F444018

General Info

Members Datasets Scaffolds Average Seq Length
438 209 876 264

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10108750|Ga0307410_101087502
Length 290
Sequence LRSFCVWAKLALTVSPLLPCGPLHFLMNTPRISASSYSNTAPLIWSFLYGSNHGKVEIILDNAPARSAELLGQNRVDAALVPVIAYQFIEDARLIPGVCVGAKERVRSVCLVTKGSELADVRSISLDVSSRTSVTLTKIIFREFLGFEPEWKDAKPDIDTMLAAECGIRGGDLSLDAAAGVPRPPIRKFDLAELWRTHTGLGFVFAMWMTTQRMCPIDFAAARDEGTAHIDEIIANYQPEIGIGRKEMRRYLSENITYSPDESMLAGMELYFKLAARHGFGGRNANLIYI

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
167 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
168 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
177 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
178 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
181 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
182 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
183 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
184 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
185 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
186 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
187 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
188 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
189 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
190 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
191 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
192 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
193 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
194 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
195 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
196 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
197 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
198 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
199 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
200 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
201 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
202 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
203 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
204 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
207 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 0.46
Rhizosphere 98.17
Stem 0
Stem Tuber 0
Unclassified 15.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10108750 3300031852 Bacteria 2002
2 CNBas_1000415 3300000531 Bacteria 1834
3 LJQas_1000054 3300000549 Bacteria 18490
4 JGI24751J29686_10000012 3300002459 Bacteria 115709
5 JGI25406J46586_10007212 3300003203 Bacteria 5086
6 JGI25406J46586_10010473 3300003203 Bacteria 4112
7 rootH1_10121963 3300003316 Bacteria 2142
8 rootH2_10103074 3300003320 Unclassified 1293
9 rootL2_10341072 3300003322 Unclassified 1438
10 Ga0065714_10064422 3300005288 Bacteria 270668
11 Ga0065712_10004308 3300005290 Bacteria 5538
12 Ga0065712_10067728 3300005290 Bacteria 178215
13 Ga0065715_10007317 3300005293 Bacteria 2994
14 Ga0065715_10089399 3300005293 Bacteria 10523
15 Ga0065715_10092248 3300005293 Bacteria 5233
16 Ga0065715_10115356 3300005293 Unclassified 2417
17 Ga0065715_10134253 3300005293 Bacteria 1958
18 Ga0070658_10034679 3300005327 Bacteria 4060
19 Ga0070683_100076017 3300005329 Bacteria 3139
20 Ga0070683_100195029 3300005329 Bacteria 1923
21 Ga0070690_100005576 3300005330 Bacteria 7081
22 Ga0070690_100323754 3300005330 Bacteria 1111
23 Ga0070670_100000165 3300005331 Bacteria 59984
24 Ga0070670_100008199 3300005331 Bacteria 8893
25 Ga0070670_100027682 3300005331 Bacteria 4876
26 Ga0070670_100041765 3300005331 Bacteria 3941
27 Ga0070670_100150448 3300005331 Bacteria 2014
28 Ga0068869_100089140 3300005334 Bacteria 2316
29 Ga0070680_100262832 3300005336 Unclassified 1460
30 Ga0070680_100600274 3300005336 Unclassified 945
31 Ga0070689_100015634 3300005340 Bacteria 5538
32 Ga0070687_100111119 3300005343 Bacteria 1551
33 Ga0070669_100008592 3300005353 Bacteria 7290
34 Ga0070675_100009139 3300005354 Bacteria 7698
35 Ga0070671_100064205 3300005355 Bacteria 3058
36 Ga0070671_100179583 3300005355 Unclassified 1792
37 Ga0070671_100270522 3300005355 Bacteria 1444
38 Ga0070674_100063868 3300005356 Bacteria 2578
39 Ga0070673_100061494 3300005364 Bacteria 2980
