F444156

General Info

Members Datasets Scaffolds Average Seq Length
439 236 878 347

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100015691|Ga0070693_1000156913
Length 351
Sequence VRGLAISAHGGLDKIEYRTDLPKPEPKRGEIRXXXXAAALNHLDLFVVGGLPGVTIDHVPWVLGADATGVIDAIGDLSGVADNQLKVGDTVIINPGISDYTCEYCMSGEHSLCVHFKLLGEHLPGTIAEYITIPARNARSIPKDRPVEQAAAYTLSTLTAWRMVVTRARVKKGDNVLIWGIGGGVALAALEITRLIGAKTWVTSHSDEKLALARGLGADNTLNYATTTDVGKEIRARTNKRGVDVVLETVGEATWTQSLVALGRRGRLVTCGATSGPMVQMDVRRLFWNQWDIMGSTMGNESEFDAVTNEFRAGRLTPLVDSVFDITQGRQAFERLQSGQQFGKIVVRIPD

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
141 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
174 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
175 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
184 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
207 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
208 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
209 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
210 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
211 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
212 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
213 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
214 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
215 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
216 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
217 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
218 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
219 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
220 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
221 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
222 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
223 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
224 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
225 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 1.82
Rhizosphere 97.49
Stem 0
Stem Tuber 0
Unclassified 7.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_100015691 3300005547 Bacteria 3905
2 Ga0065712_10112877 3300005290 Bacteria 1791
3 Ga0065715_10027856 3300005293 Unclassified 1533
4 Ga0065715_10089295 3300005293 Bacteria 11396
5 Ga0070658_10009478 3300005327 Bacteria 7824
6 Ga0070658_10188004 3300005327 Bacteria 1740
7 Ga0070658_10244055 3300005327 Bacteria 1523
8 Ga0070676_10012682 3300005328 Bacteria 4607
9 Ga0070683_100013293 3300005329 Bacteria 7176
10 Ga0070683_100013774 3300005329 Bacteria 7060
11 Ga0070683_100031654 3300005329 Bacteria 4813
12 Ga0070683_100133547 3300005329 Bacteria 2349
13 Ga0070683_100171373 3300005329 Bacteria 2060
14 Ga0070690_100067361 3300005330 Bacteria 2319
15 Ga0068869_100106461 3300005334 Bacteria 2128
16 Ga0070680_100001993 3300005336 Bacteria 15028
17 Ga0070680_100040464 3300005336 Bacteria 3774
18 Ga0070680_100046318 3300005336 Bacteria 3538
19 Ga0070680_100055994 3300005336 Bacteria 3223
20 Ga0070680_100095163 3300005336 Bacteria 2469
21 Ga0070680_100120719 3300005336 Bacteria 2188
22 Ga0070680_100277386 3300005336 Bacteria 1420
23 Ga0070682_100001315 3300005337 Bacteria 14053
24 Ga0070682_100021214 3300005337 Bacteria 3829
25 Ga0070682_100056251 3300005337 Bacteria 2474
26 Ga0068868_100070646 3300005338 Bacteria 2784
27 Ga0070660_100018864 3300005339 Bacteria 5048
28 Ga0070689_100058825 3300005340 Bacteria 2985
29 Ga0070691_10000411 3300005341 Bacteria 15661
30 Ga0070661_100033409 3300005344 Bacteria 3726
31 Ga0070661_100036160 3300005344 Bacteria 3590
32 Ga0070661_100125860 3300005344 Unclassified 1922
33 Ga0070661_100135484 3300005344 Bacteria 1853
34 Ga0070692_10033914 3300005345 Bacteria 2575
35 Ga0070668_100092337 3300005347 Bacteria 2387
36 Ga0070671_100124197 3300005355 Bacteria 2173
37 Ga0070673_100035438 3300005364 Bacteria 3784
38 Ga0070673_100197438 3300005364 Bacteria 1731
39 Ga0070659_100044394 3300005366 Bacteria 3480
40 Ga0070659_100333399 3300005366 Unclassified 1270
41 Ga0070667_100047081 3300005367 Bacteria 3628
42 Ga0070667_100060188 3300005367 Bacteria 3213
43 Ga0070709_10007405 3300005434 Bacteria 6015
44 Ga0070709_10151808 3300005434 Bacteria 1602
45 Ga0070714_100008717 3300005435 Bacteria 7928
46 Ga0070714_100018353 3300005435 Bacteria 5681
47 Ga0070713_100000500 3300005436 Bacteria 25055
48 Ga0070713_100001301 3300005436 Bacteria 15977
49 Ga0070713_100012906 3300005436 Bacteria 6148
50 Ga0070713_100142160 3300005436 Bacteria 2127
51 Ga0070708_100000081 3300005445 Bacteria 61675
52 Ga0070708_100000093 3300005445 Bacteria 59081
53 Ga0070708_100012332 3300005445 Bacteria 6971
54 Ga0070662_100115085 3300005457 Unclassified 2054
55 Ga0070681_10003491 3300005458 Bacteria 14717
56 Ga0070681_10006979 3300005458 Bacteria 10991
57 Ga0070681_10031269 3300005458 Bacteria 5343
