F444223

General Info

Members Datasets Scaffolds Average Seq Length
439 236 878 151

Family's Representative Sequence

Representative Sequence 3300026067|Ga0207678_10150903|Ga0207678_101509032
Length 171
Sequence MTSHRTVFNHVGLCVADRERSCRFYEGLLGFQFWWELELPDEGTEQLLQLAKPIGVRATYLMRDGLVLELIDYSKRDVHVGPERVMDQVGLTHLSLSVSNLGDVLAMVDGFGGSVVKETVTKQFAMIRDPDGQLIELLPDSWLAAIPPRPRNYCNHYVRSGTVIACRPLRM

Samples

Sample ID Description Type Environment
1 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
165 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
166 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
167 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
168 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
169 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
170 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
182 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.74
Nodule 0
Rhizoplane 9.11
Rhizosphere 81.78
Stem 0
Stem Tuber 0
Unclassified 2.96

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207678_10150903 3300026067 Bacteria 1984
2 JGI24737J22298_10104822 3300001990 Bacteria 837
3 JGI24750J21931_1011444 3300002070 Bacteria 1167
4 JGI24745J21846_1010621 3300002073 Bacteria 1049
5 JGI24738J21930_10025192 3300002075 Bacteria 1223
6 JGI24744J21845_10002655 3300002077 Bacteria 3650
7 JGI24744J21845_10002998 3300002077 Bacteria 3462
8 JGI24742J22300_10002000 3300002244 Bacteria 3247
9 JGI24751J29686_10096904 3300002459 Bacteria 615
10 Ga0070676_10010632 3300005328 Bacteria 4992
11 Ga0070676_10359905 3300005328 Bacteria 1002
12 Ga0070683_100088228 3300005329 Bacteria 2910
13 Ga0070690_100009449 3300005330 Bacteria 5647
14 Ga0070670_100239317 3300005331 Bacteria 1580
15 Ga0070670_100666605 3300005331 Bacteria 934
16 Ga0068869_100084411 3300005334 Bacteria 2377
17 Ga0068869_100457704 3300005334 Bacteria 1058
18 Ga0070666_10923904 3300005335 Bacteria 646
19 Ga0070682_100008365 3300005337 Bacteria 5835
20 Ga0070682_100945152 3300005337 Bacteria 711
21 Ga0068868_100002274 3300005338 Bacteria 13266
22 Ga0068868_100077320 3300005338 Bacteria 2662
23 Ga0068868_101240365 3300005338 Bacteria 691
24 Ga0070660_100188492 3300005339 Bacteria 1670
25 Ga0070660_100560822 3300005339 Bacteria 953
26 Ga0070689_100005403 3300005340 Bacteria 8717
27 Ga0070691_10013866 3300005341 Bacteria 3699
28 Ga0070691_10215705 3300005341 Bacteria 1015
29 Ga0070692_10081253 3300005345 Bacteria 1746
30 Ga0070692_10087795 3300005345 Bacteria 1686
31 Ga0070668_100009862 3300005347 Bacteria 7074
32 Ga0070668_100055553 3300005347 Bacteria 3057
33 Ga0070668_100071201 3300005347 Bacteria 2708
34 Ga0070668_101372327 3300005347 Bacteria 644
35 Ga0070669_100269089 3300005353 Bacteria 1362
36 Ga0070669_100375450 3300005353 Bacteria 1159
37 Ga0070671_100018937 3300005355 Bacteria 5596
38 Ga0070674_100000470 3300005356 Bacteria 20285
39 Ga0070688_100285922 3300005365 Bacteria 1187
40 Ga0070667_100002949 3300005367 Bacteria 14622
41 Ga0070667_100029857 3300005367 Bacteria 4545
42 Ga0070667_100531694 3300005367 Bacteria 1079
43 Ga0070667_100554686 3300005367 Bacteria 1056
44 Ga0070667_100840756 3300005367 Bacteria 853
45 Ga0070709_10106652 3300005434 Bacteria 1876
46 Ga0070709_10151733 3300005434 Bacteria 1602
47 Ga0070714_100678608 3300005435 Bacteria 993
48 Ga0070713_100364620 3300005436 Bacteria 1343
49 Ga0070713_100517779 3300005436 Bacteria 1127
50 Ga0070710_10062002 3300005437 Bacteria 2131
51 Ga0070701_10011352 3300005438 Bacteria 3979
52 Ga0070701_10056518 3300005438 Bacteria 2053
53 Ga0070711_100000636 3300005439 Bacteria 18312
54 Ga0070711_100036818 3300005439 Bacteria 3280
55 Ga0070711_101447687 3300005439 Bacteria 598
56 Ga0070705_100002459 3300005440 Bacteria 9317
57 Ga0070705_100357815 3300005440 Bacteria 1067
58 Ga0070700_100001014 3300005441 Bacteria 13882
59 Ga0070694_100063975 3300005444 Bacteria 2517
60 Ga0070678_100000312 3300005456 Bacteria 22599
61 Ga0070678_100363018 3300005456 Bacteria 1248
62 Ga0070662_100016085 3300005457 Bacteria 5019
63 Ga0070662_100761675 3300005457 Bacteria 821
64 Ga0068867_100000491 3300005459 Bacteria 26406
65 Ga0070685_10139421 3300005466 Bacteria 1525
66 Ga0070685_10570270 3300005466 Bacteria 811