40 Ga0070673_100166531 3300005364 Unclassified 1878
41 Ga0070673_100313460 3300005364 Viruses 1384
42 Ga0070673_100320749 3300005364 Bacteria 1368
43 Ga0070688_100057903 3300005365 Bacteria 2438
44 Ga0070659_100054313 3300005366 Bacteria 3155
45 Ga0070659_100133722 3300005366 Bacteria 2016
46 Ga0070667_100025041 3300005367 Bacteria 4959
47 Ga0070667_100169482 3300005367 Unclassified 1927
48 Ga0070701_10300529 3300005438 Unclassified 986
49 Ga0070705_100047986 3300005440 Bacteria 2471
50 Ga0070705_100076814 3300005440 Bacteria 2038
51 Ga0070700_100031420 3300005441 Bacteria 3182
52 Ga0070700_100084871 3300005441 Bacteria 2053
53 Ga0070694_100015542 3300005444 Bacteria 4782
54 Ga0070694_100300580 3300005444 Bacteria 1230
55 Ga0070694_100334131 3300005444 Bacteria 1170
56 Ga0070708_100000343 3300005445 Bacteria 35108
57 Ga0070662_100073097 3300005457 Unclassified 2533
58 Ga0070662_100123351 3300005457 Unclassified 1988
59 Ga0070662_100179738 3300005457 Bacteria 1667
60 Ga0070681_10096457 3300005458 Unclassified 2905
61 Ga0068867_100051848 3300005459 Bacteria 3027
62 Ga0070706_100000128 3300005467 Bacteria 92969
63 Ga0070706_100104088 3300005467 Bacteria 2639
64 Ga0070707_100021729 3300005468 Bacteria 6065
65 Ga0070698_100002257 3300005471 Bacteria 21324
66 Ga0070699_100001091 3300005518 Bacteria 25262
67 Ga0070699_100001108 3300005518 Bacteria 25059
68 Ga0070699_100006200 3300005518 Bacteria 10444
69 Ga0070679_100011688 3300005530 Bacteria 8370
70 Ga0070679_100013285 3300005530 Bacteria 7883
71 Ga0070684_100233122 3300005535 Bacteria 1681
72 Ga0070684_100297636 3300005535 Bacteria 1480
73 Ga0070697_100011849 3300005536 Bacteria 6825
74 Ga0070697_100133246 3300005536 Bacteria 2085
75 Ga0068853_100014162 3300005539 Bacteria 6529
76 Ga0068853_100121547 3300005539 Bacteria 2330
77 Ga0068853_100332209 3300005539 Bacteria 1411
78 Ga0070672_100253765 3300005543 Bacteria 1482
79 Ga0070686_100337076 3300005544 Bacteria 1129
80 Ga0070686_100422880 3300005544 Unclassified 1018
81 Ga0070695_100074870 3300005545 Bacteria 2225
82 Ga0070695_100090364 3300005545 Bacteria 2043
83 Ga0070695_100098965 3300005545 Bacteria 1960
84 Ga0070696_100008161 3300005546 Bacteria 7005
85 Ga0070696_100174306 3300005546 Bacteria 1592
86 Ga0070696_100203789 3300005546 Bacteria 1478
87 Ga0070693_100014841 3300005547 Bacteria 4002
88 Ga0070693_100079513 3300005547 Bacteria 1951
89 Ga0070693_100212861 3300005547 Bacteria 1262
90 Ga0070693_100228180 3300005547 Bacteria 1224
91 Ga0070704_100117909 3300005549 Bacteria 2033
92 Ga0070704_100255715 3300005549 Bacteria 1441
93 Ga0068855_100035262 3300005563 Bacteria 5959
94 Ga0070664_100036125 3300005564 Bacteria 4150
95 Ga0068857_100663203 3300005577 Unclassified 989
96 Ga0068854_100027463 3300005578 Bacteria 3923
97 Ga0068854_100185505 3300005578 Unclassified 1627
98 Ga0068854_100204441 3300005578 Unclassified 1554
99 Ga0070702_100069532 3300005615 Bacteria 2075
100 Ga0068852_100076776 3300005616 Bacteria 2950
101 Ga0068859_100008584 3300005617 Bacteria 10330
102 Ga0068859_100008676 3300005617 Bacteria 10275
103 Ga0068859_100032379 3300005617 Bacteria 5252
104 Ga0068859_100183382 3300005617 Bacteria 2176
105 Ga0068859_100237223 3300005617 Unclassified 1912
106 Ga0068859_100355595 3300005617 Bacteria 1559
107 Ga0068859_100562254 3300005617 Bacteria 1235
108 Ga0068859_101132606 3300005617 Bacteria 861
109 Ga0068864_100007967 3300005618 Bacteria 8732
110 Ga0068864_100041285 3300005618 Unclassified 3946
111 Ga0068864_100078734 3300005618 Bacteria 2885
112 Ga0068864_100109565 3300005618 Bacteria 2458
113 Ga0068864_100143990 3300005618 Unclassified 2152
114 Ga0068861_100011172 3300005719 Bacteria 6235
115 Ga0068861_100522375 3300005719 Bacteria 1077
116 Ga0068851_10013065 3300005834 Bacteria 3926
117 Ga0068870_10073418 3300005840 Bacteria 1871
118 Ga0068870_10157188 3300005840 Bacteria 1345
119 Ga0068870_10198678 3300005840 Unclassified 1215
120 Ga0068863_100079889 3300005841 Bacteria 3098
121 Ga0068863_100387899 3300005841 Bacteria 1364
122 Ga0068863_100435882 3300005841 Bacteria 1285
123 Ga0068858_100063691 3300005842 Bacteria 3411
124 Ga0068858_100072397 3300005842 Unclassified 3198
