Ga0307405_10062744 3300031731 Bacteria 2354
97 Ga0307405_10077729 3300031731 Bacteria 2158
98 Ga0307405_10080040 3300031731 Bacteria 2132
99 Ga0307405_10109937 3300031731 Bacteria 1865
100 Ga0307405_10128046 3300031731 Bacteria 1749
101 Ga0307405_10156590 3300031731 Bacteria 1608
102 Ga0307405_10160608 3300031731 Bacteria 1591
103 Ga0307405_10164471 3300031731 Bacteria 1576
104 Ga0307405_10290435 3300031731 Bacteria 1235
105 Ga0307405_10325709 3300031731 Bacteria 1175
106 Ga0307405_11318605 3300031731 Bacteria 628
107 Ga0307413_10009365 3300031824 Bacteria 4684
108 Ga0307413_10041626 3300031824 Bacteria 2691
109 Ga0307413_10272341 3300031824 Bacteria 1268
110 Ga0307413_10393327 3300031824 Bacteria 1084
111 Ga0307413_10901395 3300031824 Bacteria 751
112 Ga0307413_11414345 3300031824 Bacteria 612
113 Ga0307413_11922643 3300031824 Unclassified 532
114 Ga0307410_10008398 3300031852 Bacteria 5723
115 Ga0307410_10033719 3300031852 Bacteria 3307
116 Ga0307410_10103323 3300031852 Bacteria 2046
117 Ga0307410_10131247 3300031852 Bacteria 1841
118 Ga0307410_10194916 3300031852 Unclassified 1543
119 Ga0307410_10651413 3300031852 Bacteria 883
120 Ga0307410_10988318 3300031852 Bacteria 725
121 Ga0307410_11728683 3300031852 Unclassified 555
122 Ga0307410_12084819 3300031852 Bacteria 507
123 Ga0307406_10019506 3300031901 Bacteria 3980
124 Ga0307406_10023761 3300031901 Bacteria 3652
125 Ga0307406_10079355 3300031901 Bacteria 2177
126 Ga0307406_10177905 3300031901 Bacteria 1546
127 Ga0307406_10536194 3300031901 Bacteria 955
128 Ga0307406_10586132 3300031901 Bacteria 917
129 Ga0307406_10864080 3300031901 Bacteria 768
130 Ga0307407_10004061 3300031903 Bacteria 6145
131 Ga0307407_10014698 3300031903 Bacteria 3842
132 Ga0307407_10032277 3300031903 Bacteria 2845
133 Ga0307407_10044171 3300031903 Bacteria 2509
134 Ga0307407_10090107 3300031903 Bacteria 1877
135 Ga0307407_10436121 3300031903 Bacteria 948
136 Ga0307412_10001076 3300031911 Bacteria 15640
137 Ga0307412_10012880 3300031911 Bacteria 4886
138 Ga0307412_10025491 3300031911 Bacteria 3664
139 Ga0307412_10053404 3300031911 Bacteria 2678
140 Ga0307412_10086503 3300031911 Bacteria 2181
141 Ga0307412_10107564 3300031911 Bacteria 1985
142 Ga0307412_10193645 3300031911 Bacteria 1539
143 Ga0307412_10255682 3300031911 Bacteria 1362
144 Ga0307412_10327344 3300031911 Bacteria 1221
145 Ga0307412_10380142 3300031911 Bacteria 1143
146 Ga0307412_10489644 3300031911 Bacteria 1021
147 Ga0307412_10687741 3300031911 Bacteria 876
148 Ga0307412_10982595 3300031911 Bacteria 745
149 Ga0307412_11147625 3300031911 Bacteria 693
150 Ga0307412_12216745 3300031911 Bacteria 511
151 Ga0307409_100065029 3300031995 Bacteria 2868
152 Ga0307409_100071240 3300031995 Bacteria 2763
153 Ga0307409_100076597 3300031995 Bacteria 2683
154 Ga0307409_100188934 3300031995 Bacteria 1831
155 Ga0307409_100284754 3300031995 Bacteria 1529
156 Ga0307409_100318814 3300031995 Bacteria 1454
157 Ga0307409_100407937 3300031995 Bacteria 1300
158 Ga0307409_100701341 3300031995 Bacteria 1011
159 Ga0307409_100993081 3300031995 Bacteria 857
160 Ga0307409_101140989 3300031995 Bacteria 801
161 Ga0307409_101173958 3300031995 Bacteria 790
162 Ga0307409_101501234 3300031995 Bacteria 701
163 Ga0307416_100011437 3300032002 Bacteria 5920
164 Ga0307416_100017467 3300032002 Bacteria 5023
165 Ga0307416_100034428 3300032002 Bacteria 3855
166 Ga0307416_100142648 3300032002 Bacteria 2180
167 Ga0307416_100185783 3300032002 Bacteria 1953
168 Ga0307416_100228131 3300032002 Bacteria 1793
169 Ga0307416_100433304 3300032002 Bacteria 1362
170 Ga0307416_100836102 3300032002 Bacteria 1018
171 Ga0307416_100937064 3300032002 Bacteria 967
172 Ga0307416_101062889 3300032002 Bacteria 913
173 Ga0307414_10029377 3300032004 Bacteria 3578
174 Ga0307414_10236838 3300032004 Bacteria 1508
175 Ga0307414_10408717 3300032004 Bacteria 1181
176 Ga0307414_10927358 3300032004 Bacteria 799
177 Ga0307414_11110432 3300032004 Bacteria 730
178 Ga0307414_11365268 3300032004 Bacteria 658
179 Ga0307411_10212581 3300032005 Bacteria 1494
180 Ga0307411_10240653 3300032005 Bacteria 1416
181 Ga0307415_100063266 3300032126 Bacteria 2570
182 Ga0307415_100072477 3300032126 Bacteria 2426
183 Ga0307415_100331727 3300032126 Bacteria 1273
184 Ga0307415_100836295 3300032126 Bacteria 843
185 Ga0307415_101326409 3300032126 Bacteria 682
186 Ga0395899_0128858 3300037312 Bacteria 1808
187 Ga0395899_0185013 3300037312 Bacteria 1460
188 Ga0395899_0303183 3300037312 Bacteria 1080
189 Ga0395900_0230218 3300037418 Bacteria 1864
190 Ga0395900_0933074 3300037418 Bacteria 790
191 Ga0395900_1115736 3300037418 Bacteria 706
192 Ga0395898_0038802 3300037466 Bacteria 4717
193 Ga0395898_0422974 3300037466 Bacteria 1269
194 Ga0395905_0702082 3300037471 Bacteria 914
195 Ga0395901_0043302 3300038443 Bacteria 4670
196 Ga0395901_0112764 3300038443 Bacteria 2855
197 Ga0439436_0012676 3300041404 Bacteria 2558
198 Ga0439436_0021042 3300041404 Bacteria 1941
199 Ga0439438_027049 3300041405 Bacteria 1551
200 Ga0439439_0190896 3300041406 Unclassified 593
201 Ga0439466_0121825 3300041411 Bacteria 805
202 Ga0439433_0000898 3300041999 Bacteria 5928
203 Ga0439433_0047440 3300041999 Bacteria 1008
204 Ga0439432_188958 3300042006 Unclassified 599
205 Ga0439449_0019847 3300042007 Bacteria 2520
206 Ga0439452_120080 3300042010 Unclassified 560
207 Ga0439457_028678 3300042014 Bacteria 1232