67 Ga0070707_100341271 3300005468 Bacteria 1455
68 Ga0070684_100126203 3300005535 Bacteria 2305
69 Ga0068853_100004841 3300005539 Bacteria 10464
70 Ga0068853_100343393 3300005539 Bacteria 1387
71 Ga0070686_100055599 3300005544 Bacteria 2536
72 Ga0070686_100227700 3300005544 Bacteria 1351
73 Ga0070695_100015827 3300005545 Bacteria 4557
74 Ga0070695_100193937 3300005545 Bacteria 1447
75 Ga0070696_100002152 3300005546 Bacteria 12970
76 Ga0070696_100254419 3300005546 Bacteria 1329
77 Ga0070693_100002896 3300005547 Bacteria 7919
78 Ga0070693_100057303 3300005547 Bacteria 2252
79 Ga0070665_100016722 3300005548 Bacteria 7352
80 Ga0070665_100187394 3300005548 Bacteria 2070
81 Ga0070704_100026177 3300005549 Bacteria 3850
82 Ga0070704_100155584 3300005549 Bacteria 1802
83 Ga0068855_100180033 3300005563 Bacteria 2390
84 Ga0068855_101364214 3300005563 Bacteria 732
85 Ga0068854_100090327 3300005578 Bacteria 2277
86 Ga0068854_100618416 3300005578 Bacteria 927
87 Ga0070702_100003334 3300005615 Bacteria 7167
88 Ga0070702_100183991 3300005615 Bacteria 1369
89 Ga0068852_100182607 3300005616 Bacteria 1974
90 Ga0068852_100340044 3300005616 Bacteria 1462
91 Ga0068852_101053752 3300005616 Bacteria 833
92 Ga0068859_100001590 3300005617 Bacteria 23177
93 Ga0068859_100219820 3300005617 Bacteria 1987
94 Ga0068864_100082378 3300005618 Bacteria 2823
95 Ga0068864_100677661 3300005618 Bacteria 1006
96 Ga0068866_10000180 3300005718 Bacteria 29552
97 Ga0068866_10062369 3300005718 Bacteria 1939
98 Ga0068866_10122663 3300005718 Bacteria 1466
99 Ga0068861_100000226 3300005719 Bacteria 30664
100 Ga0068861_100140974 3300005719 Bacteria 1967
101 Ga0068861_101112352 3300005719 Bacteria 760
102 Ga0068870_10136366 3300005840 Bacteria 1431
103 Ga0068863_101527319 3300005841 Bacteria 676
104 Ga0068858_100000903 3300005842 Bacteria 30776
105 Ga0068858_100136619 3300005842 Bacteria 2300
106 Ga0068858_100460014 3300005842 Bacteria 1227
107 Ga0068860_100012527 3300005843 Bacteria 8350
108 Ga0068860_100029712 3300005843 Bacteria 5258
109 Ga0068860_100547178 3300005843 Bacteria 1159
110 Ga0068862_100012822 3300005844 Bacteria 6933
111 Ga0068862_100224073 3300005844 Bacteria 1703
112 Ga0081455_10103349 3300005937 Bacteria 2282
113 Ga0081455_10173090 3300005937 Bacteria 1642
114 Ga0081455_10471352 3300005937 Bacteria 852
115 Ga0070717_10429252 3300006028 Unclassified 1189
116 Ga0070717_10689599 3300006028 Bacteria 928
117 Ga0075363_100004164 3300006048 Bacteria 6282
118 Ga0075363_100009429 3300006048 Bacteria 4589
119 Ga0075363_100528034 3300006048 Bacteria 703
120 Ga0075364_10010447 3300006051 Bacteria 5609
121 Ga0075364_10027304 3300006051 Bacteria 3645
122 Ga0075364_10054068 3300006051 Bacteria 2625
123 Ga0075364_10105818 3300006051 Bacteria 1874
124 Ga0070715_10001786 3300006163 Bacteria 6406
125 Ga0070716_100017485 3300006173 Bacteria 3718
126 Ga0070716_100197696 3300006173 Unclassified 1334
127 Ga0070716_100474782 3300006173 Bacteria 917
128 Ga0070712_100129975 3300006175 Bacteria 1907
129 Ga0070712_100211206 3300006175 Bacteria 1530
130 Ga0070712_100259439 3300006175 Bacteria 1392
131 Ga0070712_100541968 3300006175 Bacteria 980
132 Ga0075362_10015629 3300006177 Bacteria 3091
133 Ga0075362_10054430 3300006177 Bacteria 1798
134 Ga0075367_10109053 3300006178 Bacteria 1698
135 Ga0075369_10000093 3300006186 Bacteria 24053
136 Ga0075369_10191778 3300006186 Bacteria 942
137 Ga0097621_100013793 3300006237 Bacteria 6032
138 Ga0075370_10009218 3300006353 Bacteria 5113
139 Ga0075370_10136526 3300006353 Unclassified 1433
140 Ga0075370_10164442 3300006353 Bacteria 1303
141 Ga0075370_10525228 3300006353 Bacteria 715
142 Ga0075370_10802066 3300006353 Bacteria 574
143 Ga0068871_100132323 3300006358 Bacteria 2116
144 Ga0068871_101186679 3300006358 Bacteria 716
145 Ga0075428_100021414 3300006844 Bacteria 7155
146 Ga0075430_100029073 3300006846 Bacteria 4692
147 Ga0075430_100078927 3300006846 Bacteria 2759
148 Ga0075431_100329550 3300006847 Bacteria 1538
149 Ga0068865_100000640 3300006881 Bacteria 19786
150 Ga0068865_100022605 3300006881 Bacteria 4105
151 Ga0068865_100861382 3300006881 Bacteria 785
152 Ga0097620_100001590 3300006931 Bacteria 23177
153 Ga0097620_100219821 3300006931 Bacteria 1987