125 Ga0068858_100095004 3300005842 Unclassified 2777
126 Ga0068858_100536028 3300005842 Bacteria 1133
127 Ga0068860_100017986 3300005843 Bacteria 6884
128 Ga0068860_100075021 3300005843 Bacteria 3217
129 Ga0068860_100132871 3300005843 Bacteria 2389
130 Ga0068860_100148963 3300005843 Bacteria 2252
131 Ga0068862_100072919 3300005844 Bacteria 2967
132 Ga0068862_100076877 3300005844 Bacteria 2889
133 Ga0068862_100083167 3300005844 Unclassified 2779
134 Ga0068862_100195377 3300005844 Bacteria 1822
135 Ga0068862_100327706 3300005844 Bacteria 1415
136 Ga0068862_100412564 3300005844 Unclassified 1266
137 Ga0081539_10000858 3300005985 Bacteria 58194
138 Ga0097621_100069051 3300006237 Bacteria 2917
139 Ga0068871_100069133 3300006358 Bacteria 2900
140 Ga0068871_100193083 3300006358 Bacteria 1755
141 Ga0075431_100179530 3300006847 Bacteria 2173
142 Ga0075433_10113726 3300006852 Bacteria 2401
143 Ga0075434_100053119 3300006871 Bacteria 4026
144 Ga0075434_100656705 3300006871 Bacteria 1067
145 Ga0075436_100010337 3300006914 Bacteria 6394
146 Ga0097620_100008584 3300006931 Bacteria 10330
147 Ga0097620_100008676 3300006931 Bacteria 10275
148 Ga0097620_100032379 3300006931 Bacteria 5252
149 Ga0097620_100183382 3300006931 Bacteria 2176
150 Ga0097620_100237227 3300006931 Unclassified 1912
151 Ga0097620_100355596 3300006931 Bacteria 1559
152 Ga0097620_100562239 3300006931 Bacteria 1235
153 Ga0097620_101132268 3300006931 Bacteria 861
154 Ga0075435_100031400 3300007076 Bacteria 4184
155 Ga0105240_10082921 3300009093 Bacteria 3936
156 Ga0105240_10163825 3300009093 Bacteria 2639
157 Ga0111539_10681930 3300009094 Bacteria 1196
158 Ga0105247_10005268 3300009101 Bacteria 8162
159 Ga0105247_10037655 3300009101 Bacteria 2951
160 Ga0114129_10039258 3300009147 Bacteria 6675
161 Ga0114129_10284745 3300009147 Bacteria 2207
162 Ga0114129_10669715 3300009147 Bacteria 1337
163 Ga0114129_10755841 3300009147 Bacteria 1244
164 Ga0105243_10587963 3300009148 Bacteria 1070
165 Ga0105241_10073361 3300009174 Unclassified 2662
166 Ga0105241_10203204 3300009174 Bacteria 1656
167 Ga0105248_10003200 3300009177 Bacteria 18152
168 Ga0105248_10046522 3300009177 Bacteria 4863
169 Ga0105248_10112287 3300009177 Unclassified 3074
170 Ga0105248_10259336 3300009177 Bacteria 1957
171 Ga0105248_10784509 3300009177 Bacteria 1075
172 Ga0105237_10001199 3300009545 Bacteria 34703
173 Ga0105237_10048964 3300009545 Bacteria 4248
174 Ga0105238_10030257 3300009551 Bacteria 5510
175 Ga0105249_10003337 3300009553 Bacteria 13900
176 Ga0105249_10004916 3300009553 Bacteria 11532
177 Ga0105249_10109005 3300009553 Bacteria 2615
178 Ga0105239_10400229 3300010375 Bacteria 1554
179 Ga0105246_10753641 3300011119 Unclassified 859
180 Ga0157373_10046999 3300013100 Bacteria 3079
181 Ga0157373_10428911 3300013100 Bacteria 950
182 Ga0157371_10312165 3300013102 Bacteria 1140
183 Ga0157371_10398057 3300013102 Bacteria 1007
184 Ga0157369_10038095 3300013105 Bacteria 5259
185 Ga0157369_10181154 3300013105 Unclassified 2216
186 Ga0157374_10085921 3300013296 Bacteria 2992
187 Ga0157374_10461954 3300013296 Bacteria 1271
188 Ga0157378_10268639 3300013297 Unclassified 1639
189 Ga0157378_10399900 3300013297 Bacteria 1353
190 Ga0163162_10073481 3300013306 Unclassified 3475
191 Ga0157372_10021934 3300013307 Bacteria 6902
192 Ga0157372_10125709 3300013307 Bacteria 2948
193 Ga0157372_10135231 3300013307 Bacteria 2838
194 Ga0157372_10930051 3300013307 Unclassified 1008
195 Ga0157375_10005952 3300013308 Bacteria 10631
196 Ga0157375_10244802 3300013308 Bacteria 1953
197 Ga0157375_10478974 3300013308 Bacteria 1410
198 Ga0163163_10005531 3300014325 Bacteria 10940
199 Ga0163163_10076003 3300014325 Unclassified 3352
200 Ga0163163_10225655 3300014325 Bacteria 1922
201 Ga0163163_10322878 3300014325 Bacteria 1597
202 Ga0163163_10415419 3300014325 Viruses 1404
203 Ga0163163_10474260 3300014325 Bacteria 1312
204 Ga0157380_10005705 3300014326 Bacteria 8711
205 Ga0157380_10039977 3300014326 Unclassified 3650
206 Ga0157380_10248926 3300014326 Bacteria 1607
207 Ga0157380_10430713 3300014326 Bacteria 1261
208 Ga0157377_10031213 3300014745 Bacteria 2894
209 Ga0157379_10104796 3300014968 Bacteria 2538