208 Ga0439462_0002199 3300042015 Bacteria 4500
209 Ga0450907_017100 3300042146 Bacteria 1210
210 Ga0450908_016994 3300042184 Bacteria 1294
211 Ga0439434_0032747 3300042435 Bacteria 1583
212 Ga0450918_039243 3300042531 Bacteria 847
213 Ga0495629_0183191 3300046459 Bacteria 1451
214 Ga0495638_0400888 3300046460 Bacteria 712
215 Ga0495653_0012980 3300046463 Bacteria 6797
216 Ga0495580_0610519 3300046472 Bacteria 720
217 Ga0495580_0682429 3300046472 Bacteria 673
218 Ga0495582_0019086 3300046473 Bacteria 3752
219 Ga0495582_0480760 3300046473 Bacteria 718
220 Ga0495639_0011432 3300046475 Bacteria 3827
221 Ga0495639_0018558 3300046475 Bacteria 3030
222 Ga0495662_0007832 3300046476 Bacteria 5259
223 Ga0495664_0078769 3300046477 Bacteria 1974
224 Ga0495594_0254150 3300046499 Bacteria 1001
225 Ga0495630_0079103 3300046517 Bacteria 2480
226 Ga0495630_0613746 3300046517 Bacteria 834
227 Ga0495631_0044183 3300046518 Bacteria 1964
228 Ga0495643_0295788 3300046522 Bacteria 740
229 Ga0495642_0082447 3300046528 Bacteria 1356
230 Ga0495642_0084332 3300046528 Bacteria 1341
231 Ga0495665_0001325 3300046531 Bacteria 13203
232 Ga0495665_0018190 3300046531 Bacteria 3776
233 Ga0495665_0477181 3300046531 Bacteria 629
234 Ga0495586_0002603 3300046535 Bacteria 9756
235 Ga0495586_0037609 3300046535 Bacteria 2598
236 Ga0495586_0223587 3300046535 Bacteria 1070
237 Ga0495586_0244918 3300046535 Bacteria 1022
238 Ga0495586_0686189 3300046535 Unclassified 591
239 Ga0495587_0007020 3300046536 Bacteria 7313
240 Ga0495645_0008181 3300046543 Bacteria 7293
241 Ga0495633_0122065 3300046558 Bacteria 1207
242 Ga0495633_0247257 3300046558 Bacteria 814
243 Ga0495667_0006967 3300046559 Bacteria 7668
244 Ga0495656_0048875 3300046615 Bacteria 1799
245 Ga0495656_0587849 3300046615 Bacteria 595
246 Ga0495656_0606167 3300046615 Bacteria 586
247 Ga0495668_0022150 3300046616 Bacteria 3634
248 Ga0495635_0050455 3300046663 Bacteria 2868
249 Ga0495659_0010420 3300046664 Bacteria 2982
250 Ga0495588_0003785 3300046674 Bacteria 6628
251 Ga0495588_0004432 3300046674 Bacteria 6206
252 Ga0495588_0006270 3300046674 Bacteria 5349
253 Ga0495588_0029818 3300046674 Bacteria 2738
254 Ga0495588_0214546 3300046674 Bacteria 1016
255 Ga0495657_0366767 3300046675 Bacteria 850
256 Ga0495623_0018871 3300046679 Bacteria 4453
257 Ga0495669_0247897 3300046684 Bacteria 855
258 Ga0495670_0002988 3300046691 Bacteria 8341
259 Ga0495670_0048165 3300046691 Bacteria 2132
260 Ga0495670_0052921 3300046691 Bacteria 2033
261 Ga0495670_0390552 3300046691 Bacteria 751
262 Ga0495600_0060580 3300046809 Bacteria 2471
263 Ga0495600_0129935 3300046809 Bacteria 1638
264 Ga0495581_0009589 3300047315 Bacteria 5599
265 Ga0495581_0099283 3300047315 Bacteria 1691
266 Ga0495581_0355980 3300047315 Bacteria 854
267 Ga0495604_0191904 3300047317 Bacteria 1423
268 Ga0495636_0009838 3300047318 Bacteria 3766
269 Ga0495636_0277503 3300047318 Unclassified 780
270 Ga0495636_0623900 3300047318 Bacteria 528
271 Ga0495674_0284966 3300047319 Bacteria 1353
272 Ga0495680_0042945 3300047322 Bacteria 3584
273 Ga0495680_0391821 3300047322 Bacteria 960
274 Ga0495675_0080189 3300047444 Bacteria 2055
275 Ga0495677_0159224 3300047445 Unclassified 871
276 Ga0495677_0228141 3300047445 Bacteria 726
277 Ga0495685_056486 3300047447 Bacteria 1327
278 Ga0495684_0198521 3300047471 Bacteria 1480
279 Ga0495593_0095683 3300047673 Bacteria 1527
280 Ga0495593_0577191 3300047673 Bacteria 564
281 Ga0496100_0031994 3300048903 Bacteria 3275
282 Ga0496100_0147672 3300048903 Bacteria 1673
283 Ga0496100_1308154 3300048903 Bacteria 572
284 Ga0496101_0537959 3300048904 Bacteria 923
285 Ga0496102_0008132 3300048905 Bacteria 8975
286 Ga0496102_0015427 3300048905 Bacteria 6655
287 Ga0496102_0304278 3300048905 Bacteria 1502
288 Ga0496102_0378118 3300048905 Bacteria 1333
289 Ga0496102_0515951 3300048905 Bacteria 1117
290 Ga0496103_0022615 3300048906 Bacteria 3785
291 Ga0496103_0137173 3300048906 Bacteria 1563
292 Ga0496103_0151313 3300048906 Bacteria 1486
293 Ga0496104_0852442 3300048907 Bacteria 816
294 Ga0496105_0881512 3300048908 Bacteria 675
295 Ga0496106_0004849 3300048909 Bacteria 9956
296 Ga0496106_1232688 3300048909 Bacteria 582
297 Ga0496107_0153651 3300048910 Bacteria 1703
298 Ga0496107_0167273 3300048910 Bacteria 1630
299 Ga0496107_0431495 3300048910 Bacteria 979
300 Ga0496108_0067392 3300048911 Bacteria 3019
301 Ga0496108_0842165 3300048911 Bacteria 789
302 Ga0496109_0034501 3300048912 Bacteria 4557
303 Ga0496109_0133584 3300048912 Bacteria 2317
304 Ga0496109_0237303 3300048912 Bacteria 1715
305 Ga0496110_0010693 3300048913 Bacteria 7474
306 Ga0496110_0103684 3300048913 Bacteria 2551
307 Ga0496110_0471595 3300048913 Bacteria 1143
308 Ga0496110_1618943 3300048913 Bacteria 557
309 Ga0496111_0003996 3300048914 Bacteria 9255
310 Ga0496111_0060659 3300048914 Bacteria 2741
311 Ga0496111_0435055 3300048914 Bacteria 968
312 Ga0496113_0024263 3300048916 Bacteria 4307
313 Ga0496114_0062016 3300048917 Bacteria 3129
314 Ga0496114_0498237 3300048917 Bacteria 1077
315 Ga0496115_0030143 3300048918 Bacteria 4266
316 Ga0496116_0447301 3300048919 Bacteria 555
317 Ga0496119_0186488 3300048922 Bacteria 1084
318 Ga0496124_0035935 3300048927 Bacteria 4329
319 Ga0496125_0093808 3300048928 Bacteria 2239
320 Ga0496125_0245462 3300048928 Bacteria 1134
321 Ga0496126_0848598 3300048929 Bacteria 697