154 Ga0099795_10006373 3300007788 Bacteria 3215
155 Ga0099795_10273307 3300007788 Bacteria 735
156 Ga0105244_10142625 3300009036 Bacteria 1151
157 Ga0105250_10043264 3300009092 Bacteria 1805
158 Ga0111539_11901700 3300009094 Bacteria 690
159 Ga0105245_10001209 3300009098 Bacteria 23349
160 Ga0105245_10423219 3300009098 Bacteria 1335
161 Ga0105247_10001400 3300009101 Bacteria 17503
162 Ga0105247_10203725 3300009101 Bacteria 1331
163 Ga0105247_10218267 3300009101 Unclassified 1289
164 Ga0114129_10018435 3300009147 Bacteria 9941
165 Ga0105243_10004023 3300009148 Bacteria 11707
166 Ga0105243_10981705 3300009148 Bacteria 846
167 Ga0105241_10009315 3300009174 Bacteria 7219
168 Ga0105242_10001150 3300009176 Bacteria 20856
169 Ga0105242_10219305 3300009176 Bacteria 1699
170 Ga0105248_10005761 3300009177 Bacteria 13611
171 Ga0105248_10885635 3300009177 Bacteria 1008
172 Ga0105237_10153503 3300009545 Bacteria 2299
173 Ga0105237_10373069 3300009545 Bacteria 1431
174 Ga0105238_10176700 3300009551 Bacteria 2112
175 Ga0105238_10210038 3300009551 Bacteria 1922
176 Ga0105238_11595264 3300009551 Bacteria 682
177 Ga0105249_10004508 3300009553 Bacteria 12039
178 Ga0105249_10026523 3300009553 Bacteria 5222
179 Ga0105249_11016301 3300009553 Bacteria 898
180 Ga0105239_10095527 3300010375 Bacteria 3284
181 Ga0105246_10162924 3300011119 Bacteria 1700
182 Ga0157369_10021440 3300013105 Bacteria 7227
183 Ga0157369_10332560 3300013105 Bacteria 1578
184 Ga0157374_10192621 3300013296 Bacteria 1994
185 Ga0157374_10208389 3300013296 Bacteria 1916
186 Ga0157378_10000885 3300013297 Bacteria 27623
187 Ga0157378_10157794 3300013297 Bacteria 2119
188 Ga0163162_10002813 3300013306 Bacteria 16552
189 Ga0163162_10092708 3300013306 Bacteria 3105
190 Ga0163162_11894148 3300013306 Bacteria 682
191 Ga0163162_11909193 3300013306 Bacteria 680
192 Ga0157372_10032834 3300013307 Bacteria 5694
193 Ga0157372_10566555 3300013307 Bacteria 1324
194 Ga0157375_10001307 3300013308 Bacteria 21463
195 Ga0157375_11176451 3300013308 Bacteria 899
196 Ga0163163_10100180 3300014325 Bacteria 2919
197 Ga0163163_10445942 3300014325 Bacteria 1354
198 Ga0163163_10640474 3300014325 Bacteria 1126
199 Ga0163163_12239616 3300014325 Bacteria 605
200 Ga0157380_10004266 3300014326 Bacteria 9896
201 Ga0157380_10305912 3300014326 Bacteria 1467
202 Ga0157377_10144413 3300014745 Bacteria 1465
203 Ga0157379_10020598 3300014968 Bacteria 5834
204 Ga0157379_10432803 3300014968 Bacteria 1212
205 Ga0157379_10943591 3300014968 Bacteria 820
206 Ga0157376_10059570 3300014969 Bacteria 3202
207 Ga0157376_10278540 3300014969 Bacteria 1574
208 Ga0163161_10000472 3300017792 Bacteria 33371
209 Ga0163161_10165591 3300017792 Bacteria 1688
210 Ga0213875_10047510 3300021388 Bacteria 2014
211 Ga0207692_10065877 3300025898 Bacteria 1892
212 Ga0207642_10090157 3300025899 Bacteria 1512
213 Ga0207642_10281912 3300025899 Bacteria 956
214 Ga0207710_10001305 3300025900 Bacteria 12613
215 Ga0207710_10139196 3300025900 Bacteria 1171
216 Ga0207710_10205986 3300025900 Bacteria 973
217 Ga0207688_10017388 3300025901 Bacteria 3906
218 Ga0207688_10020463 3300025901 Bacteria 3613
219 Ga0207680_10493059 3300025903 Bacteria 872
220 Ga0207647_10055856 3300025904 Bacteria 2425
221 Ga0207685_10089589 3300025905 Bacteria 1292
222 Ga0207699_10132537 3300025906 Bacteria 1627
223 Ga0207699_10511894 3300025906 Unclassified 867
224 Ga0207645_10037019 3300025907 Bacteria 3132
225 Ga0207643_10159128 3300025908 Bacteria 1358
226 Ga0207654_10621214 3300025911 Bacteria 772
227 Ga0207671_10273060 3300025914 Bacteria 1332
228 Ga0207671_10824097 3300025914 Bacteria 735
229 Ga0207693_10001936 3300025915 Bacteria 18133
230 Ga0207693_10011934 3300025915 Bacteria 7022
231 Ga0207693_10458888 3300025915 Bacteria 995
232 Ga0207663_10002446 3300025916 Bacteria 8926
233 Ga0207663_10609753 3300025916 Bacteria 858
234 Ga0207660_11210883 3300025917 Bacteria 614
235 Ga0207694_10379795 3300025924 Bacteria 1173
236 Ga0207650_10308642 3300025925 Bacteria 1294
237 Ga0207687_10178416 3300025927 Bacteria 1644
238 Ga0207687_10464390 3300025927 Bacteria 1052
239 Ga0207700_10512423 3300025928 Unclassified 1062
240 Ga0207664_10024468 3300025929 Bacteria 4538
241 Ga0207644_10053043 3300025931 Bacteria 2917