58 Ga0070681_10039505 3300005458 Bacteria 4730
59 Ga0070681_10129321 3300005458 Bacteria 2457
60 Ga0068867_100028837 3300005459 Bacteria 3996
61 Ga0070706_100010875 3300005467 Bacteria 8447
62 Ga0070706_100146608 3300005467 Bacteria 2204
63 Ga0070707_100000636 3300005468 Bacteria 35107
64 Ga0070707_100096451 3300005468 Bacteria 2864
65 Ga0070698_100021731 3300005471 Bacteria 6718
66 Ga0070699_100012592 3300005518 Bacteria 7295
67 Ga0070699_100052420 3300005518 Bacteria 3530
68 Ga0070699_100088065 3300005518 Bacteria 2711
69 Ga0070699_100155613 3300005518 Unclassified 2023
70 Ga0070699_100277069 3300005518 Unclassified 1502
71 Ga0070679_100002497 3300005530 Bacteria 16661
72 Ga0070679_100010151 3300005530 Bacteria 8926
73 Ga0070679_100020941 3300005530 Bacteria 6379
74 Ga0070679_100034772 3300005530 Bacteria 4997
75 Ga0070679_100035447 3300005530 Bacteria 4951
76 Ga0070679_100052302 3300005530 Bacteria 4069
77 Ga0070679_100069041 3300005530 Bacteria 3525
78 Ga0070679_100069977 3300005530 Bacteria 3500
79 Ga0070679_100092635 3300005530 Bacteria 3009
80 Ga0070679_100152056 3300005530 Bacteria 2291
81 Ga0070679_100206046 3300005530 Bacteria 1931
82 Ga0070679_100519526 3300005530 Bacteria 1134
83 Ga0070684_100001598 3300005535 Bacteria 16365
84 Ga0070684_100002439 3300005535 Bacteria 13708
85 Ga0070684_100004210 3300005535 Bacteria 10904
86 Ga0070684_100053416 3300005535 Bacteria 3517
87 Ga0070684_100112925 3300005535 Bacteria 2438
88 Ga0070684_100127383 3300005535 Bacteria 2294
89 Ga0070684_100302193 3300005535 Bacteria 1469
90 Ga0070697_100111308 3300005536 Bacteria 2282
91 Ga0070697_100142698 3300005536 Unclassified 2015
92 Ga0070697_100153513 3300005536 Bacteria 1942
93 Ga0068853_100078928 3300005539 Bacteria 2878
94 Ga0068853_100347806 3300005539 Unclassified 1378
95 Ga0070672_100053688 3300005543 Bacteria 3151
96 Ga0070686_100118726 3300005544 Bacteria 1813
97 Ga0070695_100001292 3300005545 Bacteria 13826
98 Ga0070695_100046352 3300005545 Bacteria 2773
99 Ga0070695_100114773 3300005545 Bacteria 1834
100 Ga0070696_100002156 3300005546 Bacteria 12962
101 Ga0070696_100010172 3300005546 Bacteria 6298
102 Ga0070693_100028548 3300005547 Bacteria 3034
103 Ga0068855_100005334 3300005563 Bacteria 15696
104 Ga0068855_100044560 3300005563 Bacteria 5250
105 Ga0068855_100072482 3300005563 Bacteria 4003
106 Ga0068855_100258015 3300005563 Unclassified 1943
107 Ga0068855_100276929 3300005563 Bacteria 1864
108 Ga0070664_100016858 3300005564 Bacteria 5997
109 Ga0070664_100051383 3300005564 Bacteria 3490
110 Ga0070664_100056670 3300005564 Bacteria 3329
111 Ga0070664_100125447 3300005564 Bacteria 2251
112 Ga0070664_100149062 3300005564 Bacteria 2065
113 Ga0070664_100347484 3300005564 Bacteria 1348
114 Ga0068857_100020139 3300005577 Bacteria 5864
115 Ga0068857_100295643 3300005577 Bacteria 1492
116 Ga0068856_100469410 3300005614 Bacteria 1279
117 Ga0068852_100177928 3300005616 Bacteria 1998
118 Ga0068852_100254457 3300005616 Unclassified 1684
119 Ga0068859_100019008 3300005617 Bacteria 6900
120 Ga0068851_10054071 3300005834 Bacteria 2045
121 Ga0068870_10023552 3300005840 Bacteria 3039
122 Ga0068860_100126519 3300005843 Bacteria 2449
123 Ga0070716_100009440 3300006173 Bacteria 4863
124 Ga0070712_100065419 3300006175 Bacteria 2581
125 Ga0070712_100205731 3300006175 Bacteria 1549
126 Ga0075430_100026380 3300006846 Bacteria 4944
127 Ga0075430_100161037 3300006846 Bacteria 1868
128 Ga0075431_100107155 3300006847 Bacteria 2883
129 Ga0075433_10079648 3300006852 Bacteria 2887
130 Ga0068865_100098835 3300006881 Bacteria 2133
131 Ga0075436_100010664 3300006914 Bacteria 6302
132 Ga0075436_100050213 3300006914 Bacteria 2878
133 Ga0075436_100105298 3300006914 Unclassified 1967
134 Ga0075436_100185968 3300006914 Bacteria 1469
135 Ga0097620_100019008 3300006931 Bacteria 6900
136 Ga0075435_100060193 3300007076 Bacteria 3078
137 Ga0075435_100062999 3300007076 Bacteria 3011
138 Ga0075435_100170504 3300007076 Bacteria 1836
139 Ga0105240_10017969 3300009093 Bacteria 9513
140 Ga0105240_10024524 3300009093 Bacteria 7948
141 Ga0105240_10078423 3300009093 Bacteria 4067
142 Ga0105240_10102412 3300009093 Bacteria 3479
143 Ga0105245_10013990 3300009098 Bacteria 6989
144 Ga0105245_10137226 3300009098 Bacteria 2300
145 Ga0105245_10218946 3300009098 Bacteria 1836
146 Ga0105243_10028598 3300009148 Bacteria 4280
147 Ga0105241_10085419 3300009174 Bacteria 2480
148 Ga0105241_10216014 3300009174 Bacteria 1609
149 Ga0105248_10079849 3300009177 Bacteria 3677
150 Ga0105248_10137408 3300009177 Bacteria 2757
151 Ga0105248_10153375 3300009177 Bacteria 2599
152 Ga0157373_10006122 3300013100 Bacteria 8997
153 Ga0157373_10109792 3300013100 Bacteria 1939
154 Ga0157370_10007632 3300013104 Bacteria 11743
155 Ga0157370_10054965 3300013104 Bacteria 3794