322 Ga0501306_054474 3300049127 Bacteria 648
323 Ga0501308_071849 3300049128 Unclassified 539
324 Ga0501310_068665 3300049130 Unclassified 539
325 Ga0501305_109277 3300049161 Unclassified 522
326 Ga0501307_076986 3300049162 Unclassified 540
327 Ga0501316_065227 3300049532 Unclassified 544
328 Ga0501317_085715 3300049533 Unclassified 551
329 Ga0501318_061550 3300049534 Bacteria 577
330 Ga0501318_061570 3300049534 Unclassified 577
331 Ga0501319_026517 3300049535 Unclassified 543
332 Ga0501319_028856 3300049535 Bacteria 527
333 Ga0501320_039387 3300049536 Bacteria 615
334 Ga0501321_068223 3300049537 Unclassified 549
335 Ga0501323_019122 3300049539 Bacteria 891
336 Ga0501323_038542 3300049539 Unclassified 694
337 Ga0501323_040966 3300049539 Bacteria 679
338 Ga0501323_041429 3300049539 Bacteria 676
339 Ga0501324_008321 3300049540 Bacteria 912
340 Ga0501324_024439 3300049540 Bacteria 633
341 Ga0501325_048200 3300049541 Unclassified 536
342 Ga0501329_13116 3300049545 Unclassified 543
343 Ga0501330_019135 3300049546 Unclassified 541
344 Ga0501331_01827 3300049547 Bacteria 1073
345 Ga0501334_23072 3300049550 Bacteria 508
346 Ga0501335_040313 3300049551 Unclassified 549
347 Ga0501335_051688 3300049551 Bacteria 502
348 Ga0501336_009575 3300049552 Bacteria 765
349 Ga0501340_025563 3300049556 Unclassified 515
350 Ga0501032_0007174 3300049569 Bacteria 8154
351 Ga0501032_0363938 3300049569 Bacteria 931
352 Ga0501036_0506470 3300049572 Bacteria 1004
353 Ga0501037_0015111 3300049573 Bacteria 5678
354 Ga0501037_0018012 3300049573 Bacteria 5200
355 Ga0501037_0046022 3300049573 Bacteria 3201
356 Ga0501038_0016854 3300049574 Bacteria 6612
357 Ga0501038_0103430 3300049574 Bacteria 2368
358 Ga0501038_0195155 3300049574 Bacteria 1627
359 Ga0501038_0515223 3300049574 Bacteria 913
360 Ga0501039_0005464 3300049575 Bacteria 9611
361 Ga0501039_0007011 3300049575 Bacteria 8579
362 Ga0501039_1304804 3300049575 Bacteria 560
363 Ga0501043_0051323 3300049579 Bacteria 3240
364 Ga0501043_0062145 3300049579 Bacteria 2932
365 Ga0501198_027372 3300049649 Bacteria 936
366 Ga0501216_012795 3300049660 Bacteria 1383
367 Ga0501216_025544 3300049660 Bacteria 1062
368 Ga0501217_131355 3300049661 Bacteria 735
369 Ga0501252_080773 3300049682 Bacteria 538
370 Ga0501221_071280 3300049704 Bacteria 821
371 Ga0501245_115102 3300049708 Bacteria 561
372 Ga0501269_033569 3300049766 Bacteria 665
373 Ga0501279_003007 3300049775 Bacteria 2192
374 Ga0501279_030390 3300049775 Bacteria 799
375 Ga0501279_074194 3300049775 Bacteria 577
376 Ga0501044_0166699 3300049823 Bacteria 2177
377 nmdc:mga06z11_836174_c1 3300050494 Bacteria 561
378 nmdc:mga04h51_205761_c1 3300050495 Bacteria 775
379 nmdc:mga08x19_1122751_c1 3300050514 Bacteria 558
380 Ga0587084_002582 3300059477 Bacteria 1897
381 Ga0587093_069971 3300059478 Unclassified 588
382 Ga0587070_051954 3300059491 Bacteria 821
383 Ga0587073_0033528 3300059492 Bacteria 1077
384 Ga0587073_0133575 3300059492 Unclassified 684
385 Ga0587080_017016 3300059503 Bacteria 1154
386 Ga0587083_0068308 3300059505 Bacteria 819
387 Ga0587085_021081 3300059506 Bacteria 992
388 Ga0587086_017635 3300059507 Bacteria 943
389 Ga0587088_036516 3300059508 Bacteria 906
390 Ga0587089_013949 3300059509 Unclassified 1045
391 Ga0587089_014057 3300059509 Bacteria 1042
392 Ga0587090_002553 3300059510 Bacteria 2018
393 Ga0587091_006954 3300059511 Bacteria 1612
394 Ga0587091_185563 3300059511 Unclassified 550
395 Ga0587092_022525 3300059512 Bacteria 986
396 Ga0587097_04656 3300059603 Unclassified 624
397 Ga0587098_007078 3300059604 Bacteria 1157
398 Ga0587098_039234 3300059604 Unclassified 683
399 Ga0587106_004535 3300059605 Bacteria 1534
400 Ga0587101_011483 3300059623 Bacteria 1134
401 Ga0587109_049267 3300059624 Bacteria 859
402 Ga0587117_008000 3300059627 Bacteria 1229
403 Ga0587117_030084 3300059627 Unclassified 814
404 Ga0587122_004008 3300059628 Bacteria 1168
405 Ga0587128_025764 3300059630 Bacteria 939
406 Ga0587062_006355 3300059639 Bacteria 1340
407 Ga0587067_048034 3300059640 Bacteria 854
408 Ga0587068_038145 3300059641 Bacteria 860
409 Ga0587069_027216 3300059642 Bacteria 901
410 Ga0587072_034231 3300059643 Bacteria 962
411 Ga0587072_161519 3300059643 Unclassified 548
412 Ga0587076_016479 3300059645 Bacteria 1167
413 Ga0587105_002297 3300059651 Unclassified 1081
414 Ga0587114_027723 3300059655 Bacteria 846
415 Ga0587120_011264 3300059659 Unclassified 767
416 Ga0587124_010149 3300059660 Bacteria 836
417 Ga0587111_0025298 3300060346 Bacteria 1175

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032005 Ga0307411_10240653 Ga0307411_102406531 79
2 iso_pu_bacteria 2919391150 2919394182 79
3 iso_pu_bacteria 2919391150 2919395557 79
4 iso_pu_bacteria 2945916053 2945918929 79
5 iso_pu_bacteria 2945956166 2945958865 79
6 iso_pu_bacteria 2946037020 2946039209 79
7 iso_pu_bacteria 2974302888 2974303780 79
8 iso_pu_bacteria 2775506735 2775657386 80
9 iso_pu_bacteria 2808606357 2808828868 80
10 iso_pu_bacteria 2808606360 2808850101 80
11 iso_pu_bacteria 2808606366 2808877346 80
12 iso_pu_bacteria 2808606370 2808893102 80
13 iso_pu_bacteria 2808606371 2808898821 80
14 iso_pu_bacteria 2811994871 2812319429 80
15 iso_pu_bacteria 2919391150 2919393852 80
16 iso_pu_bacteria 2939598168 2939602228 80
17 iso_pu_bacteria 2945916053 2945917181 80
18 iso_pu_bacteria 2945920336 2945922561 80