242 Ga0207644_10646519 3300025931 Bacteria 880
243 Ga0207690_10496006 3300025932 Bacteria 987
244 Ga0207706_10012787 3300025933 Bacteria 7641
245 Ga0207706_10134737 3300025933 Bacteria 2173
246 Ga0207686_10000810 3300025934 Bacteria 19122
247 Ga0207686_10279099 3300025934 Bacteria 1232
248 Ga0207670_10336247 3300025936 Bacteria 1192
249 Ga0207669_10012403 3300025937 Bacteria 4188
250 Ga0207669_10864681 3300025937 Bacteria 753
251 Ga0207704_10000402 3300025938 Bacteria 19716
252 Ga0207665_10032290 3300025939 Bacteria 3466
253 Ga0207665_10470342 3300025939 Unclassified 967
254 Ga0207665_10588732 3300025939 Bacteria 868
255 Ga0207711_10536713 3300025941 Bacteria 1091
256 Ga0207689_10013558 3300025942 Bacteria 6956
257 Ga0207689_10232430 3300025942 Bacteria 1524
258 Ga0207667_10712355 3300025949 Bacteria 1005
259 Ga0207668_10001095 3300025972 Bacteria 16134
260 Ga0207668_10086896 3300025972 Bacteria 2286
261 Ga0207668_10118248 3300025972 Unclassified 2002
262 Ga0207640_10022350 3300025981 Bacteria 3784
263 Ga0207658_10029052 3300025986 Bacteria 3899
264 Ga0207658_10109153 3300025986 Bacteria 2184
265 Ga0207658_10556726 3300025986 Bacteria 1026
266 Ga0207658_10808179 3300025986 Bacteria 851
267 Ga0207677_10058316 3300026023 Bacteria 2657
268 Ga0207677_10362934 3300026023 Bacteria 1217
269 Ga0207703_10016037 3300026035 Bacteria 5844
270 Ga0207703_10622180 3300026035 Bacteria 1022
271 Ga0207703_10656998 3300026035 Bacteria 995
272 Ga0207703_10977341 3300026035 Bacteria 812
273 Ga0207703_11194476 3300026035 Bacteria 731
274 Ga0207639_10012056 3300026041 Bacteria 6014
275 Ga0207639_10190926 3300026041 Bacteria 1750
276 Ga0207639_10999455 3300026041 Bacteria 783
277 Ga0207678_10007825 3300026067 Bacteria 9433
278 Ga0207708_10004782 3300026075 Bacteria 9972
279 Ga0207641_10034089 3300026088 Bacteria 4233
280 Ga0207641_10198696 3300026088 Bacteria 1847
281 Ga0207641_11210823 3300026088 Bacteria 755
282 Ga0207648_10002676 3300026089 Bacteria 18956
283 Ga0207648_10035886 3300026089 Bacteria 4369
284 Ga0207676_10195656 3300026095 Bacteria 1783
285 Ga0207675_100002307 3300026118 Bacteria 18956
286 Ga0207675_100182060 3300026118 Bacteria 2012
287 Ga0207683_10002231 3300026121 Bacteria 17044
288 Ga0207683_10026003 3300026121 Bacteria 5053
289 Ga0207698_10211130 3300026142 Bacteria 1747
290 Ga0207428_11042144 3300027907 Bacteria 573
291 Ga0268266_10012036 3300028379 Bacteria 7487
292 Ga0268266_10086222 3300028379 Bacteria 2745
293 Ga0268265_10067065 3300028380 Bacteria 2776
294 Ga0268264_10035402 3300028381 Bacteria 4111
295 Ga0268264_11092194 3300028381 Bacteria 806
296 Ga0373932_0083190 3300035112 Bacteria 1015
297 Ga0373941_0287609 3300035115 Bacteria 652
298 Ga0373931_0024883 3300035691 Bacteria 3038
299 Ga0373931_0072449 3300035691 Bacteria 1884
300 Ga0373947_0617773 3300035725 Bacteria 739
301 Ga0395900_0729541 3300037418 Bacteria 923
302 Ga0436364_0768660 3300037853 Bacteria 5970
303 Ga0436365_1102542 3300039437 Bacteria 8232
304 Ga0436361_0072683 3300039447 Bacteria 1208
305 Ga0436361_0246412 3300039447 Bacteria 1136
306 Ga0436361_1101612 3300039447 Bacteria 517
307 Ga0439461_0071096 3300041410 Bacteria 806
308 Ga0439466_0010251 3300041411 Bacteria 3486
309 Ga0439466_0012137 3300041411 Bacteria 3179
310 Ga0439465_0004798 3300041413 Bacteria 4349
311 Ga0439465_0087719 3300041413 Bacteria 1061
312 Ga0451843_1238562 3300041509 Bacteria 567
313 Ga0439434_0041475 3300042435 Bacteria 1414
314 Ga0439460_0363383 3300042461 Bacteria 511
315 Ga0466969_0023001 3300044656 Bacteria 3214
316 Ga0466972_0040436 3300044658 Bacteria 2272
317 Ga0466965_0032776 3300044683 Bacteria 2538
318 Ga0466965_0810695 3300044683 Bacteria 542
319 Ga0466966_0019054 3300044684 Bacteria 4523
320 Ga0466961_0031950 3300044693 Bacteria 3383
321 Ga0466961_0188206 3300044693 Bacteria 1280
322 Ga0466963_0054025 3300044694 Bacteria 2669
323 Ga0466963_0374316 3300044694 Bacteria 1004
324 Ga0466968_0002844 3300044735 Bacteria 6400
325 Ga0466968_0021952 3300044735 Bacteria 2590
326 Ga0466970_0026738 3300044765 Bacteria 3025
327 Ga0466970_0239536 3300044765 Bacteria 1015
328 Ga0466957_0011238 3300044842 Bacteria 5157
329 Ga0466957_0171661 3300044842 Bacteria 1413
330 Ga0466957_0382152 3300044842 Bacteria 960