156 Ga0157369_10040457 3300013105 Bacteria 5088
157 Ga0157374_10058747 3300013296 Bacteria 3595
158 Ga0157374_10169828 3300013296 Unclassified 2127
159 Ga0157378_10105876 3300013297 Bacteria 2572
160 Ga0157378_10175941 3300013297 Bacteria 2010
161 Ga0163162_10045549 3300013306 Bacteria 4395
162 Ga0157372_10022699 3300013307 Bacteria 6792
163 Ga0157372_10050223 3300013307 Bacteria 4640
164 Ga0157372_10059838 3300013307 Bacteria 4262
165 Ga0157372_10065271 3300013307 Bacteria 4087
166 Ga0157372_10123752 3300013307 Bacteria 2973
167 Ga0157375_10029205 3300013308 Bacteria 5182
168 Ga0157375_10045390 3300013308 Bacteria 4276
169 Ga0157375_10125344 3300013308 Bacteria 2682
170 Ga0182008_10027605 3300014497 Bacteria 2874
171 Ga0157377_10033892 3300014745 Bacteria 2790
172 Ga0163161_10076047 3300017792 Bacteria 2464
173 Ga0213876_10036946 3300021384 Bacteria 2577
174 Ga0207692_10094518 3300025898 Bacteria 1628
175 Ga0207699_10003350 3300025906 Bacteria 7638
176 Ga0207699_10008735 3300025906 Bacteria 5013
177 Ga0207699_10019187 3300025906 Bacteria 3640
178 Ga0207645_10156682 3300025907 Bacteria 1488
179 Ga0207643_10020057 3300025908 Bacteria 3667
180 Ga0207705_10012823 3300025909 Bacteria 6052
181 Ga0207684_10055970 3300025910 Bacteria 3346
182 Ga0207654_10037323 3300025911 Bacteria 2719
183 Ga0207707_10001939 3300025912 Bacteria 18822
184 Ga0207707_10003196 3300025912 Bacteria 14540
185 Ga0207707_10011888 3300025912 Bacteria 7573
186 Ga0207707_10012337 3300025912 Bacteria 7426
187 Ga0207707_10031670 3300025912 Bacteria 4628
188 Ga0207707_10039933 3300025912 Bacteria 4100
189 Ga0207707_10046617 3300025912 Bacteria 3775
190 Ga0207707_10047474 3300025912 Bacteria 3739
191 Ga0207707_10077208 3300025912 Bacteria 2907
192 Ga0207707_10096129 3300025912 Bacteria 2589
193 Ga0207695_10009859 3300025913 Bacteria 11738
194 Ga0207695_10014927 3300025913 Bacteria 9167
195 Ga0207693_10017954 3300025915 Bacteria 5640
196 Ga0207660_10000500 3300025917 Bacteria 26124
197 Ga0207660_10058459 3300025917 Bacteria 2765
198 Ga0207660_10072695 3300025917 Bacteria 2505
199 Ga0207660_10092845 3300025917 Bacteria 2241
200 Ga0207660_10261142 3300025917 Bacteria 1369
201 Ga0207662_10054698 3300025918 Bacteria 2381
202 Ga0207657_10021863 3300025919 Bacteria 6008
203 Ga0207657_10308331 3300025919 Bacteria 1253
204 Ga0207649_10024304 3300025920 Bacteria 3520
205 Ga0207649_10026770 3300025920 Bacteria 3377
206 Ga0207649_10086900 3300025920 Bacteria 2039
207 Ga0207652_10001115 3300025921 Bacteria 24239
208 Ga0207652_10014022 3300025921 Bacteria 6488
209 Ga0207652_10023024 3300025921 Bacteria 5160
210 Ga0207652_10024994 3300025921 Bacteria 4961
211 Ga0207652_10042588 3300025921 Bacteria 3865
212 Ga0207652_10047232 3300025921 Bacteria 3677
213 Ga0207652_10066922 3300025921 Bacteria 3114
214 Ga0207652_10111774 3300025921 Bacteria 2423
215 Ga0207646_10000953 3300025922 Bacteria 37249
216 Ga0207646_10026506 3300025922 Bacteria 5288
217 Ga0207650_10131865 3300025925 Bacteria 1956
218 Ga0207687_10043711 3300025927 Bacteria 3088
219 Ga0207700_10008879 3300025928 Bacteria 6251
220 Ga0207700_10014089 3300025928 Bacteria 5228
221 Ga0207700_10099662 3300025928 Bacteria 2314
222 Ga0207700_10256903 3300025928 Bacteria 1494
223 Ga0207664_10058057 3300025929 Bacteria 3077
224 Ga0207644_10084440 3300025931 Bacteria 2354
225 Ga0207690_10113745 3300025932 Bacteria 1953
226 Ga0207706_10075797 3300025933 Bacteria 2959
227 Ga0207706_10166710 3300025933 Bacteria 1936
228 Ga0207686_10106588 3300025934 Bacteria 1882
229 Ga0207670_10129459 3300025936 Bacteria 1846
230 Ga0207669_10242044 3300025937 Unclassified 1338
231 Ga0207704_10038991 3300025938 Bacteria 2761
232 Ga0207704_10129508 3300025938 Bacteria 1744
233 Ga0207665_10005679 3300025939 Bacteria 8308
234 Ga0207665_10015964 3300025939 Bacteria 4931
235 Ga0207665_10020898 3300025939 Bacteria 4303
236 Ga0207691_10030118 3300025940 Bacteria 5073
237 Ga0207691_10052759 3300025940 Bacteria 3713
238 Ga0207691_10074645 3300025940 Bacteria 3058
239 Ga0207661_10001922 3300025944 Bacteria 14269
240 Ga0207661_10002866 3300025944 Bacteria 11916
241 Ga0207661_10006923 3300025944 Bacteria 8041
242 Ga0207661_10012131 3300025944 Bacteria 6258
243 Ga0207661_10030241 3300025944 Bacteria 4169
244 Ga0207661_10047106 3300025944 Bacteria 3421
245 Ga0207661_10081133 3300025944 Bacteria 2679
246 Ga0207661_10141782 3300025944 Unclassified 2069
247 Ga0207679_10026964 3300025945 Bacteria 3968
248 Ga0207679_10054641 3300025945 Bacteria 2941
249 Ga0207667_10032127 3300025949 Bacteria 5658
250 Ga0207667_10117936 3300025949 Bacteria 2735
251 Ga0207667_10249847 3300025949 Unclassified 1814
252 Ga0207667_10262182 3300025949 Unclassified 1767
253 Ga0207651_10359665 3300025960 Bacteria 1228
254 Ga0207668_10059209 3300025972 Bacteria 2682