19 iso_pu_bacteria 2945941187 2945941274 80
20 iso_pu_bacteria 2946037020 2946037149 80
21 iso_pu_bacteria 2953998280 2953998405 80
22 iso_pu_bacteria 2974302888 2974305129 80
23 iso_pu_bacteria 2690315906 2691515719 81
24 3300031548 Ga0307408_100091280 Ga0307408_1000912805 83
25 3300031548 Ga0307408_100271797 Ga0307408_1002717971 83
26 3300031548 Ga0307408_101247725 Ga0307408_1012477251 83
27 3300031731 Ga0307405_10109937 Ga0307405_101099372 83
28 3300031731 Ga0307405_10128046 Ga0307405_101280462 83
29 3300031731 Ga0307405_10156590 Ga0307405_101565902 83
30 3300031731 Ga0307405_10164471 Ga0307405_101644713 83
31 3300031824 Ga0307413_10393327 Ga0307413_103933272 83
32 3300031852 Ga0307410_10131247 Ga0307410_101312471 83
33 3300031901 Ga0307406_10586132 Ga0307406_105861322 83
34 3300031903 Ga0307407_10014698 Ga0307407_100146984 83
35 3300031903 Ga0307407_10436121 Ga0307407_104361211 83
36 3300031911 Ga0307412_10012880 Ga0307412_100128803 83
37 3300031911 Ga0307412_10687741 Ga0307412_106877411 83
38 3300031911 Ga0307412_10982595 Ga0307412_109825952 83
39 3300031995 Ga0307409_100065029 Ga0307409_1000650292 83
40 3300031995 Ga0307409_100318814 Ga0307409_1003188142 83
41 3300031995 Ga0307409_100701341 Ga0307409_1007013411 83
42 3300031995 Ga0307409_100993081 Ga0307409_1009930811 83
43 3300032002 Ga0307416_100011437 Ga0307416_1000114376 83
44 3300032002 Ga0307416_100017467 Ga0307416_1000174675 83
45 3300032002 Ga0307416_100228131 Ga0307416_1002281312 83
46 3300032002 Ga0307416_100937064 Ga0307416_1009370641 83
47 3300032002 Ga0307416_101062889 Ga0307416_1010628891 83
48 3300032126 Ga0307415_100072477 Ga0307415_1000724774 83
49 3300032126 Ga0307415_100836295 Ga0307415_1008362951 83
50 3300037312 Ga0395899_0128858 Ga0395899_0128858_866_1117 83
51 3300037418 Ga0395900_0230218 Ga0395900_0230218_873_1124 83
52 3300037466 Ga0395898_0422974 Ga0395898_0422974_942_1193 83
53 3300049127 Ga0501306_054474 Ga0501306_054474_70_321 83
54 3300049128 Ga0501308_071849 Ga0501308_071849_67_339 83
55 3300049130 Ga0501310_068665 Ga0501310_068665_227_478 83
56 3300049161 Ga0501305_109277 Ga0501305_109277_44_295 83
57 3300049162 Ga0501307_076986 Ga0501307_076986_65_316 83
58 3300049532 Ga0501316_065227 Ga0501316_065227_224_475 83
59 3300049533 Ga0501317_085715 Ga0501317_085715_73_324 83
60 3300049534 Ga0501318_061570 Ga0501318_061570_70_321 83
61 3300049535 Ga0501319_026517 Ga0501319_026517_68_319 83
62 3300049536 Ga0501320_039387 Ga0501320_039387_71_322 83
63 3300049537 Ga0501321_068223 Ga0501321_068223_71_322 83
64 3300049539 Ga0501323_019122 Ga0501323_019122_342_593 83
65 3300049539 Ga0501323_038542 Ga0501323_038542_362_613 83
66 3300049539 Ga0501323_040966 Ga0501323_040966_390_641 83
67 3300049540 Ga0501324_008321 Ga0501324_008321_295_546 83
68 3300049541 Ga0501325_048200 Ga0501325_048200_70_321 83
69 3300049545 Ga0501329_13116 Ga0501329_13116_70_321 83
70 3300049546 Ga0501330_019135 Ga0501330_019135_68_319 83
71 3300049547 Ga0501331_01827 Ga0501331_01827_298_549 83
72 3300049550 Ga0501334_23072 Ga0501334_23072_104_355 83
73 3300049551 Ga0501335_040313 Ga0501335_040313_229_480 83
74 3300049552 Ga0501336_009575 Ga0501336_009575_298_549 83
75 3300049556 Ga0501340_025563 Ga0501340_025563_65_316 83
76 3300049573 Ga0501037_0018012 Ga0501037_0018012_1228_1479 83
77 3300049574 Ga0501038_0016854 Ga0501038_0016854_251_502 83
78 3300049575 Ga0501039_0005464 Ga0501039_0005464_2628_2879 83
79 3300049579 Ga0501043_0051323 Ga0501043_0051323_1179_1430 83
80 3300049649 Ga0501198_027372 Ga0501198_027372_82_333 83
81 3300049661 Ga0501217_131355 Ga0501217_131355_434_685 83
82 3300049775 Ga0501279_074194 Ga0501279_074194_139_390 83
83 3300059477 Ga0587084_002582 Ga0587084_002582_1082_1333 83
84 3300059478 Ga0587093_069971 Ga0587093_069971_68_319 83
85 3300059491 Ga0587070_051954 Ga0587070_051954_542_793 83
86 3300059492 Ga0587073_0033528 Ga0587073_0033528_556_807 83
87 3300059492 Ga0587073_0133575 Ga0587073_0133575_24_275 83
88 3300059503 Ga0587080_017016 Ga0587080_017016_557_808 83
89 3300059505 Ga0587083_0068308 Ga0587083_0068308_542_793 83
90 3300059506 Ga0587085_021081 Ga0587085_021081_177_428 83
91 3300059507 Ga0587086_017635 Ga0587086_017635_128_379 83
92 3300059508 Ga0587088_036516 Ga0587088_036516_90_341 83
93 3300059509 Ga0587089_013949 Ga0587089_013949_646_897 83
94 3300059509 Ga0587089_014057 Ga0587089_014057_236_487 83
95 3300059510 Ga0587090_002553 Ga0587090_002553_1203_1454 83
96 3300059511 Ga0587091_006954 Ga0587091_006954_571_822 83
97 3300059512 Ga0587092_022525 Ga0587092_022525_171_422 83
98 3300059603 Ga0587097_04656 Ga0587097_04656_329_580 83
99 3300059604 Ga0587098_007078 Ga0587098_007078_565_816 83
100 3300059605 Ga0587106_004535 Ga0587106_004535_702_953 83
101 3300059623 Ga0587101_011483 Ga0587101_011483_320_571 83
102 3300059624 Ga0587109_049267 Ga0587109_049267_44_295 83
103 3300059627 Ga0587117_008000 Ga0587117_008000_560_811 83
104 3300059627 Ga0587117_030084 Ga0587117_030084_412_663 83
105 3300059628 Ga0587122_004008 Ga0587122_004008_396_647 83
106 3300059630 Ga0587128_025764 Ga0587128_025764_124_375 83
107 3300059639 Ga0587062_006355 Ga0587062_006355_525_776 83
108 3300059640 Ga0587067_048034 Ga0587067_048034_44_295 83
109 3300059641 Ga0587068_038145 Ga0587068_038145_561_812 83
110 3300059642 Ga0587069_027216 Ga0587069_027216_129_380 83