210 Ga0157379_10441620 3300014968 Bacteria 1200
211 Ga0157376_10663865 3300014969 Bacteria 1044
212 Ga0163161_10008120 3300017792 Bacteria 7259
213 Ga0207653_10000497 3300025885 Bacteria 15280
214 Ga0207710_10007795 3300025900 Unclassified 4534
215 Ga0207688_10102460 3300025901 Bacteria 1654
216 Ga0207647_10059435 3300025904 Bacteria 2339
217 Ga0207643_10000377 3300025908 Bacteria 29969
218 Ga0207643_10075769 3300025908 Unclassified 1942
219 Ga0207643_10120367 3300025908 Bacteria 1554
220 Ga0207643_10159637 3300025908 Unclassified 1356
221 Ga0207684_10000150 3300025910 Bacteria 121849
222 Ga0207684_10009336 3300025910 Bacteria 8667
223 Ga0207684_10109336 3300025910 Bacteria 2366
224 Ga0207707_10000625 3300025912 Bacteria 35059
225 Ga0207707_10051115 3300025912 Unclassified 3599
226 Ga0207707_10163078 3300025912 Bacteria 1948
227 Ga0207671_10001638 3300025914 Bacteria 25473
228 Ga0207671_10325979 3300025914 Unclassified 1216
229 Ga0207660_10110509 3300025917 Unclassified 2068
230 Ga0207660_10533053 3300025917 Unclassified 954
231 Ga0207662_10036468 3300025918 Bacteria 2874
232 Ga0207649_10222414 3300025920 Bacteria 1345
233 Ga0207652_10040591 3300025921 Bacteria 3952
234 Ga0207652_10116121 3300025921 Unclassified 2378
235 Ga0207681_10026902 3300025923 Bacteria 3714
236 Ga0207694_10002701 3300025924 Bacteria 14354
237 Ga0207650_10000011 3300025925 Bacteria 450115
238 Ga0207650_10046523 3300025925 Bacteria 3195
239 Ga0207650_10071765 3300025925 Bacteria 2605
240 Ga0207650_10100662 3300025925 Viruses 2224
241 Ga0207659_10003888 3300025926 Bacteria 9005
242 Ga0207659_10342565 3300025926 Bacteria 1238
243 Ga0207659_10474173 3300025926 Bacteria 1057
244 Ga0207644_10173222 3300025931 Bacteria 1686
245 Ga0207690_10117134 3300025932 Bacteria 1928
246 Ga0207706_10045611 3300025933 Unclassified 3883
247 Ga0207706_10150296 3300025933 Bacteria 2048
248 Ga0207706_10500161 3300025933 Bacteria 1049
249 Ga0207709_10326689 3300025935 Unclassified 1150
250 Ga0207670_10006143 3300025936 Bacteria 6644
251 Ga0207669_10032333 3300025937 Bacteria 2937
252 Ga0207704_10212982 3300025938 Bacteria 1424
253 Ga0207665_10189960 3300025939 Bacteria 1492
254 Ga0207691_10006627 3300025940 Bacteria 11177
255 Ga0207691_10103453 3300025940 Bacteria 2539
256 Ga0207711_10003556 3300025941 Bacteria 13503
257 Ga0207711_10029582 3300025941 Unclassified 4622
258 Ga0207711_10278144 3300025941 Unclassified 1541
259 Ga0207711_10426661 3300025941 Bacteria 1233
260 Ga0207689_10106322 3300025942 Bacteria 2306
261 Ga0207689_10170168 3300025942 Bacteria 1796
262 Ga0207661_10288985 3300025944 Bacteria 1467
263 Ga0207679_10022319 3300025945 Bacteria 4309
264 Ga0207679_10098060 3300025945 Unclassified 2284
265 Ga0207679_10101638 3300025945 Bacteria 2249
266 Ga0207679_10599941 3300025945 Unclassified 992
267 Ga0207651_10086162 3300025960 Bacteria 2282
268 Ga0207651_10260455 3300025960 Bacteria 1424
269 Ga0207651_10343314 3300025960 Bacteria 1255
270 Ga0207712_10006067 3300025961 Bacteria 7626
271 Ga0207712_10012047 3300025961 Bacteria 5522
272 Ga0207668_10167647 3300025972 Bacteria 1719
273 Ga0207640_10024674 3300025981 Unclassified 3631
274 Ga0207640_10345704 3300025981 Bacteria 1193
275 Ga0207658_10055045 3300025986 Bacteria 2946
276 Ga0207658_10139494 3300025986 Bacteria 1960
277 Ga0207703_10054335 3300026035 Unclassified 3257
278 Ga0207703_10058576 3300026035 Bacteria 3144
279 Ga0207703_10372704 3300026035 Bacteria 1319
280 Ga0207639_10016848 3300026041 Bacteria 5177
281 Ga0207639_10088654 3300026041 Bacteria 2470
282 Ga0207639_10161690 3300026041 Unclassified 1887
283 Ga0207678_10384750 3300026067 Bacteria 1213
284 Ga0207708_10469163 3300026075 Bacteria 1051
285 Ga0207641_10017466 3300026088 Bacteria 5873
286 Ga0207641_10124545 3300026088 Bacteria 2305
287 Ga0207641_10475208 3300026088 Bacteria 1211
288 Ga0207641_10839583 3300026088 Unclassified 910
289 Ga0207648_10053427 3300026089 Bacteria 3531
290 Ga0207648_10267443 3300026089 Bacteria 1527
291 Ga0207648_10440434 3300026089 Bacteria 1185
292 Ga0207676_10013027 3300026095 Bacteria 5971
293 Ga0207676_10107441 3300026095 Bacteria 2328
294 Ga0207676_10218902 3300026095 Bacteria 1694
295 Ga0207676_10347569 3300026095 Bacteria 1370