255 Ga0207640_10003579 3300025981 Bacteria 8378
256 Ga0207658_10044842 3300025986 Bacteria 3221
257 Ga0207658_10082119 3300025986 Bacteria 2474
258 Ga0207677_10018195 3300026023 Bacteria 4213
259 Ga0207677_10018586 3300026023 Bacteria 4174
260 Ga0207639_10319375 3300026041 Unclassified 1378
261 Ga0207702_10099049 3300026078 Bacteria 2569
262 Ga0207702_10181110 3300026078 Bacteria 1940
263 Ga0207702_10246829 3300026078 Unclassified 1675
264 Ga0207702_10406467 3300026078 Bacteria 1314
265 Ga0207648_10026191 3300026089 Bacteria 5184
266 Ga0207674_10003369 3300026116 Bacteria 19621
267 Ga0207698_10273629 3300026142 Bacteria 1558
268 Ga0207698_10355657 3300026142 Bacteria 1385
269 Ga0209981_1006076 3300027378 Bacteria 1613
270 Ga0210000_1005853 3300027462 Bacteria 1788
271 Ga0209966_1001492 3300027695 Bacteria 4066
272 Ga0209966_1002669 3300027695 Bacteria 2985
273 Ga0209998_10000136 3300027717 Bacteria 28757
274 Ga0268264_10102232 3300028381 Bacteria 2493
275 Ga0265318_10057277 3300028577 Bacteria 1457
276 Ga0307408_100016674 3300031548 Bacteria 4910
277 Ga0307408_100070619 3300031548 Unclassified 2579
278 Ga0307408_100173069 3300031548 Bacteria 1725
279 Ga0307408_100342209 3300031548 Bacteria 1266
280 Ga0265342_10044151 3300031712 Bacteria 2688
281 Ga0307405_10006271 3300031731 Bacteria 5834
282 Ga0307413_10002358 3300031824 Bacteria 7664
283 Ga0307413_10006200 3300031824 Bacteria 5433
284 Ga0307413_10024749 3300031824 Bacteria 3278
285 Ga0307413_10261187 3300031824 Bacteria 1291
286 Ga0307410_10009265 3300031852 Bacteria 5512
287 Ga0307410_10011155 3300031852 Bacteria 5126
288 Ga0307406_10011055 3300031901 Bacteria 5112
289 Ga0307406_10025120 3300031901 Bacteria 3564
290 Ga0307406_10028869 3300031901 Bacteria 3354
291 Ga0307407_10005344 3300031903 Bacteria 5564
292 Ga0307407_10008284 3300031903 Bacteria 4762
293 Ga0307407_10023515 3300031903 Bacteria 3217
294 Ga0307407_10131141 3300031903 Unclassified 1604
295 Ga0307412_10009088 3300031911 Bacteria 5695
296 Ga0307412_10011248 3300031911 Bacteria 5176
297 Ga0307409_100003092 3300031995 Bacteria 8914
298 Ga0307409_100008554 3300031995 Bacteria 6220
299 Ga0307409_100056501 3300031995 Bacteria 3035
300 Ga0307409_100409737 3300031995 Archaea 1297
301 Ga0307416_100004471 3300032002 Bacteria 8436
302 Ga0307416_100079873 3300032002 Bacteria 2758
303 Ga0307416_100112788 3300032002 Bacteria 2400
304 Ga0307416_100120885 3300032002 Bacteria 2333
305 Ga0307416_100123656 3300032002 Bacteria 2313
306 Ga0307414_10003698 3300032004 Bacteria 8198
307 Ga0307414_10051143 3300032004 Bacteria 2866
308 Ga0307411_10007006 3300032005 Bacteria 5697
309 Ga0307411_10030954 3300032005 Bacteria 3286
310 Ga0307411_10272161 3300032005 Bacteria 1344
311 Ga0307415_100008906 3300032126 Bacteria 5591
312 Ga0307415_100008992 3300032126 Bacteria 5572
313 Ga0307415_100023790 3300032126 Bacteria 3811
314 Ga0307415_100157773 3300032126 Bacteria 1754
315 Ga0373959_0015798 3300034820 Bacteria 1391
316 Ga0373934_0017321 3300035086 Bacteria 2750
317 Ga0373923_0001998 3300035111 Bacteria 6132
318 Ga0373945_0006429 3300035116 Bacteria 3789
319 Ga0373953_0007976 3300035117 Bacteria 3574
320 Ga0373953_0081574 3300035117 Unclassified 1345
321 Ga0373954_0044252 3300035118 Unclassified 2077
322 Ga0373956_0003151 3300035119 Bacteria 6666
323 Ga0373943_0001808 3300035170 Bacteria 9676
324 Ga0373946_0003649 3300035171 Bacteria 5451
325 Ga0373955_0000236 3300035172 Bacteria 22890
326 Ga0373955_0010516 3300035172 Bacteria 4374
327 Ga0373935_0003719 3300035692 Bacteria 8903
328 Ga0373935_0030206 3300035692 Unclassified 3357
329 Ga0373927_0023911 3300035695 Bacteria 3997
330 Ga0373947_0006652 3300035725 Bacteria 6709
331 Ga0373937_0023402 3300036401 Bacteria 5561
332 Ga0373937_0036174 3300036401 Bacteria 4498
333 Ga0373925_0002761 3300037068 Bacteria 13896
334 Ga0436365_1137226 3300039437 Bacteria 8383
335 Ga0466957_0147850 3300044842 Bacteria 1518
336 Ga0466959_0023810 3300045049 Bacteria 4534
337 Ga0451576_0303615 3300045051 Bacteria 1670
338 Ga0466958_0048072 3300045836 Bacteria 2577
339 Ga0495592_0028091 3300046454 Bacteria 4261
340 Ga0495603_0010635 3300046455 Bacteria 5578
341 Ga0495629_0036669 3300046459 Bacteria 3459
342 Ga0495629_0040668 3300046459 Bacteria 3271
343 Ga0495651_0006407 3300046462 Bacteria 9007
344 Ga0495651_0035212 3300046462 Bacteria 3900
345 Ga0495653_0085257 3300046463 Bacteria 2324
346 Ga0495580_0001782 3300046472 Bacteria 18945
347 Ga0495580_0186957 3300046472 Bacteria 1430
348 Ga0495582_0000810 3300046473 Bacteria 17365
349 Ga0495582_0083540 3300046473 Bacteria 1775
350 Ga0495639_0000043 3300046475 Bacteria 55213
351 Ga0495662_0042992 3300046476 Bacteria 2181
352 Ga0495608_0000059 3300046511 Bacteria 89203
353 Ga0495618_0108855 3300046514 Unclassified 1774