111 3300059643 Ga0587072_034231 Ga0587072_034231_147_398 83
112 3300059645 Ga0587076_016479 Ga0587076_016479_352_603 83
113 3300059651 Ga0587105_002297 Ga0587105_002297_429_680 83
114 3300059655 Ga0587114_027723 Ga0587114_027723_565_816 83
115 3300059659 Ga0587120_011264 Ga0587120_011264_106_357 83
116 3300059660 Ga0587124_010149 Ga0587124_010149_21_272 83
117 3300060346 Ga0587111_0025298 Ga0587111_0025298_560_811 83
118 3300005288 Ga0065714_10024863 Ga0065714_100248632 84
119 3300005328 Ga0070676_10461311 Ga0070676_104613111 84
120 3300009148 Ga0105243_11002729 Ga0105243_110027291 84
121 3300011119 Ga0105246_10036133 Ga0105246_100361333 84
122 3300013105 Ga0157369_10012352 Ga0157369_100123527 84
123 3300013105 Ga0157369_10058431 Ga0157369_100584314 84
124 3300025315 Ga0207697_10408611 Ga0207697_104086111 84
125 3300025935 Ga0207709_10620713 Ga0207709_106207131 84
126 3300030744 Ga0316181_1151807 Ga0316181_11518071 84
127 3300031548 Ga0307408_100003688 Ga0307408_1000036884 84
128 3300031548 Ga0307408_100016111 Ga0307408_1000161114 84
129 3300031548 Ga0307408_100041724 Ga0307408_1000417241 84
130 3300031548 Ga0307408_100155032 Ga0307408_1001550322 84
131 3300031548 Ga0307408_100214528 Ga0307408_1002145281 84
132 3300031548 Ga0307408_100260643 Ga0307408_1002606432 84
133 3300031548 Ga0307408_100334426 Ga0307408_1003344262 84
134 3300031548 Ga0307408_100574265 Ga0307408_1005742651 84
135 3300031731 Ga0307405_10044752 Ga0307405_100447523 84
136 3300031731 Ga0307405_10056264 Ga0307405_100562644 84
137 3300031731 Ga0307405_10062744 Ga0307405_100627443 84
138 3300031731 Ga0307405_10080040 Ga0307405_100800402 84
139 3300031731 Ga0307405_10160608 Ga0307405_101606082 84
140 3300031731 Ga0307405_10325709 Ga0307405_103257091 84
141 3300031731 Ga0307405_11318605 Ga0307405_113186052 84
142 3300031824 Ga0307413_10009365 Ga0307413_100093654 84
143 3300031824 Ga0307413_10041626 Ga0307413_100416264 84
144 3300031824 Ga0307413_10901395 Ga0307413_109013951 84
145 3300031824 Ga0307413_11414345 Ga0307413_114143451 84
146 3300031824 Ga0307413_11922643 Ga0307413_119226432 84
147 3300031852 Ga0307410_10008398 Ga0307410_100083983 84
148 3300031852 Ga0307410_10033719 Ga0307410_100337193 84
149 3300031852 Ga0307410_10103323 Ga0307410_101033232 84
150 3300031852 Ga0307410_10194916 Ga0307410_101949161 84
151 3300031852 Ga0307410_10988318 Ga0307410_109883182 84
152 3300031852 Ga0307410_11728683 Ga0307410_117286831 84
153 3300031852 Ga0307410_12084819 Ga0307410_120848192 84
154 3300031901 Ga0307406_10019506 Ga0307406_100195064 84
155 3300031901 Ga0307406_10023761 Ga0307406_100237613 84
156 3300031901 Ga0307406_10079355 Ga0307406_100793552 84
157 3300031901 Ga0307406_10536194 Ga0307406_105361942 84
158 3300031901 Ga0307406_10864080 Ga0307406_108640802 84
159 3300031903 Ga0307407_10004061 Ga0307407_100040615 84
160 3300031903 Ga0307407_10032277 Ga0307407_100322774 84
161 3300031903 Ga0307407_10044171 Ga0307407_100441712 84
162 3300031903 Ga0307407_10090107 Ga0307407_100901073 84
163 3300031911 Ga0307412_10001076 Ga0307412_1000107616 84
164 3300031911 Ga0307412_10025491 Ga0307412_100254913 84
165 3300031911 Ga0307412_10086503 Ga0307412_100865031 84
166 3300031911 Ga0307412_10107564 Ga0307412_101075642 84
167 3300031911 Ga0307412_10255682 Ga0307412_102556822 84
168 3300031911 Ga0307412_10327344 Ga0307412_103273441 84
169 3300031911 Ga0307412_10489644 Ga0307412_104896442 84
170 3300031911 Ga0307412_11147625 Ga0307412_111476252 84
171 3300031911 Ga0307412_12216745 Ga0307412_122167452 84
172 3300031995 Ga0307409_100071240 Ga0307409_1000712403 84
173 3300031995 Ga0307409_100188934 Ga0307409_1001889342 84
174 3300031995 Ga0307409_100284754 Ga0307409_1002847542 84
175 3300031995 Ga0307409_100407937 Ga0307409_1004079371 84
176 3300031995 Ga0307409_101140989 Ga0307409_1011409891 84
177 3300031995 Ga0307409_101501234 Ga0307409_1015012342 84
178 3300032002 Ga0307416_100142648 Ga0307416_1001426482 84
179 3300032002 Ga0307416_100185783 Ga0307416_1001857832 84
180 3300032002 Ga0307416_100433304 Ga0307416_1004333042 84
181 3300032002 Ga0307416_100836102 Ga0307416_1008361022 84
182 3300032004 Ga0307414_10029377 Ga0307414_100293774 84
183 3300032004 Ga0307414_10236838 Ga0307414_102368382 84
184 3300032004 Ga0307414_10408717 Ga0307414_104087172 84
185 3300032004 Ga0307414_10927358 Ga0307414_109273582 84
186 3300032005 Ga0307411_10212581 Ga0307411_102125812 84
187 3300032126 Ga0307415_100063266 Ga0307415_1000632662 84
188 3300032126 Ga0307415_100331727 Ga0307415_1003317271 84
189 3300032126 Ga0307415_101326409 Ga0307415_1013264091 84
190 3300037312 Ga0395899_0185013 Ga0395899_0185013_948_1202 84
191 3300037312 Ga0395899_0303183 Ga0395899_0303183_813_1067 84
192 3300037418 Ga0395900_0933074 Ga0395900_0933074_67_321 84
193 3300037418 Ga0395900_1115736 Ga0395900_1115736_223_477 84
194 3300037466 Ga0395898_0038802 Ga0395898_0038802_3884_4138 84
195 3300037471 Ga0395905_0702082 Ga0395905_0702082_450_704 84
196 3300038443 Ga0395901_0043302 Ga0395901_0043302_4259_4513 84
197 3300038443 Ga0395901_0112764 Ga0395901_0112764_1224_1478 84
198 3300041404 Ga0439436_0012676 Ga0439436_0012676_706_960 84
199 3300041404 Ga0439436_0021042 Ga0439436_0021042_240_521 84
200 3300041405 Ga0439438_027049 Ga0439438_027049_664_945 84
201 3300041406 Ga0439439_0190896 Ga0439439_0190896_202_483 84
202 3300041411 Ga0439466_0121825 Ga0439466_0121825_60_341 84