296 Ga0207676_10480436 3300026095 Bacteria 1177
297 Ga0207674_10009976 3300026116 Bacteria 10809
298 Ga0207674_10033627 3300026116 Bacteria 5366
299 Ga0207674_10043732 3300026116 Bacteria 4617
300 Ga0207674_10049806 3300026116 Bacteria 4282
301 Ga0207675_100019722 3300026118 Bacteria 6294
302 Ga0207675_100509532 3300026118 Bacteria 1199
303 Ga0207675_100599660 3300026118 Bacteria 1104
304 Ga0207683_10072026 3300026121 Bacteria 3056
305 Ga0207698_10264313 3300026142 Bacteria 1582
306 Ga0209974_10038770 3300027876 Bacteria 1584
307 Ga0268265_10044903 3300028380 Unclassified 3293
308 Ga0268265_10078846 3300028380 Unclassified 2592
309 Ga0268265_10171323 3300028380 Bacteria 1856
310 Ga0268264_10005565 3300028381 Bacteria 10670
311 Ga0268264_10096078 3300028381 Bacteria 2566
312 Ga0268264_10151442 3300028381 Bacteria 2080
313 Ga0307408_100001894 3300031548 Bacteria 15220
314 Ga0307408_100002285 3300031548 Bacteria 13642
315 Ga0307408_100024981 3300031548 Bacteria 4087
316 Ga0307408_100049414 3300031548 Bacteria 3021
317 Ga0307408_100081149 3300031548 Bacteria 2424
318 Ga0307408_100115561 3300031548 Bacteria 2070
319 Ga0307405_10003589 3300031731 Bacteria 7164
320 Ga0307405_10004966 3300031731 Bacteria 6354
321 Ga0307405_10029466 3300031731 Bacteria 3209
322 Ga0307405_10471331 3300031731 Bacteria 1000
323 Ga0307413_10010799 3300031824 Bacteria 4452
324 Ga0307413_10015535 3300031824 Bacteria 3905
325 Ga0307413_10067785 3300031824 Bacteria 2232
326 Ga0307413_10100630 3300031824 Unclassified 1909
327 Ga0307413_10112873 3300031824 Bacteria 1823
328 Ga0307413_10428973 3300031824 Bacteria 1043
329 Ga0307410_10001431 3300031852 Bacteria 10752
330 Ga0307410_10029408 3300031852 Bacteria 3498
331 Ga0307410_10049695 3300031852 Bacteria 2816
332 Ga0307410_10229277 3300031852 Bacteria 1433
333 Ga0307410_10313558 3300031852 Bacteria 1242
334 Ga0307410_10340066 3300031852 Bacteria 1196
335 Ga0307406_10002074 3300031901 Bacteria 10945
336 Ga0307406_10013319 3300031901 Bacteria 4709
337 Ga0307406_10014207 3300031901 Bacteria 4577
338 Ga0307406_10023897 3300031901 Bacteria 3644
339 Ga0307406_10091394 3300031901 Bacteria 2050
340 Ga0307406_10103387 3300031901 Bacteria 1945
341 Ga0307407_10000336 3300031903 Bacteria 14099
342 Ga0307407_10010551 3300031903 Bacteria 4364
343 Ga0307407_10018690 3300031903 Bacteria 3512
344 Ga0307407_10024165 3300031903 Bacteria 3182
345 Ga0307407_10216208 3300031903 Bacteria 1293
346 Ga0307412_10003443 3300031911 Bacteria 8795
347 Ga0307412_10007354 3300031911 Bacteria 6244
348 Ga0307412_10094142 3300031911 Unclassified 2103
349 Ga0307412_10142714 3300031911 Bacteria 1756
350 Ga0307409_100018995 3300031995 Bacteria 4641
351 Ga0307409_100036128 3300031995 Bacteria 3628
352 Ga0307409_100085935 3300031995 Bacteria 2558
353 Ga0307409_100087822 3300031995 Bacteria 2536
354 Ga0307409_100248880 3300031995 Bacteria 1623
355 Ga0307416_100003933 3300032002 Bacteria 8845
356 Ga0307416_100017135 3300032002 Bacteria 5057
357 Ga0307416_100069849 3300032002 Bacteria 2909
358 Ga0307416_100153369 3300032002 Bacteria 2117
359 Ga0307416_100189129 3300032002 Bacteria 1939
360 Ga0307416_100453120 3300032002 Bacteria 1336
361 Ga0307416_100806915 3300032002 Bacteria 1034
362 Ga0307416_100887661 3300032002 Bacteria 991
363 Ga0307414_10000825 3300032004 Bacteria 15832
364 Ga0307414_10038551 3300032004 Bacteria 3210
365 Ga0307411_10001684 3300032005 Bacteria 9256
366 Ga0307411_10035338 3300032005 Bacteria 3119
367 Ga0307411_10044906 3300032005 Unclassified 2838
368 Ga0307411_10356320 3300032005 Bacteria 1195
369 Ga0307415_100002907 3300032126 Bacteria 8591
370 Ga0307415_100010643 3300032126 Bacteria 5218
371 Ga0307415_100066284 3300032126 Bacteria 2519
372 Ga0307415_100166114 3300032126 Bacteria 1716
373 Ga0373929_0076419 3300035085 Bacteria 809
374 Ga0373940_0064731 3300035088 Bacteria 1053
375 Ga0373951_0002995 3300035091 Bacteria 4187
376 Ga0395900_0202748 3300037418 Bacteria 2006
377 Ga0395900_0213726 3300037418 Bacteria 1947
378 Ga0395898_0246276 3300037466 Bacteria 1704
379 Ga0395898_0316430 3300037466 Bacteria 1489
380 Ga0395901_0179137 3300038443 Bacteria 2223
381 Ga0436365_0803993 3300039437 Bacteria 1475