331 Ga0466960_0010571 3300044901 Bacteria 3836
332 Ga0466959_0002289 3300045049 Bacteria 12214
333 Ga0466959_0021162 3300045049 Bacteria 4795
334 Ga0466959_0427903 3300045049 Bacteria 898
335 Ga0466958_0013857 3300045836 Bacteria 4598
336 Ga0466958_0077434 3300045836 Bacteria 2042
337 Ga0466967_0068791 3300045976 Bacteria 3163
338 Ga0466967_0248830 3300045976 Bacteria 1697
339 Ga0466967_0273497 3300045976 Bacteria 1619
340 Ga0466967_0323773 3300045976 Bacteria 1487
341 Ga0466967_0556738 3300045976 Bacteria 1129
342 Ga0466967_1002045 3300045976 Bacteria 832
343 Ga0466967_2569388 3300045976 Unclassified 504
344 Ga0495592_0313488 3300046454 Unclassified 1016
345 Ga0495629_0032991 3300046459 Bacteria 3664
346 Ga0495662_0033546 3300046476 Bacteria 2480
347 Ga0495594_0607486 3300046499 Bacteria 620
348 Ga0495630_0506492 3300046517 Bacteria 926
349 Ga0495666_0356303 3300046526 Bacteria 659
350 Ga0495658_0132205 3300046683 Bacteria 1520
351 Ga0495624_0464247 3300046690 Bacteria 758
352 Ga0495649_0148333 3300046694 Unclassified 1232
353 Ga0495589_0161513 3300046794 Bacteria 1067
354 Ga0495674_0056799 3300047319 Bacteria 3427
355 Ga0495672_0195728 3300047320 Bacteria 1014
356 Ga0496100_0017379 3300048903 Bacteria 4244
357 Ga0496100_0456773 3300048903 Bacteria 980
358 Ga0496100_0703716 3300048903 Bacteria 789
359 Ga0496101_0000744 3300048904 Bacteria 19351
360 Ga0496101_0094550 3300048904 Bacteria 2228
361 Ga0496101_0357098 3300048904 Bacteria 1149
362 Ga0496101_0703702 3300048904 Bacteria 798
363 Ga0496102_0004662 3300048905 Bacteria 11600
364 Ga0496102_0042915 3300048905 Bacteria 4099
365 Ga0496102_0102825 3300048905 Bacteria 2656
366 Ga0496103_0000867 3300048906 Bacteria 21979
367 Ga0496103_0073749 3300048906 Bacteria 2138
368 Ga0496104_0035600 3300048907 Bacteria 4649
369 Ga0496104_0121208 3300048907 Bacteria 2511
370 Ga0496105_1115620 3300048908 Bacteria 585
371 Ga0496106_0000197 3300048909 Bacteria 42550
372 Ga0496106_0019170 3300048909 Bacteria 5072
373 Ga0496107_0013876 3300048910 Bacteria 5631
374 Ga0496107_0119603 3300048910 Bacteria 1940
375 Ga0496108_0000434 3300048911 Bacteria 33756
376 Ga0496108_0049967 3300048911 Bacteria 3499
377 Ga0496108_0945053 3300048911 Bacteria 738
378 Ga0496109_0015522 3300048912 Bacteria 6640
379 Ga0496109_0299148 3300048912 Bacteria 1517
380 Ga0496109_0355210 3300048912 Bacteria 1385
381 Ga0496109_0758849 3300048912 Bacteria 908
382 Ga0496109_0805674 3300048912 Bacteria 877
383 Ga0496110_0032886 3300048913 Bacteria 4483
384 Ga0496110_0523397 3300048913 Bacteria 1079
385 Ga0496111_0059284 3300048914 Bacteria 2773
386 Ga0496111_0083886 3300048914 Bacteria 2329
387 Ga0496111_0351185 3300048914 Bacteria 1092
388 Ga0496112_0252240 3300048915 Bacteria 1715
389 Ga0496112_0261115 3300048915 Bacteria 1681
390 Ga0496112_0349931 3300048915 Bacteria 1420
391 Ga0496113_0050980 3300048916 Bacteria 3088
392 Ga0496113_0182354 3300048916 Bacteria 1664
393 Ga0496114_0000237 3300048917 Bacteria 40235
394 Ga0496114_0275393 3300048917 Bacteria 1483
395 Ga0496115_0002058 3300048918 Bacteria 14400
396 Ga0496126_0011532 3300048929 Bacteria 9132
397 Ga0496126_0022251 3300048929 Bacteria 6172
398 Ga0501032_0077483 3300049569 Bacteria 2213
399 Ga0501033_0005338 3300049570 Bacteria 10184
400 Ga0501033_0647730 3300049570 Bacteria 722
401 Ga0501034_0107059 3300049571 Bacteria 2788
402 Ga0501034_0217829 3300049571 Bacteria 1862
403 Ga0501034_0504642 3300049571 Bacteria 1123
404 Ga0501036_0147594 3300049572 Bacteria 1984
405 Ga0501043_0275016 3300049579 Bacteria 1292
406 Ga0501046_0003524 3300049580 Bacteria 14332
407 Ga0501046_0049696 3300049580 Bacteria 3317
408 Ga0501047_0071469 3300049581 Bacteria 3340
409 Ga0501047_0106778 3300049581 Bacteria 2681
410 Ga0501047_1019357 3300049581 Bacteria 641
411 Ga0501048_0207975 3300049582 Bacteria 1388
412 Ga0501070_0044407 3300049586 Bacteria 3698
413 Ga0501035_0008135 3300049822 Bacteria 9775
414 Ga0501035_0083433 3300049822 Bacteria 2819
415 Ga0501044_0001121 3300049823 Bacteria 31806
416 Ga0501044_0047903 3300049823 Bacteria 4419
417 nmdc:mga03683_62523_c1 3300050489 Bacteria 1577
418 nmdc:mga03n38_145710_c1 3300050490 Unclassified 1187
419 nmdc:mga03n38_152471_c1 3300050490 Bacteria 1164