203 3300041999 Ga0439433_0000898 Ga0439433_0000898_4977_5258 84
204 3300041999 Ga0439433_0047440 Ga0439433_0047440_16_270 84
205 3300042006 Ga0439432_188958 Ga0439432_188958_270_551 84
206 3300042007 Ga0439449_0019847 Ga0439449_0019847_1037_1318 84
207 3300042010 Ga0439452_120080 Ga0439452_120080_162_443 84
208 3300042014 Ga0439457_028678 Ga0439457_028678_742_1023 84
209 3300042015 Ga0439462_0002199 Ga0439462_0002199_2118_2399 84
210 3300042146 Ga0450907_017100 Ga0450907_017100_82_336 84
211 3300042435 Ga0439434_0032747 Ga0439434_0032747_570_851 84
212 3300042531 Ga0450918_039243 Ga0450918_039243_105_359 84
213 3300046528 Ga0495642_0082447 Ga0495642_0082447_632_889 84
214 3300046535 Ga0495586_0686189 Ga0495586_0686189_82_339 84
215 3300046674 Ga0495588_0029818 Ga0495588_0029818_1356_1613 84
216 3300046691 Ga0495670_0048165 Ga0495670_0048165_1177_1434 84
217 3300047318 Ga0495636_0277503 Ga0495636_0277503_81_338 84
218 3300047445 Ga0495677_0159224 Ga0495677_0159224_492_749 84
219 3300049539 Ga0501323_041429 Ga0501323_041429_134_388 84
220 3300049540 Ga0501324_024439 Ga0501324_024439_234_488 84
221 3300049569 Ga0501032_0007174 Ga0501032_0007174_1605_1859 84
222 3300049569 Ga0501032_0363938 Ga0501032_0363938_92_346 84
223 3300049572 Ga0501036_0506470 Ga0501036_0506470_33_287 84
224 3300049573 Ga0501037_0015111 Ga0501037_0015111_1447_1701 84
225 3300049574 Ga0501038_0103430 Ga0501038_0103430_522_776 84
226 3300049574 Ga0501038_0195155 Ga0501038_0195155_363_617 84
227 3300049574 Ga0501038_0515223 Ga0501038_0515223_578_832 84
228 3300049575 Ga0501039_0007011 Ga0501039_0007011_6804_7058 84
229 3300049575 Ga0501039_1304804 Ga0501039_1304804_190_444 84
230 3300049579 Ga0501043_0062145 Ga0501043_0062145_1015_1269 84
231 3300049660 Ga0501216_012795 Ga0501216_012795_650_904 84
232 3300049660 Ga0501216_025544 Ga0501216_025544_449_703 84
233 3300049682 Ga0501252_080773 Ga0501252_080773_34_288 84
234 3300049704 Ga0501221_071280 Ga0501221_071280_247_501 84
235 3300049708 Ga0501245_115102 Ga0501245_115102_156_410 84
236 3300049766 Ga0501269_033569 Ga0501269_033569_62_316 84
237 3300049775 Ga0501279_003007 Ga0501279_003007_463_717 84
238 3300049775 Ga0501279_030390 Ga0501279_030390_46_300 84
239 3300049823 Ga0501044_0166699 Ga0501044_0166699_928_1182 84
240 3300059511 Ga0587091_185563 Ga0587091_185563_130_384 84
241 3300059604 Ga0587098_039234 Ga0587098_039234_93_347 84
242 3300059643 Ga0587072_161519 Ga0587072_161519_130_384 84
243 3300000549 LJQas_1000937 LJQas_10009373 85
244 3300000549 LJQas_1002118 LJQas_10021182 85
245 3300000549 LJQas_1002313 LJQas_10023133 85
246 3300002126 JGI24035J26624_1015286 JGI24035J26624_10152861 85
247 3300003762 Ga0055542_1006566 Ga0055542_10065663 85
248 3300005288 Ga0065714_10003943 Ga0065714_1000394315 85
249 3300005288 Ga0065714_10120012 Ga0065714_101200123 85
250 3300005290 Ga0065712_10160454 Ga0065712_101604541 85
251 3300005290 Ga0065712_10486088 Ga0065712_104860881 85
252 3300005328 Ga0070676_10001684 Ga0070676_100016842 85
253 3300005331 Ga0070670_100233907 Ga0070670_1002339073 85
254 3300005331 Ga0070670_100420586 Ga0070670_1004205861 85
255 3300005333 Ga0070677_10015796 Ga0070677_100157963 85
256 3300005333 Ga0070677_10221001 Ga0070677_102210011 85
257 3300005335 Ga0070666_10002892 Ga0070666_100028927 85
258 3300005347 Ga0070668_100018591 Ga0070668_1000185916 85
259 3300005353 Ga0070669_100006953 Ga0070669_1000069536 85
260 3300005354 Ga0070675_100003219 Ga0070675_1000032192 85
261 3300005364 Ga0070673_100022905 Ga0070673_1000229055 85
262 3300005367 Ga0070667_100022662 Ga0070667_1000226627 85
263 3300005455 Ga0070663_100845947 Ga0070663_1008459471 85
264 3300005456 Ga0070678_100056435 Ga0070678_1000564352 85
265 3300005456 Ga0070678_102325647 Ga0070678_1023256471 85
266 3300005543 Ga0070672_100598044 Ga0070672_1005980442 85
267 3300005548 Ga0070665_100128784 Ga0070665_1001287842 85
268 3300005840 Ga0068870_10129486 Ga0068870_101294862 85
269 3300006914 Ga0075436_100219437 Ga0075436_1002194373 85
270 3300009011 Ga0105251_10020828 Ga0105251_100208286 85
271 3300009036 Ga0105244_10288666 Ga0105244_102886661 85
272 3300009092 Ga0105250_10472983 Ga0105250_104729832 85
273 3300009098 Ga0105245_10191583 Ga0105245_101915833 85
274 3300009098 Ga0105245_11871984 Ga0105245_118719841 85
275 3300009101 Ga0105247_10211026 Ga0105247_102110262 85
276 3300009148 Ga0105243_10003959 Ga0105243_1000395911 85
277 3300009148 Ga0105243_11501217 Ga0105243_115012171 85
278 3300009148 Ga0105243_11572292 Ga0105243_115722921 85
279 3300009177 Ga0105248_10011701 Ga0105248_1001170110 85
280 3300009551 Ga0105238_12590639 Ga0105238_125906392 85
281 3300009553 Ga0105249_10441172 Ga0105249_104411722 85
282 3300011119 Ga0105246_10020612 Ga0105246_100206121 85
283 3300011119 Ga0105246_12058074 Ga0105246_120580742 85
284 3300013100 Ga0157373_10046707 Ga0157373_100467071 85
285 3300013100 Ga0157373_10559366 Ga0157373_105593662 85
286 3300013102 Ga0157371_10038200 Ga0157371_100382006 85
287 3300013105 Ga0157369_10033455 Ga0157369_100334557 85
288 3300013296 Ga0157374_10826940 Ga0157374_108269401 85
289 3300013306 Ga0163162_10007835 Ga0163162_1000783515 85
290 3300013308 Ga0157375_10582912 Ga0157375_105829122 85
291 3300014969 Ga0157376_13096207 Ga0157376_130962071 85
292 3300017792 Ga0163161_10180760 Ga0163161_101807602 85