382 Ga0439466_0069012 3300041411 Bacteria 1128
383 Ga0451837_0235181 3300041494 Bacteria 1648
384 Ga0439432_012436 3300042006 Bacteria 2913
385 Ga0451576_0581759 3300045051 Unclassified 1177
386 Ga0466967_0213046 3300045976 Unclassified 1833
387 Ga0495598_0009559 3300046537 Bacteria 2296
388 Ga0495621_0062482 3300046539 Bacteria 1355
389 Ga0495668_0001077 3300046616 Bacteria 28515
390 Ga0496106_0170832 3300048909 Bacteria 1723
391 Ga0496112_0434694 3300048915 Bacteria 1251
392 Ga0501291_003388 3300049514 Bacteria 1979
393 Ga0501291_023613 3300049514 Unclassified 994
394 Ga0501296_002234 3300049519 Bacteria 2010
395 Ga0501296_009955 3300049519 Unclassified 1121
396 Ga0501299_021059 3300049522 Bacteria 1193
397 Ga0501072_0045558 3300049588 Bacteria 3449
398 Ga0501202_033478 3300049652 Unclassified 1082
399 Ga0501207_006771 3300049654 Bacteria 1619
400 Ga0501216_000244 3300049660 Bacteria 6037
401 Ga0501217_001537 3300049661 Bacteria 4353
402 Ga0501224_002125 3300049664 Bacteria 2683
403 Ga0501227_003744 3300049665 Bacteria 3291
404 Ga0501227_004399 3300049665 Bacteria 3032
405 Ga0501233_009877 3300049668 Bacteria 1870
406 Ga0501233_034766 3300049668 Bacteria 1158
407 Ga0501233_043229 3300049668 Bacteria 1067
408 Ga0501235_021322 3300049669 Bacteria 1440
409 Ga0501242_013775 3300049674 Bacteria 996
410 Ga0501247_004714 3300049677 Bacteria 1501
411 Ga0501251_009471 3300049681 Bacteria 1123
412 Ga0501252_002701 3300049682 Bacteria 1783
413 Ga0501257_020149 3300049686 Bacteria 1564
414 Ga0501259_010675 3300049688 Bacteria 1504
415 Ga0501261_012301 3300049690 Bacteria 1150
416 Ga0501221_023841 3300049704 Bacteria 1223
417 Ga0501225_0001991 3300049705 Bacteria 6384
418 Ga0501225_0004459 3300049705 Bacteria 4170
419 Ga0501225_0006648 3300049705 Bacteria 3371
420 Ga0501234_007171 3300049707 Bacteria 1745
421 Ga0501234_018479 3300049707 Unclassified 1103
422 Ga0501245_008212 3300049708 Bacteria 1485
423 Ga0501241_035374 3300049758 Bacteria 955
424 Ga0501268_010167 3300049765 Bacteria 1460
425 Ga0501268_019945 3300049765 Bacteria 1138
426 Ga0501268_020518 3300049765 Unclassified 1126
427 Ga0501274_001562 3300049771 Bacteria 1756
428 Ga0501279_017300 3300049775 Unclassified 1009
429 Ga0501283_003936 3300049779 Bacteria 1984
430 Ga0501212_016059 3300049851 Unclassified 1121
431 nmdc:mga05p37_236297_c1 3300050507 Bacteria 2199
432 nmdc:mga05p37_411732_c1 3300050507 Bacteria 1576
433 nmdc:mga05p37_764145_c1 3300050507 Bacteria 1063
434 nmdc:mga0rr50_195513_c1 3300050513 Bacteria 1660
435 nmdc:mga08x19_46527_c1 3300050514 Bacteria 2775
436 nmdc:mga0a205_156048_c1 3300050515 Bacteria 2181
437 nmdc:mga0a205_184513_c1 3300050515 Bacteria 1980
438 Ga0500616_0006608 3300053153 Bacteria 7561
439 Ga0307410_10108750
440 CNBas_1000415
441 LJQas_1000054
442 JGI24751J29686_10000012
443 JGI25406J46586_10007212
444 JGI25406J46586_10010473
445 rootH1_10121963
446 rootH2_10103074
447 rootL2_10341072
448 Ga0065714_10064422
449 Ga0065712_10004308
450 Ga0065712_10067728
451 Ga0065715_10007317
452 Ga0065715_10089399
453 Ga0065715_10092248
454 Ga0065715_10115356
455 Ga0065715_10134253
456 Ga0070658_10034679
457 Ga0070683_100076017
458 Ga0070683_100195029
459 Ga0070690_100005576
460 Ga0070690_100323754
461 Ga0070670_100000165
462 Ga0070670_100008199
463 Ga0070670_100027682
464 Ga0070670_100041765
465 Ga0070670_100150448
466 Ga0068869_100089140
467 Ga0070680_100262832
468 Ga0070680_100600274
469 Ga0070689_100015634
470 Ga0070687_100111119
471 Ga0070669_100008592
472 Ga0070675_100009139
473 Ga0070671_100064205
474 Ga0070671_100179583
475 Ga0070671_100270522
476 Ga0070674_100063868
477 Ga0070673_100061494
478 Ga0070673_100166531
479 Ga0070673_100313460
480 Ga0070673_100320749
481 Ga0070688_100057903
482 Ga0070659_100054313
483 Ga0070659_100133722
484 Ga0070667_100025041
485 Ga0070667_100169482
486 Ga0070701_10300529
487 Ga0070705_100047986
488 Ga0070705_100076814
489 Ga0070700_100031420
490 Ga0070700_100084871
491 Ga0070694_100015542
492 Ga0070694_100300580
493 Ga0070694_100334131
494 Ga0070708_100000343
495 Ga0070662_100073097
496 Ga0070662_100123351
497 Ga0070662_100179738
498 Ga0070681_10096457
499 Ga0068867_100051848