420 nmdc:mga03n38_17957_c1 3300050490 Bacteria 2782
421 nmdc:mga03n38_4217_c1 3300050490 Bacteria 4728
422 nmdc:mga00v17_102172_c1 3300050491 Bacteria 1811
423 nmdc:mga00v17_15685_c1 3300050491 Bacteria 1911
424 nmdc:mga00v17_46815_c1 3300050491 Bacteria 2618
425 nmdc:mga00v17_93962_c1 3300050491 Bacteria 1886
426 nmdc:mga0yw44_333077_c1 3300050492 Bacteria 1020
427 nmdc:mga06z11_403262_c1 3300050494 Unclassified 823
428 nmdc:mga04h51_382985_c1 3300050495 Bacteria 586
429 nmdc:mga07m45_123331_c1 3300050496 Bacteria 1497
430 nmdc:mga07m45_56482_c1 3300050496 Bacteria 2219
431 nmdc:mga07m45_752379_c1 3300050496 Bacteria 559
432 nmdc:mga05p37_582476_c1 3300050507 Bacteria 1267
433 nmdc:mga0qj67_44271_c1 3300050509 Bacteria 3507
434 nmdc:mga0qj67_777315_c1 3300050509 Bacteria 759
435 nmdc:mga06r32_339001_c1 3300050510 Bacteria 1488
436 nmdc:mga0sz30_136427_c1 3300050516 Bacteria 1082
437 nmdc:mga0sz30_16730_c1 3300050516 Bacteria 2917
438 Ga0495619_0167020 3300053085 Bacteria 1521
439 Ga0466962_0295150 3300061719 Bacteria 801
440 Ga0207678_10150903
441 JGI24737J22298_10104822
442 JGI24750J21931_1011444
443 JGI24745J21846_1010621
444 JGI24738J21930_10025192
445 JGI24744J21845_10002655
446 JGI24744J21845_10002998
447 JGI24742J22300_10002000
448 JGI24751J29686_10096904
449 Ga0070676_10010632
450 Ga0070676_10359905
451 Ga0070683_100088228
452 Ga0070690_100009449
453 Ga0070670_100239317
454 Ga0070670_100666605
455 Ga0068869_100084411
456 Ga0068869_100457704
457 Ga0070666_10923904
458 Ga0070682_100008365
459 Ga0070682_100945152
460 Ga0068868_100002274
461 Ga0068868_100077320
462 Ga0068868_101240365
463 Ga0070660_100188492
464 Ga0070660_100560822
465 Ga0070689_100005403
466 Ga0070691_10013866
467 Ga0070691_10215705
468 Ga0070692_10081253
469 Ga0070692_10087795
470 Ga0070668_100009862
471 Ga0070668_100055553
472 Ga0070668_100071201
473 Ga0070668_101372327
474 Ga0070669_100269089
475 Ga0070669_100375450
476 Ga0070671_100018937
477 Ga0070674_100000470
478 Ga0070688_100285922
479 Ga0070667_100002949
480 Ga0070667_100029857
481 Ga0070667_100531694
482 Ga0070667_100554686
483 Ga0070667_100840756
484 Ga0070709_10106652
485 Ga0070709_10151733
486 Ga0070714_100678608
487 Ga0070713_100364620
488 Ga0070713_100517779
489 Ga0070710_10062002
490 Ga0070701_10011352
491 Ga0070701_10056518
492 Ga0070711_100000636
493 Ga0070711_100036818
494 Ga0070711_101447687
495 Ga0070705_100002459
496 Ga0070705_100357815
497 Ga0070700_100001014
498 Ga0070694_100063975
499 Ga0070678_100000312
500 Ga0070678_100363018
501 Ga0070662_100016085
502 Ga0070662_100761675
503 Ga0068867_100000491
504 Ga0070685_10139421
505 Ga0070685_10570270
506 Ga0070707_100341271
507 Ga0070684_100126203
508 Ga0068853_100004841
509 Ga0068853_100343393
510 Ga0070686_100055599
511 Ga0070686_100227700
512 Ga0070695_100015827
513 Ga0070695_100193937
514 Ga0070696_100002152
515 Ga0070696_100254419
516 Ga0070693_100002896
517 Ga0070693_100057303
518 Ga0070665_100016722
519 Ga0070665_100187394
520 Ga0070704_100026177
521 Ga0070704_100155584
522 Ga0068855_100180033
523 Ga0068855_101364214
524 Ga0068854_100090327
525 Ga0068854_100618416
526 Ga0070702_100003334
527 Ga0070702_100183991
528 Ga0068852_100182607
529 Ga0068852_100340044
530 Ga0068852_101053752
531 Ga0068859_100001590
532 Ga0068859_100219820
533 Ga0068864_100082378
534 Ga0068864_100677661
535 Ga0068866_10000180
536 Ga0068866_10062369
537 Ga0068866_10122663
538 Ga0068861_100000226
539 Ga0068861_100140974
540 Ga0068861_101112352
541 Ga0068870_10136366
542 Ga0068863_101527319
543 Ga0068858_100000903
544 Ga0068858_100136619
545 Ga0068858_100460014
546 Ga0068860_100012527
547 Ga0068860_100029712
548 Ga0068860_100547178
549 Ga0068862_100012822
550 Ga0068862_100224073
551 Ga0081455_10103349
552 Ga0081455_10173090
553 Ga0081455_10471352
554 Ga0070717_10429252
555 Ga0070717_10689599
556 Ga0075363_100004164
557 Ga0075363_100009429
558 Ga0075363_100528034
559 Ga0075364_10010447
560 Ga0075364_10027304
561 Ga0075364_10054068
562 Ga0075364_10105818
563 Ga0070715_10001786
564 Ga0070716_100017485
565 Ga0070716_100197696
566 Ga0070716_100474782
567 Ga0070712_100129975
568 Ga0070712_100211206
569 Ga0070712_100259439
570 Ga0070712_100541968
571 Ga0075362_10015629