293 3300025254 Ga0209148_1003508 Ga0209148_10035084 85
294 3300025290 Ga0207673_1044433 Ga0207673_10444332 85
295 3300025315 Ga0207697_10000359 Ga0207697_1000035925 85
296 3300025728 Ga0207655_1041465 Ga0207655_10414651 85
297 3300025735 Ga0207713_1007465 Ga0207713_10074654 85
298 3300025893 Ga0207682_10000797 Ga0207682_100007972 85
299 3300025901 Ga0207688_10071083 Ga0207688_100710834 85
300 3300025907 Ga0207645_10004818 Ga0207645_100048185 85
301 3300025908 Ga0207643_10239401 Ga0207643_102394011 85
302 3300025925 Ga0207650_10011546 Ga0207650_100115464 85
303 3300025925 Ga0207650_10333973 Ga0207650_103339731 85
304 3300025926 Ga0207659_10019126 Ga0207659_100191261 85
305 3300025927 Ga0207687_10453510 Ga0207687_104535102 85
306 3300025935 Ga0207709_10004550 Ga0207709_100045507 85
307 3300025937 Ga0207669_11360240 Ga0207669_113602401 85
308 3300025940 Ga0207691_10221083 Ga0207691_102210832 85
309 3300025941 Ga0207711_10033419 Ga0207711_100334195 85
310 3300025960 Ga0207651_10507357 Ga0207651_105073571 85
311 3300025972 Ga0207668_10051447 Ga0207668_100514472 85
312 3300025986 Ga0207658_10135866 Ga0207658_101358661 85
313 3300026067 Ga0207678_10686883 Ga0207678_106868832 85
314 3300031548 Ga0307408_100279605 Ga0307408_1002796052 85
315 3300031548 Ga0307408_100442348 Ga0307408_1004423481 85
316 3300031731 Ga0307405_10077729 Ga0307405_100777291 85
317 3300031731 Ga0307405_10290435 Ga0307405_102904351 85
318 3300031824 Ga0307413_10272341 Ga0307413_102723411 85
319 3300031852 Ga0307410_10651413 Ga0307410_106514131 85
320 3300031901 Ga0307406_10177905 Ga0307406_101779052 85
321 3300031911 Ga0307412_10053404 Ga0307412_100534042 85
322 3300031911 Ga0307412_10193645 Ga0307412_101936452 85
323 3300031911 Ga0307412_10380142 Ga0307412_103801422 85
324 3300031995 Ga0307409_100076597 Ga0307409_1000765972 85
325 3300031995 Ga0307409_101173958 Ga0307409_1011739581 85
326 3300032002 Ga0307416_100034428 Ga0307416_1000344285 85
327 3300032004 Ga0307414_11110432 Ga0307414_111104321 85
328 3300032004 Ga0307414_11365268 Ga0307414_113652681 85
329 3300042184 Ga0450908_016994 Ga0450908_016994_946_1224 85
330 3300046459 Ga0495629_0183191 Ga0495629_0183191_719_976 85
331 3300046460 Ga0495638_0400888 Ga0495638_0400888_325_582 85
332 3300046463 Ga0495653_0012980 Ga0495653_0012980_5742_5999 85
333 3300046472 Ga0495580_0610519 Ga0495580_0610519_115_372 85
334 3300046472 Ga0495580_0682429 Ga0495580_0682429_138_395 85
335 3300046473 Ga0495582_0019086 Ga0495582_0019086_2803_3060 85
336 3300046473 Ga0495582_0480760 Ga0495582_0480760_291_548 85
337 3300046475 Ga0495639_0011432 Ga0495639_0011432_1123_1380 85
338 3300046475 Ga0495639_0018558 Ga0495639_0018558_2422_2679 85
339 3300046476 Ga0495662_0007832 Ga0495662_0007832_2498_2755 85
340 3300046477 Ga0495664_0078769 Ga0495664_0078769_1142_1399 85
341 3300046499 Ga0495594_0254150 Ga0495594_0254150_697_954 85
342 3300046517 Ga0495630_0079103 Ga0495630_0079103_1834_2091 85
343 3300046517 Ga0495630_0613746 Ga0495630_0613746_526_783 85
344 3300046518 Ga0495631_0044183 Ga0495631_0044183_1471_1728 85
345 3300046522 Ga0495643_0295788 Ga0495643_0295788_234_491 85
346 3300046528 Ga0495642_0084332 Ga0495642_0084332_626_883 85
347 3300046531 Ga0495665_0001325 Ga0495665_0001325_162_419 85
348 3300046531 Ga0495665_0018190 Ga0495665_0018190_138_395 85
349 3300046531 Ga0495665_0477181 Ga0495665_0477181_16_273 85
350 3300046535 Ga0495586_0002603 Ga0495586_0002603_1163_1420 85
351 3300046535 Ga0495586_0037609 Ga0495586_0037609_1143_1400 85
352 3300046535 Ga0495586_0223587 Ga0495586_0223587_168_425 85
353 3300046535 Ga0495586_0244918 Ga0495586_0244918_409_666 85
354 3300046536 Ga0495587_0007020 Ga0495587_0007020_2566_2823 85
355 3300046543 Ga0495645_0008181 Ga0495645_0008181_6151_6408 85
356 3300046558 Ga0495633_0122065 Ga0495633_0122065_385_642 85
357 3300046558 Ga0495633_0247257 Ga0495633_0247257_109_366 85
358 3300046559 Ga0495667_0006967 Ga0495667_0006967_1468_1725 85
359 3300046615 Ga0495656_0048875 Ga0495656_0048875_868_1125 85
360 3300046615 Ga0495656_0587849 Ga0495656_0587849_150_407 85
361 3300046615 Ga0495656_0606167 Ga0495656_0606167_210_467 85
362 3300046616 Ga0495668_0022150 Ga0495668_0022150_3128_3385 85
363 3300046663 Ga0495635_0050455 Ga0495635_0050455_788_1045 85
364 3300046664 Ga0495659_0010420 Ga0495659_0010420_2277_2534 85
365 3300046674 Ga0495588_0003785 Ga0495588_0003785_590_847 85
366 3300046674 Ga0495588_0004432 Ga0495588_0004432_2356_2652 85
367 3300046674 Ga0495588_0006270 Ga0495588_0006270_4263_4520 85
368 3300046674 Ga0495588_0214546 Ga0495588_0214546_441_698 85
369 3300046675 Ga0495657_0366767 Ga0495657_0366767_275_532 85
370 3300046679 Ga0495623_0018871 Ga0495623_0018871_591_848 85
371 3300046684 Ga0495669_0247897 Ga0495669_0247897_567_824 85
372 3300046691 Ga0495670_0002988 Ga0495670_0002988_4495_4752 85
373 3300046691 Ga0495670_0052921 Ga0495670_0052921_1085_1342 85
374 3300046691 Ga0495670_0390552 Ga0495670_0390552_145_402 85
375 3300046809 Ga0495600_0060580 Ga0495600_0060580_570_827 85
376 3300046809 Ga0495600_0129935 Ga0495600_0129935_618_875 85
377 3300047315 Ga0495581_0009589 Ga0495581_0009589_608_865 85
378 3300047315 Ga0495581_0099283 Ga0495581_0099283_1256_1513 85
379 3300047315 Ga0495581_0355980 Ga0495581_0355980_574_831 85
380 3300047317 Ga0495604_0191904 Ga0495604_0191904_119_376 85