354 Ga0495628_0000161 3300046516 Bacteria 58486
355 Ga0495628_0041987 3300046516 Bacteria 3649
356 Ga0495630_0002393 3300046517 Bacteria 13036
357 Ga0495630_0002571 3300046517 Bacteria 12577
358 Ga0495630_0124131 3300046517 Unclassified 1959
359 Ga0495652_0006499 3300046529 Bacteria 10868
360 Ga0495665_0000754 3300046531 Bacteria 16781
361 Ga0495640_0047488 3300046533 Bacteria 2971
362 Ga0495586_0104107 3300046535 Bacteria 1577
363 Ga0495587_0004474 3300046536 Bacteria 9196
364 Ga0495587_0024475 3300046536 Bacteria 3699
365 Ga0495645_0002376 3300046543 Bacteria 12770
366 Ga0495645_0002518 3300046543 Bacteria 12437
367 Ga0495667_0005581 3300046559 Bacteria 8510
368 Ga0495635_0004439 3300046663 Bacteria 9720
369 Ga0495588_0000269 3300046674 Bacteria 40277
370 Ga0495657_0016083 3300046675 Bacteria 5457
371 Ga0495599_0000742 3300046678 Bacteria 18400
372 Ga0495599_0011305 3300046678 Bacteria 5482
373 Ga0495623_0118746 3300046679 Unclassified 1594
374 Ga0495646_0025750 3300046680 Bacteria 3698
375 Ga0495646_0034194 3300046680 Bacteria 3158
376 Ga0495658_0001378 3300046683 Bacteria 12747
377 Ga0495600_0001679 3300046809 Bacteria 12357
378 Ga0495581_0000773 3300047315 Bacteria 16961
379 Ga0495674_0001828 3300047319 Bacteria 20992
380 Ga0495672_0008436 3300047320 Bacteria 7606
381 Ga0495680_0005292 3300047322 Bacteria 12177
382 Ga0495680_0016829 3300047322 Bacteria 6265
383 Ga0495675_0005939 3300047444 Bacteria 7462
384 Ga0495675_0020795 3300047444 Bacteria 4176
385 Ga0495675_0165519 3300047444 Unclassified 1360
386 Ga0495684_0006652 3300047471 Bacteria 8965
387 Ga0495593_0000046 3300047673 Bacteria 50024
388 Ga0495593_0052263 3300047673 Bacteria 2160
389 Ga0495602_0000949 3300048088 Bacteria 27975
390 Ga0495614_0006289 3300048089 Bacteria 5336
391 Ga0496101_0084570 3300048904 Bacteria 2350
392 Ga0496108_0085257 3300048911 Bacteria 2681
393 Ga0496109_0138550 3300048912 Bacteria 2275
394 Ga0496112_0041931 3300048915 Bacteria 4479
395 Ga0496112_0371059 3300048915 Unclassified 1372
396 Ga0496113_0104559 3300048916 Unclassified 2197
397 Ga0496115_0001944 3300048918 Bacteria 14740
398 Ga0496115_0199326 3300048918 Bacteria 1654
399 Ga0501031_0014672 3300049568 Bacteria 5092
400 Ga0501033_0055778 3300049570 Bacteria 2921
401 Ga0501034_0048987 3300049571 Bacteria 4264
402 Ga0501040_0011336 3300049576 Bacteria 5834
403 Ga0501042_0038904 3300049578 Bacteria 3378
404 Ga0501072_0185435 3300049588 Bacteria 1660
405 Ga0501075_0028979 3300049591 Bacteria 4092
406 Ga0501202_014514 3300049652 Bacteria 1508
407 Ga0501216_000654 3300049660 Bacteria 4252
408 Ga0501223_004668 3300049663 Bacteria 2914
409 Ga0501228_000846 3300049666 Bacteria 2076
410 Ga0501233_008773 3300049668 Unclassified 1957
411 Ga0501235_000739 3300049669 Bacteria 6663
412 Ga0501250_006483 3300049680 Unclassified 1239
413 Ga0501251_004230 3300049681 Bacteria 1474
414 Ga0501221_008467 3300049704 Bacteria 1788
415 Ga0501225_0000992 3300049705 Bacteria 8892
416 Ga0501234_003365 3300049707 Unclassified 2516
417 Ga0501245_001350 3300049708 Bacteria 3156
418 Ga0501079_0059019 3300049741 Bacteria 2960
419 Ga0501080_0194922 3300049742 Bacteria 1861
420 Ga0501262_001075 3300049759 Bacteria 3105
421 Ga0501266_000369 3300049763 Bacteria 5995
422 Ga0501268_003136 3300049765 Bacteria 2240
423 Ga0501273_004014 3300049770 Bacteria 1596
424 Ga0501044_0140017 3300049823 Bacteria 2408
425 nmdc:mga09592_88120_c2 3300050508 Bacteria 1762
426 nmdc:mga0qj67_306898_c1 3300050509 Unclassified 1285
427 nmdc:mga06r32_10207_c1 3300050510 Bacteria 8477
428 nmdc:mga0n895_23772_c1 3300050512 Bacteria 5766
429 nmdc:mga0rr50_196361_c1 3300050513 Bacteria 1656
430 nmdc:mga0rr50_235243_c1 3300050513 Bacteria 1517
431 nmdc:mga08x19_116835_c1 3300050514 Bacteria 1784
432 nmdc:mga08x19_13223_c1 3300050514 Bacteria 4984
433 nmdc:mga08x19_13755_c1 3300050514 Bacteria 4899
434 nmdc:mga08x19_195780_c1 3300050514 Unclassified 1384
435 nmdc:mga0a205_155764_c1 3300050515 Bacteria 2183
436 Ga0495601_0012017 3300053077 Bacteria 5188
437 Ga0495612_0007076 3300053078 Bacteria 4589
438 Ga0495619_0011601 3300053085 Bacteria 5553
439 Ga0500596_006515 3300053735 Bacteria 1969
440 Ga0070693_100015691
441 Ga0065712_10112877
442 Ga0065715_10027856
443 Ga0065715_10089295
444 Ga0070658_10009478
445 Ga0070658_10188004
446 Ga0070658_10244055
447 Ga0070676_10012682
448 Ga0070683_100013293
449 Ga0070683_100013774
450 Ga0070683_100031654
451 Ga0070683_100133547
452 Ga0070683_100171373
453 Ga0070690_100067361
454 Ga0068869_100106461
455 Ga0070680_100001993
456 Ga0070680_100040464
457 Ga0070680_100046318
458 Ga0070680_100055994
459 Ga0070680_100095163
460 Ga0070680_100120719
461 Ga0070680_100277386
462 Ga0070682_100001315
463 Ga0070682_100021214
464 Ga0070682_100056251
465 Ga0068868_100070646