572 Ga0075362_10054430
573 Ga0075367_10109053
574 Ga0075369_10000093
575 Ga0075369_10191778
576 Ga0097621_100013793
577 Ga0075370_10009218
578 Ga0075370_10136526
579 Ga0075370_10164442
580 Ga0075370_10525228
581 Ga0075370_10802066
582 Ga0068871_100132323
583 Ga0068871_101186679
584 Ga0075428_100021414
585 Ga0075430_100029073
586 Ga0075430_100078927
587 Ga0075431_100329550
588 Ga0068865_100000640
589 Ga0068865_100022605
590 Ga0068865_100861382
591 Ga0097620_100001590
592 Ga0097620_100219821
593 Ga0099795_10006373
594 Ga0099795_10273307
595 Ga0105244_10142625
596 Ga0105250_10043264
597 Ga0111539_11901700
598 Ga0105245_10001209
599 Ga0105245_10423219
600 Ga0105247_10001400
601 Ga0105247_10203725
602 Ga0105247_10218267
603 Ga0114129_10018435
604 Ga0105243_10004023
605 Ga0105243_10981705
606 Ga0105241_10009315
607 Ga0105242_10001150
608 Ga0105242_10219305
609 Ga0105248_10005761
610 Ga0105248_10885635
611 Ga0105237_10153503
612 Ga0105237_10373069
613 Ga0105238_10176700
614 Ga0105238_10210038
615 Ga0105238_11595264
616 Ga0105249_10004508
617 Ga0105249_10026523
618 Ga0105249_11016301
619 Ga0105239_10095527
620 Ga0105246_10162924
621 Ga0157369_10021440
622 Ga0157369_10332560
623 Ga0157374_10192621
624 Ga0157374_10208389
625 Ga0157378_10000885
626 Ga0157378_10157794
627 Ga0163162_10002813
628 Ga0163162_10092708
629 Ga0163162_11894148
630 Ga0163162_11909193
631 Ga0157372_10032834
632 Ga0157372_10566555
633 Ga0157375_10001307
634 Ga0157375_11176451
635 Ga0163163_10100180
636 Ga0163163_10445942
637 Ga0163163_10640474
638 Ga0163163_12239616
639 Ga0157380_10004266
640 Ga0157380_10305912
641 Ga0157377_10144413
642 Ga0157379_10020598
643 Ga0157379_10432803
644 Ga0157379_10943591
645 Ga0157376_10059570
646 Ga0157376_10278540
647 Ga0163161_10000472
648 Ga0163161_10165591
649 Ga0213875_10047510
650 Ga0207692_10065877
651 Ga0207642_10090157
652 Ga0207642_10281912
653 Ga0207710_10001305
654 Ga0207710_10139196
655 Ga0207710_10205986
656 Ga0207688_10017388
657 Ga0207688_10020463
658 Ga0207680_10493059
659 Ga0207647_10055856
660 Ga0207685_10089589
661 Ga0207699_10132537
662 Ga0207699_10511894
663 Ga0207645_10037019
664 Ga0207643_10159128
665 Ga0207654_10621214
666 Ga0207671_10273060
667 Ga0207671_10824097
668 Ga0207693_10001936
669 Ga0207693_10011934
670 Ga0207693_10458888
671 Ga0207663_10002446
672 Ga0207663_10609753
673 Ga0207660_11210883
674 Ga0207694_10379795
675 Ga0207650_10308642
676 Ga0207687_10178416
677 Ga0207687_10464390
678 Ga0207700_10512423
679 Ga0207664_10024468
680 Ga0207644_10053043
681 Ga0207644_10646519
682 Ga0207690_10496006
683 Ga0207706_10012787
684 Ga0207706_10134737
685 Ga0207686_10000810
686 Ga0207686_10279099
687 Ga0207670_10336247
688 Ga0207669_10012403
689 Ga0207669_10864681
690 Ga0207704_10000402
691 Ga0207665_10032290
692 Ga0207665_10470342
693 Ga0207665_10588732
694 Ga0207711_10536713
695 Ga0207689_10013558
696 Ga0207689_10232430
697 Ga0207667_10712355
698 Ga0207668_10001095
699 Ga0207668_10086896
700 Ga0207668_10118248
701 Ga0207640_10022350
702 Ga0207658_10029052
703 Ga0207658_10109153
704 Ga0207658_10556726
705 Ga0207658_10808179
706 Ga0207677_10058316
707 Ga0207677_10362934
708 Ga0207703_10016037
709 Ga0207703_10622180
710 Ga0207703_10656998
711 Ga0207703_10977341
712 Ga0207703_11194476
713 Ga0207639_10012056
714 Ga0207639_10190926
715 Ga0207639_10999455
716 Ga0207678_10007825
717 Ga0207708_10004782
718 Ga0207641_10034089
719 Ga0207641_10198696
720 Ga0207641_11210823
721 Ga0207648_10002676
722 Ga0207648_10035886
723 Ga0207676_10195656
724 Ga0207675_100002307
725 Ga0207675_100182060
726 Ga0207683_10002231
727 Ga0207683_10026003
728 Ga0207698_10211130
729 Ga0207428_11042144
730 Ga0268266_10012036
731 Ga0268266_10086222
732 Ga0268265_10067065
733 Ga0268264_10035402
734 Ga0268264_11092194
735 Ga0373932_0083190
736 Ga0373941_0287609
737 Ga0373931_0024883
738 Ga0373931_0072449
739 Ga0373947_0617773
740 Ga0395900_0729541
741 Ga0436364_0768660
742 Ga0436365_1102542
743 Ga0436361_0072683
744 Ga0436361_0246412
745 Ga0436361_1101612
746 Ga0439461_0071096
747 Ga0439466_0010251
748 Ga0439466_0012137
749 Ga0439465_0004798
750 Ga0439465_0087719
751 Ga0451843_1238562
752 Ga0439434_0041475
753 Ga0439460_0363383
754 Ga0466969_0023001