381 3300047318 Ga0495636_0009838 Ga0495636_0009838_2820_3077 85
382 3300047318 Ga0495636_0623900 Ga0495636_0623900_28_285 85
383 3300047319 Ga0495674_0284966 Ga0495674_0284966_176_433 85
384 3300047322 Ga0495680_0042945 Ga0495680_0042945_2587_2844 85
385 3300047322 Ga0495680_0391821 Ga0495680_0391821_80_337 85
386 3300047444 Ga0495675_0080189 Ga0495675_0080189_1229_1486 85
387 3300047445 Ga0495677_0228141 Ga0495677_0228141_144_401 85
388 3300047447 Ga0495685_056486 Ga0495685_056486_736_993 85
389 3300047471 Ga0495684_0198521 Ga0495684_0198521_201_458 85
390 3300047673 Ga0495593_0095683 Ga0495593_0095683_1221_1478 85
391 3300047673 Ga0495593_0577191 Ga0495593_0577191_251_508 85
392 3300048903 Ga0496100_0031994 Ga0496100_0031994_121_378 85
393 3300048903 Ga0496100_0147672 Ga0496100_0147672_1342_1599 85
394 3300048903 Ga0496100_1308154 Ga0496100_1308154_80_337 85
395 3300048904 Ga0496101_0537959 Ga0496101_0537959_293_550 85
396 3300048905 Ga0496102_0008132 Ga0496102_0008132_3544_3801 85
397 3300048905 Ga0496102_0015427 Ga0496102_0015427_5739_5996 85
398 3300048905 Ga0496102_0304278 Ga0496102_0304278_233_490 85
399 3300048905 Ga0496102_0378118 Ga0496102_0378118_925_1182 85
400 3300048905 Ga0496102_0515951 Ga0496102_0515951_113_370 85
401 3300048906 Ga0496103_0022615 Ga0496103_0022615_2174_2431 85
402 3300048906 Ga0496103_0137173 Ga0496103_0137173_678_935 85
403 3300048906 Ga0496103_0151313 Ga0496103_0151313_428_685 85
404 3300048907 Ga0496104_0852442 Ga0496104_0852442_45_302 85
405 3300048908 Ga0496105_0881512 Ga0496105_0881512_374_631 85
406 3300048909 Ga0496106_0004849 Ga0496106_0004849_3417_3674 85
407 3300048909 Ga0496106_1232688 Ga0496106_1232688_75_332 85
408 3300048910 Ga0496107_0153651 Ga0496107_0153651_971_1228 85
409 3300048910 Ga0496107_0167273 Ga0496107_0167273_858_1115 85
410 3300048910 Ga0496107_0431495 Ga0496107_0431495_45_302 85
411 3300048911 Ga0496108_0067392 Ga0496108_0067392_1106_1363 85
412 3300048911 Ga0496108_0842165 Ga0496108_0842165_113_370 85
413 3300048912 Ga0496109_0034501 Ga0496109_0034501_785_1042 85
414 3300048912 Ga0496109_0133584 Ga0496109_0133584_1136_1393 85
415 3300048912 Ga0496109_0237303 Ga0496109_0237303_23_280 85
416 3300048913 Ga0496110_0010693 Ga0496110_0010693_5226_5483 85
417 3300048913 Ga0496110_0103684 Ga0496110_0103684_2020_2277 85
418 3300048913 Ga0496110_0471595 Ga0496110_0471595_579_836 85
419 3300048913 Ga0496110_1618943 Ga0496110_1618943_107_364 85
420 3300048914 Ga0496111_0003996 Ga0496111_0003996_2078_2335 85
421 3300048914 Ga0496111_0060659 Ga0496111_0060659_2132_2389 85
422 3300048914 Ga0496111_0435055 Ga0496111_0435055_341_598 85
423 3300048916 Ga0496113_0024263 Ga0496113_0024263_3976_4233 85
424 3300048917 Ga0496114_0062016 Ga0496114_0062016_2736_2993 85
425 3300048917 Ga0496114_0498237 Ga0496114_0498237_776_1033 85
426 3300048918 Ga0496115_0030143 Ga0496115_0030143_3177_3434 85
427 3300048919 Ga0496116_0447301 Ga0496116_0447301_62_319 85
428 3300048922 Ga0496119_0186488 Ga0496119_0186488_627_884 85
429 3300048927 Ga0496124_0035935 Ga0496124_0035935_3610_3867 85
430 3300048928 Ga0496125_0093808 Ga0496125_0093808_858_1115 85
431 3300048928 Ga0496125_0245462 Ga0496125_0245462_593_850 85
432 3300048929 Ga0496126_0848598 Ga0496126_0848598_379_636 85
433 3300049534 Ga0501318_061550 Ga0501318_061550_301_558 85
434 3300049535 Ga0501319_028856 Ga0501319_028856_154_411 85
435 3300049551 Ga0501335_051688 Ga0501335_051688_75_332 85
436 3300049573 Ga0501037_0046022 Ga0501037_0046022_316_573 85
437 3300050494 nmdc:mga06z11_836174_c1 nmdc:mga06z11_836174_c1_143_400 85
438 3300050495 nmdc:mga04h51_205761_c1 nmdc:mga04h51_205761_c1_94_351 85
439 3300050514 nmdc:mga08x19_1122751_c1 nmdc:mga08x19_1122751_c1_187_444 85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qby-assembly1.cif.gz_B crystal structure of a heterodimer of cdc6/orc1 initiators bound to origin dna (from s. solfataricus) 0.7772 3 59
8iqh-assembly1.cif.gz_C structure of full-length asfvprimpol in apo-form 0.747 8 71
8iqh-assembly1.cif.gz_D structure of full-length asfvprimpol in apo-form 0.7227 7 71
1dp7-assembly1.cif.gz_P-2 cocrystal structure of rfx-dbd in complex with its cognate x-box binding site 0.6574 8 70
8iqi-assembly1.cif.gz_E structure of full-length asfvprimpol in complex-form 0.6086 8 72
ID Description Score Start End Superfamily
af_Q59V88_283_356_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6925 8 69 1.10.10.10
af_E9Q7E2_524_603_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.683 8 70 1.10.10.10
af_Q09555_260_334_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6823 8 69 1.10.10.10
af_D3ZHD7_91_167_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6757 6 69 1.10.10.10
1dp7P00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.6574 8 70 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A5J6MLN2-F1-model_v4 Phage protein 0.9369 4 60 GO:0016787
AF-A0A844MAA4-F1-model_v4 DUF3854 domain-containing protein 0.9267 4 56
AF-A0A1W2EKC1-F1-model_v4 Putative DNA primase/helicase 0.9249 4 58 GO:0004386
GO:0016787
AF-A0A4R5KB88-F1-model_v4 DNA primase/nucleoside triphosphatase C-terminal domain-containing protein 0.9244 5 73
AF-A0A2W5KU41-F1-model_v4 SF3 helicase domain-containing protein 0.9236 4 57 GO:0004386
GO:0005524
GO:0016787

Feature Viewer

pLDDT pTM Quality
69.36 0.54 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map