500 Ga0070706_100000128
501 Ga0070706_100104088
502 Ga0070707_100021729
503 Ga0070698_100002257
504 Ga0070699_100001091
505 Ga0070699_100001108
506 Ga0070699_100006200
507 Ga0070679_100011688
508 Ga0070679_100013285
509 Ga0070684_100233122
510 Ga0070684_100297636
511 Ga0070697_100011849
512 Ga0070697_100133246
513 Ga0068853_100014162
514 Ga0068853_100121547
515 Ga0068853_100332209
516 Ga0070672_100253765
517 Ga0070686_100337076
518 Ga0070686_100422880
519 Ga0070695_100074870
520 Ga0070695_100090364
521 Ga0070695_100098965
522 Ga0070696_100008161
523 Ga0070696_100174306
524 Ga0070696_100203789
525 Ga0070693_100014841
526 Ga0070693_100079513
527 Ga0070693_100212861
528 Ga0070693_100228180
529 Ga0070704_100117909
530 Ga0070704_100255715
531 Ga0068855_100035262
532 Ga0070664_100036125
533 Ga0068857_100663203
534 Ga0068854_100027463
535 Ga0068854_100185505
536 Ga0068854_100204441
537 Ga0070702_100069532
538 Ga0068852_100076776
539 Ga0068859_100008584
540 Ga0068859_100008676
541 Ga0068859_100032379
542 Ga0068859_100183382
543 Ga0068859_100237223
544 Ga0068859_100355595
545 Ga0068859_100562254
546 Ga0068859_101132606
547 Ga0068864_100007967
548 Ga0068864_100041285
549 Ga0068864_100078734
550 Ga0068864_100109565
551 Ga0068864_100143990
552 Ga0068861_100011172
553 Ga0068861_100522375
554 Ga0068851_10013065
555 Ga0068870_10073418
556 Ga0068870_10157188
557 Ga0068870_10198678
558 Ga0068863_100079889
559 Ga0068863_100387899
560 Ga0068863_100435882
561 Ga0068858_100063691
562 Ga0068858_100072397
563 Ga0068858_100095004
564 Ga0068858_100536028
565 Ga0068860_100017986
566 Ga0068860_100075021
567 Ga0068860_100132871
568 Ga0068860_100148963
569 Ga0068862_100072919
570 Ga0068862_100076877
571 Ga0068862_100083167
572 Ga0068862_100195377
573 Ga0068862_100327706
574 Ga0068862_100412564
575 Ga0081539_10000858
576 Ga0097621_100069051
577 Ga0068871_100069133
578 Ga0068871_100193083
579 Ga0075431_100179530
580 Ga0075433_10113726
581 Ga0075434_100053119
582 Ga0075434_100656705
583 Ga0075436_100010337
584 Ga0097620_100008584
585 Ga0097620_100008676
586 Ga0097620_100032379
587 Ga0097620_100183382
588 Ga0097620_100237227
589 Ga0097620_100355596
590 Ga0097620_100562239
591 Ga0097620_101132268
592 Ga0075435_100031400
593 Ga0105240_10082921
594 Ga0105240_10163825
595 Ga0111539_10681930
596 Ga0105247_10005268
597 Ga0105247_10037655
598 Ga0114129_10039258
599 Ga0114129_10284745
600 Ga0114129_10669715
601 Ga0114129_10755841
602 Ga0105243_10587963
603 Ga0105241_10073361
604 Ga0105241_10203204
605 Ga0105248_10003200
606 Ga0105248_10046522
607 Ga0105248_10112287
608 Ga0105248_10259336
609 Ga0105248_10784509
610 Ga0105237_10001199
611 Ga0105237_10048964
612 Ga0105238_10030257
613 Ga0105249_10003337
614 Ga0105249_10004916
615 Ga0105249_10109005
616 Ga0105239_10400229
617 Ga0105246_10753641
618 Ga0157373_10046999
619 Ga0157373_10428911
620 Ga0157371_10312165
621 Ga0157371_10398057
622 Ga0157369_10038095
623 Ga0157369_10181154
624 Ga0157374_10085921
625 Ga0157374_10461954
626 Ga0157378_10268639
627 Ga0157378_10399900
628 Ga0163162_10073481
629 Ga0157372_10021934
630 Ga0157372_10125709
631 Ga0157372_10135231
632 Ga0157372_10930051
633 Ga0157375_10005952
634 Ga0157375_10244802
635 Ga0157375_10478974
636 Ga0163163_10005531
637 Ga0163163_10076003
638 Ga0163163_10225655
639 Ga0163163_10322878
640 Ga0163163_10415419
641 Ga0163163_10474260
642 Ga0157380_10005705
643 Ga0157380_10039977
644 Ga0157380_10248926
645 Ga0157380_10430713
646 Ga0157377_10031213
647 Ga0157379_10104796
648 Ga0157379_10441620
649 Ga0157376_10663865
650 Ga0163161_10008120
651 Ga0207653_10000497
652 Ga0207710_10007795
653 Ga0207688_10102460
654 Ga0207647_10059435
655 Ga0207643_10000377
656 Ga0207643_10075769
657 Ga0207643_10120367
658 Ga0207643_10159637
659 Ga0207684_10000150
660 Ga0207684_10009336
661 Ga0207684_10109336
662 Ga0207707_10000625
663 Ga0207707_10051115
664 Ga0207707_10163078
665 Ga0207671_10001638
666 Ga0207671_10325979
667 Ga0207660_10110509
668 Ga0207660_10533053
669 Ga0207662_10036468
670 Ga0207649_10222414
671 Ga0207652_10040591
672 Ga0207652_10116121
673 Ga0207681_10026902
674 Ga0207694_10002701
675 Ga0207650_10000011
676 Ga0207650_10046523
677 Ga0207650_10071765