466 Ga0070660_100018864
467 Ga0070689_100058825
468 Ga0070691_10000411
469 Ga0070661_100033409
470 Ga0070661_100036160
471 Ga0070661_100125860
472 Ga0070661_100135484
473 Ga0070692_10033914
474 Ga0070668_100092337
475 Ga0070671_100124197
476 Ga0070673_100035438
477 Ga0070673_100197438
478 Ga0070659_100044394
479 Ga0070659_100333399
480 Ga0070667_100047081
481 Ga0070667_100060188
482 Ga0070709_10007405
483 Ga0070709_10151808
484 Ga0070714_100008717
485 Ga0070714_100018353
486 Ga0070713_100000500
487 Ga0070713_100001301
488 Ga0070713_100012906
489 Ga0070713_100142160
490 Ga0070708_100000081
491 Ga0070708_100000093
492 Ga0070708_100012332
493 Ga0070662_100115085
494 Ga0070681_10003491
495 Ga0070681_10006979
496 Ga0070681_10031269
497 Ga0070681_10039505
498 Ga0070681_10129321
499 Ga0068867_100028837
500 Ga0070706_100010875
501 Ga0070706_100146608
502 Ga0070707_100000636
503 Ga0070707_100096451
504 Ga0070698_100021731
505 Ga0070699_100012592
506 Ga0070699_100052420
507 Ga0070699_100088065
508 Ga0070699_100155613
509 Ga0070699_100277069
510 Ga0070679_100002497
511 Ga0070679_100010151
512 Ga0070679_100020941
513 Ga0070679_100034772
514 Ga0070679_100035447
515 Ga0070679_100052302
516 Ga0070679_100069041
517 Ga0070679_100069977
518 Ga0070679_100092635
519 Ga0070679_100152056
520 Ga0070679_100206046
521 Ga0070679_100519526
522 Ga0070684_100001598
523 Ga0070684_100002439
524 Ga0070684_100004210
525 Ga0070684_100053416
526 Ga0070684_100112925
527 Ga0070684_100127383
528 Ga0070684_100302193
529 Ga0070697_100111308
530 Ga0070697_100142698
531 Ga0070697_100153513
532 Ga0068853_100078928
533 Ga0068853_100347806
534 Ga0070672_100053688
535 Ga0070686_100118726
536 Ga0070695_100001292
537 Ga0070695_100046352
538 Ga0070695_100114773
539 Ga0070696_100002156
540 Ga0070696_100010172
541 Ga0070693_100028548
542 Ga0068855_100005334
543 Ga0068855_100044560
544 Ga0068855_100072482
545 Ga0068855_100258015
546 Ga0068855_100276929
547 Ga0070664_100016858
548 Ga0070664_100051383
549 Ga0070664_100056670
550 Ga0070664_100125447
551 Ga0070664_100149062
552 Ga0070664_100347484
553 Ga0068857_100020139
554 Ga0068857_100295643
555 Ga0068856_100469410
556 Ga0068852_100177928
557 Ga0068852_100254457
558 Ga0068859_100019008
559 Ga0068851_10054071
560 Ga0068870_10023552
561 Ga0068860_100126519
562 Ga0070716_100009440
563 Ga0070712_100065419
564 Ga0070712_100205731
565 Ga0075430_100026380
566 Ga0075430_100161037
567 Ga0075431_100107155
568 Ga0075433_10079648
569 Ga0068865_100098835
570 Ga0075436_100010664
571 Ga0075436_100050213
572 Ga0075436_100105298
573 Ga0075436_100185968
574 Ga0097620_100019008
575 Ga0075435_100060193
576 Ga0075435_100062999
577 Ga0075435_100170504
578 Ga0105240_10017969
579 Ga0105240_10024524
580 Ga0105240_10078423
581 Ga0105240_10102412
582 Ga0105245_10013990
583 Ga0105245_10137226
584 Ga0105245_10218946
585 Ga0105243_10028598
586 Ga0105241_10085419
587 Ga0105241_10216014
588 Ga0105248_10079849
589 Ga0105248_10137408
590 Ga0105248_10153375
591 Ga0157373_10006122
592 Ga0157373_10109792
593 Ga0157370_10007632
594 Ga0157370_10054965
595 Ga0157369_10040457
596 Ga0157374_10058747
597 Ga0157374_10169828
598 Ga0157378_10105876
599 Ga0157378_10175941
600 Ga0163162_10045549
601 Ga0157372_10022699
602 Ga0157372_10050223
603 Ga0157372_10059838
604 Ga0157372_10065271
605 Ga0157372_10123752
606 Ga0157375_10029205
607 Ga0157375_10045390
608 Ga0157375_10125344
609 Ga0182008_10027605
610 Ga0157377_10033892
611 Ga0163161_10076047
612 Ga0213876_10036946
613 Ga0207692_10094518
614 Ga0207699_10003350
615 Ga0207699_10008735
616 Ga0207699_10019187
617 Ga0207645_10156682
618 Ga0207643_10020057
619 Ga0207705_10012823
620 Ga0207684_10055970
621 Ga0207654_10037323
622 Ga0207707_10001939
623 Ga0207707_10003196
624 Ga0207707_10011888
625 Ga0207707_10012337
626 Ga0207707_10031670
627 Ga0207707_10039933
628 Ga0207707_10046617
629 Ga0207707_10047474
630 Ga0207707_10077208
631 Ga0207707_10096129
632 Ga0207695_10009859
633 Ga0207695_10014927
634 Ga0207693_10017954
635 Ga0207660_10000500
636 Ga0207660_10058459
637 Ga0207660_10072695
638 Ga0207660_10092845
639 Ga0207660_10261142
640 Ga0207662_10054698
641 Ga0207657_10021863
642 Ga0207657_10308331
643 Ga0207649_10024304
644 Ga0207649_10026770
645 Ga0207649_10086900
646 Ga0207652_10001115
647 Ga0207652_10014022
648 Ga0207652_10023024
649 Ga0207652_10024994
650 Ga0207652_10042588
651 Ga0207652_10047232
652 Ga0207652_10066922
653 Ga0207652_10111774
654 Ga0207646_10000953
655 Ga0207646_10026506
656 Ga0207650_10131865
657 Ga0207687_10043711
658 Ga0207700_10008879
659 Ga0207700_10014089
660 Ga0207700_10099662
661 Ga0207700_10256903
662 Ga0207664_10058057
663 Ga0207644_10084440
664 Ga0207690_10113745
665 Ga0207706_10075797
666 Ga0207706_10166710
667 Ga0207686_10106588
668 Ga0207670_10129459