755 Ga0466972_0040436
756 Ga0466965_0032776
757 Ga0466965_0810695
758 Ga0466966_0019054
759 Ga0466961_0031950
760 Ga0466961_0188206
761 Ga0466963_0054025
762 Ga0466963_0374316
763 Ga0466968_0002844
764 Ga0466968_0021952
765 Ga0466970_0026738
766 Ga0466970_0239536
767 Ga0466957_0011238
768 Ga0466957_0171661
769 Ga0466957_0382152
770 Ga0466960_0010571
771 Ga0466959_0002289
772 Ga0466959_0021162
773 Ga0466959_0427903
774 Ga0466958_0013857
775 Ga0466958_0077434
776 Ga0466967_0068791
777 Ga0466967_0248830
778 Ga0466967_0273497
779 Ga0466967_0323773
780 Ga0466967_0556738
781 Ga0466967_1002045
782 Ga0466967_2569388
783 Ga0495592_0313488
784 Ga0495629_0032991
785 Ga0495662_0033546
786 Ga0495594_0607486
787 Ga0495630_0506492
788 Ga0495666_0356303
789 Ga0495658_0132205
790 Ga0495624_0464247
791 Ga0495649_0148333
792 Ga0495589_0161513
793 Ga0495674_0056799
794 Ga0495672_0195728
795 Ga0496100_0017379
796 Ga0496100_0456773
797 Ga0496100_0703716
798 Ga0496101_0000744
799 Ga0496101_0094550
800 Ga0496101_0357098
801 Ga0496101_0703702
802 Ga0496102_0004662
803 Ga0496102_0042915
804 Ga0496102_0102825
805 Ga0496103_0000867
806 Ga0496103_0073749
807 Ga0496104_0035600
808 Ga0496104_0121208
809 Ga0496105_1115620
810 Ga0496106_0000197
811 Ga0496106_0019170
812 Ga0496107_0013876
813 Ga0496107_0119603
814 Ga0496108_0000434
815 Ga0496108_0049967
816 Ga0496108_0945053
817 Ga0496109_0015522
818 Ga0496109_0299148
819 Ga0496109_0355210
820 Ga0496109_0758849
821 Ga0496109_0805674
822 Ga0496110_0032886
823 Ga0496110_0523397
824 Ga0496111_0059284
825 Ga0496111_0083886
826 Ga0496111_0351185
827 Ga0496112_0252240
828 Ga0496112_0261115
829 Ga0496112_0349931
830 Ga0496113_0050980
831 Ga0496113_0182354
832 Ga0496114_0000237
833 Ga0496114_0275393
834 Ga0496115_0002058
835 Ga0496126_0011532
836 Ga0496126_0022251
837 Ga0501032_0077483
838 Ga0501033_0005338
839 Ga0501033_0647730
840 Ga0501034_0107059
841 Ga0501034_0217829
842 Ga0501034_0504642
843 Ga0501036_0147594
844 Ga0501043_0275016
845 Ga0501046_0003524
846 Ga0501046_0049696
847 Ga0501047_0071469
848 Ga0501047_0106778
849 Ga0501047_1019357
850 Ga0501048_0207975
851 Ga0501070_0044407
852 Ga0501035_0008135
853 Ga0501035_0083433
854 Ga0501044_0001121
855 Ga0501044_0047903
856 nmdc:mga03683_62523_c1
857 nmdc:mga03n38_145710_c1
858 nmdc:mga03n38_152471_c1
859 nmdc:mga03n38_17957_c1
860 nmdc:mga03n38_4217_c1
861 nmdc:mga00v17_102172_c1
862 nmdc:mga00v17_15685_c1
863 nmdc:mga00v17_46815_c1
864 nmdc:mga00v17_93962_c1
865 nmdc:mga0yw44_333077_c1
866 nmdc:mga06z11_403262_c1
867 nmdc:mga04h51_382985_c1
868 nmdc:mga07m45_123331_c1
869 nmdc:mga07m45_56482_c1
870 nmdc:mga07m45_752379_c1
871 nmdc:mga05p37_582476_c1
872 nmdc:mga0qj67_44271_c1
873 nmdc:mga0qj67_777315_c1
874 nmdc:mga06r32_339001_c1
875 nmdc:mga0sz30_136427_c1
876 nmdc:mga0sz30_16730_c1
877 Ga0495619_0167020
878 Ga0466962_0295150

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

7

137

0.9

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

9

128

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.8394 1 137
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.8302 10 140
2c21-assembly3.cif.gz_F specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme 0.8268 10 144
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8135 10 140
2p7p-assembly4.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.7954 4 139
ID Description Score Start End Superfamily
2c21D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8231 10 144 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8135 10 140 3.10.180.10
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7833 4 72 3.10.180.10
4mtrB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7753 10 140 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7657 12 139 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1A2ZPD8-F1-model_v4 Glyoxalase-like protein 0.9601 1 132 GO:0004493
GO:0046491
GO:0046872
AF-A0A6J7EBY5-F1-model_v4 Unannotated protein 0.9535 8 141 GO:0004493
GO:0046491
GO:0046872
AF-A0A1A2ZPD8-F1-model_v4 Glyoxalase-like protein 0.9531 1 132 GO:0004493
GO:0046491
GO:0046872
AF-A0A6J7EBY5-F1-model_v4 Unannotated protein 0.9466 8 141 GO:0004493
GO:0046491
GO:0046872
AF-A0A2S8LKM0-F1-model_v4 deleted 0.9434 1 92

Map