669 Ga0207669_10242044
670 Ga0207704_10038991
671 Ga0207704_10129508
672 Ga0207665_10005679
673 Ga0207665_10015964
674 Ga0207665_10020898
675 Ga0207691_10030118
676 Ga0207691_10052759
677 Ga0207691_10074645
678 Ga0207661_10001922
679 Ga0207661_10002866
680 Ga0207661_10006923
681 Ga0207661_10012131
682 Ga0207661_10030241
683 Ga0207661_10047106
684 Ga0207661_10081133
685 Ga0207661_10141782
686 Ga0207679_10026964
687 Ga0207679_10054641
688 Ga0207667_10032127
689 Ga0207667_10117936
690 Ga0207667_10249847
691 Ga0207667_10262182
692 Ga0207651_10359665
693 Ga0207668_10059209
694 Ga0207640_10003579
695 Ga0207658_10044842
696 Ga0207658_10082119
697 Ga0207677_10018195
698 Ga0207677_10018586
699 Ga0207639_10319375
700 Ga0207702_10099049
701 Ga0207702_10181110
702 Ga0207702_10246829
703 Ga0207702_10406467
704 Ga0207648_10026191
705 Ga0207674_10003369
706 Ga0207698_10273629
707 Ga0207698_10355657
708 Ga0209981_1006076
709 Ga0210000_1005853
710 Ga0209966_1001492
711 Ga0209966_1002669
712 Ga0209998_10000136
713 Ga0268264_10102232
714 Ga0265318_10057277
715 Ga0307408_100016674
716 Ga0307408_100070619
717 Ga0307408_100173069
718 Ga0307408_100342209
719 Ga0265342_10044151
720 Ga0307405_10006271
721 Ga0307413_10002358
722 Ga0307413_10006200
723 Ga0307413_10024749
724 Ga0307413_10261187
725 Ga0307410_10009265
726 Ga0307410_10011155
727 Ga0307406_10011055
728 Ga0307406_10025120
729 Ga0307406_10028869
730 Ga0307407_10005344
731 Ga0307407_10008284
732 Ga0307407_10023515
733 Ga0307407_10131141
734 Ga0307412_10009088
735 Ga0307412_10011248
736 Ga0307409_100003092
737 Ga0307409_100008554
738 Ga0307409_100056501
739 Ga0307409_100409737
740 Ga0307416_100004471
741 Ga0307416_100079873
742 Ga0307416_100112788
743 Ga0307416_100120885
744 Ga0307416_100123656
745 Ga0307414_10003698
746 Ga0307414_10051143
747 Ga0307411_10007006
748 Ga0307411_10030954
749 Ga0307411_10272161
750 Ga0307415_100008906
751 Ga0307415_100008992
752 Ga0307415_100023790
753 Ga0307415_100157773
754 Ga0373959_0015798
755 Ga0373934_0017321
756 Ga0373923_0001998
757 Ga0373945_0006429
758 Ga0373953_0007976
759 Ga0373953_0081574
760 Ga0373954_0044252
761 Ga0373956_0003151
762 Ga0373943_0001808
763 Ga0373946_0003649
764 Ga0373955_0000236
765 Ga0373955_0010516
766 Ga0373935_0003719
767 Ga0373935_0030206
768 Ga0373927_0023911
769 Ga0373947_0006652
770 Ga0373937_0023402
771 Ga0373937_0036174
772 Ga0373925_0002761
773 Ga0436365_1137226
774 Ga0466957_0147850
775 Ga0466959_0023810
776 Ga0451576_0303615
777 Ga0466958_0048072
778 Ga0495592_0028091
779 Ga0495603_0010635
780 Ga0495629_0036669
781 Ga0495629_0040668
782 Ga0495651_0006407
783 Ga0495651_0035212
784 Ga0495653_0085257
785 Ga0495580_0001782
786 Ga0495580_0186957
787 Ga0495582_0000810
788 Ga0495582_0083540
789 Ga0495639_0000043
790 Ga0495662_0042992
791 Ga0495608_0000059
792 Ga0495618_0108855
793 Ga0495628_0000161
794 Ga0495628_0041987
795 Ga0495630_0002393
796 Ga0495630_0002571
797 Ga0495630_0124131
798 Ga0495652_0006499
799 Ga0495665_0000754
800 Ga0495640_0047488
801 Ga0495586_0104107
802 Ga0495587_0004474
803 Ga0495587_0024475
804 Ga0495645_0002376
805 Ga0495645_0002518
806 Ga0495667_0005581
807 Ga0495635_0004439
808 Ga0495588_0000269
809 Ga0495657_0016083
810 Ga0495599_0000742
811 Ga0495599_0011305
812 Ga0495623_0118746
813 Ga0495646_0025750
814 Ga0495646_0034194
815 Ga0495658_0001378
816 Ga0495600_0001679
817 Ga0495581_0000773
818 Ga0495674_0001828
819 Ga0495672_0008436
820 Ga0495680_0005292
821 Ga0495680_0016829
822 Ga0495675_0005939
823 Ga0495675_0020795
824 Ga0495675_0165519
825 Ga0495684_0006652
826 Ga0495593_0000046
827 Ga0495593_0052263
828 Ga0495602_0000949
829 Ga0495614_0006289
830 Ga0496101_0084570
831 Ga0496108_0085257
832 Ga0496109_0138550
833 Ga0496112_0041931
834 Ga0496112_0371059
835 Ga0496113_0104559
836 Ga0496115_0001944
837 Ga0496115_0199326
838 Ga0501031_0014672
839 Ga0501033_0055778
840 Ga0501034_0048987
841 Ga0501040_0011336
842 Ga0501042_0038904
843 Ga0501072_0185435
844 Ga0501075_0028979
845 Ga0501202_014514
846 Ga0501216_000654
847 Ga0501223_004668
848 Ga0501228_000846
849 Ga0501233_008773
850 Ga0501235_000739
851 Ga0501250_006483
852 Ga0501251_004230
853 Ga0501221_008467
854 Ga0501225_0000992
855 Ga0501234_003365
856 Ga0501245_001350
857 Ga0501079_0059019
858 Ga0501080_0194922
859 Ga0501262_001075
860 Ga0501266_000369
861 Ga0501268_003136
862 Ga0501273_004014
863 Ga0501044_0140017
864 nmdc:mga09592_88120_c2
865 nmdc:mga0qj67_306898_c1
866 nmdc:mga06r32_10207_c1
867 nmdc:mga0n895_23772_c1
868 nmdc:mga0rr50_196361_c1
869 nmdc:mga0rr50_235243_c1
870 nmdc:mga08x19_116835_c1
871 nmdc:mga08x19_13223_c1
872 nmdc:mga08x19_13755_c1
873 nmdc:mga08x19_195780_c1
874 nmdc:mga0a205_155764_c1
875 Ga0495601_0012017
876 Ga0495612_0007076
877 Ga0495619_0011601
878 Ga0500596_006515

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

184

313

0.95

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

27

143

0.88

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

216

347

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5env-assembly1.cif.gz_A yeast alcohol dehydrogenase with bound coenzyme 0.9437 2 343
2eih-assembly1.cif.gz_A crystal structure of nad-dependent alcohol dehydrogenase 0.9434 1 345
7kc2-assembly1.cif.gz_A symmetry in yeast alcohol dehydrogenase 1 -closed form with nadh 0.9409 2 343
2eih-assembly1.cif.gz_A crystal structure of nad-dependent alcohol dehydrogenase 0.9408 1 345
6iqd-assembly1.cif.gz_A crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus 0.9388 1 343
ID Description Score Start End Superfamily
2eihB01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9478 1 345 3.90.180.10
2eihB01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9432 1 345 3.90.180.10
af_O65423_126_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.93 155 290 3.40.50.720
2eihB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9291 151 292 3.40.50.720
af_B4G1G0_229_356_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9285 164 288 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A202DI34-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9681 1 343 GO:0016491
AF-A0A5C9EB97-F1-model_v4 NAD-dependent alcohol dehydrogenase 0.9667 1 343 GO:0016491
AF-A0A2V7IB97-F1-model_v4 NADPH:quinone reductase 0.9654 183 346
AF-A0A2E6J7J6-F1-model_v4 Alcohol dehydrogenase 0.962 1 344 GO:0016491
AF-A0A5C9EB97-F1-model_v4 NAD-dependent alcohol dehydrogenase 0.9584 1 343 GO:0016491

Map