678 Ga0207650_10100662
679 Ga0207659_10003888
680 Ga0207659_10342565
681 Ga0207659_10474173
682 Ga0207644_10173222
683 Ga0207690_10117134
684 Ga0207706_10045611
685 Ga0207706_10150296
686 Ga0207706_10500161
687 Ga0207709_10326689
688 Ga0207670_10006143
689 Ga0207669_10032333
690 Ga0207704_10212982
691 Ga0207665_10189960
692 Ga0207691_10006627
693 Ga0207691_10103453
694 Ga0207711_10003556
695 Ga0207711_10029582
696 Ga0207711_10278144
697 Ga0207711_10426661
698 Ga0207689_10106322
699 Ga0207689_10170168
700 Ga0207661_10288985
701 Ga0207679_10022319
702 Ga0207679_10098060
703 Ga0207679_10101638
704 Ga0207679_10599941
705 Ga0207651_10086162
706 Ga0207651_10260455
707 Ga0207651_10343314
708 Ga0207712_10006067
709 Ga0207712_10012047
710 Ga0207668_10167647
711 Ga0207640_10024674
712 Ga0207640_10345704
713 Ga0207658_10055045
714 Ga0207658_10139494
715 Ga0207703_10054335
716 Ga0207703_10058576
717 Ga0207703_10372704
718 Ga0207639_10016848
719 Ga0207639_10088654
720 Ga0207639_10161690
721 Ga0207678_10384750
722 Ga0207708_10469163
723 Ga0207641_10017466
724 Ga0207641_10124545
725 Ga0207641_10475208
726 Ga0207641_10839583
727 Ga0207648_10053427
728 Ga0207648_10267443
729 Ga0207648_10440434
730 Ga0207676_10013027
731 Ga0207676_10107441
732 Ga0207676_10218902
733 Ga0207676_10347569
734 Ga0207676_10480436
735 Ga0207674_10009976
736 Ga0207674_10033627
737 Ga0207674_10043732
738 Ga0207674_10049806
739 Ga0207675_100019722
740 Ga0207675_100509532
741 Ga0207675_100599660
742 Ga0207683_10072026
743 Ga0207698_10264313
744 Ga0209974_10038770
745 Ga0268265_10044903
746 Ga0268265_10078846
747 Ga0268265_10171323
748 Ga0268264_10005565
749 Ga0268264_10096078
750 Ga0268264_10151442
751 Ga0307408_100001894
752 Ga0307408_100002285
753 Ga0307408_100024981
754 Ga0307408_100049414
755 Ga0307408_100081149
756 Ga0307408_100115561
757 Ga0307405_10003589
758 Ga0307405_10004966
759 Ga0307405_10029466
760 Ga0307405_10471331
761 Ga0307413_10010799
762 Ga0307413_10015535
763 Ga0307413_10067785
764 Ga0307413_10100630
765 Ga0307413_10112873
766 Ga0307413_10428973
767 Ga0307410_10001431
768 Ga0307410_10029408
769 Ga0307410_10049695
770 Ga0307410_10229277
771 Ga0307410_10313558
772 Ga0307410_10340066
773 Ga0307406_10002074
774 Ga0307406_10013319
775 Ga0307406_10014207
776 Ga0307406_10023897
777 Ga0307406_10091394
778 Ga0307406_10103387
779 Ga0307407_10000336
780 Ga0307407_10010551
781 Ga0307407_10018690
782 Ga0307407_10024165
783 Ga0307407_10216208
784 Ga0307412_10003443
785 Ga0307412_10007354
786 Ga0307412_10094142
787 Ga0307412_10142714
788 Ga0307409_100018995
789 Ga0307409_100036128
790 Ga0307409_100085935
791 Ga0307409_100087822
792 Ga0307409_100248880
793 Ga0307416_100003933
794 Ga0307416_100017135
795 Ga0307416_100069849
796 Ga0307416_100153369
797 Ga0307416_100189129
798 Ga0307416_100453120
799 Ga0307416_100806915
800 Ga0307416_100887661
801 Ga0307414_10000825
802 Ga0307414_10038551
803 Ga0307411_10001684
804 Ga0307411_10035338
805 Ga0307411_10044906
806 Ga0307411_10356320
807 Ga0307415_100002907
808 Ga0307415_100010643
809 Ga0307415_100066284
810 Ga0307415_100166114
811 Ga0373929_0076419
812 Ga0373940_0064731
813 Ga0373951_0002995
814 Ga0395900_0202748
815 Ga0395900_0213726
816 Ga0395898_0246276
817 Ga0395898_0316430
818 Ga0395901_0179137
819 Ga0436365_0803993
820 Ga0439466_0069012
821 Ga0451837_0235181
822 Ga0439432_012436
823 Ga0451576_0581759
824 Ga0466967_0213046
825 Ga0495598_0009559
826 Ga0495621_0062482
827 Ga0495668_0001077
828 Ga0496106_0170832
829 Ga0496112_0434694
830 Ga0501291_003388
831 Ga0501291_023613
832 Ga0501296_002234
833 Ga0501296_009955
834 Ga0501299_021059
835 Ga0501072_0045558
836 Ga0501202_033478
837 Ga0501207_006771
838 Ga0501216_000244
839 Ga0501217_001537
840 Ga0501224_002125
841 Ga0501227_003744
842 Ga0501227_004399
843 Ga0501233_009877
844 Ga0501233_034766
845 Ga0501233_043229
846 Ga0501235_021322
847 Ga0501242_013775
848 Ga0501247_004714
849 Ga0501251_009471
850 Ga0501252_002701
851 Ga0501257_020149
852 Ga0501259_010675
853 Ga0501261_012301
854 Ga0501221_023841
855 Ga0501225_0001991
856 Ga0501225_0004459
857 Ga0501225_0006648
858 Ga0501234_007171
859 Ga0501234_018479
860 Ga0501245_008212
861 Ga0501241_035374
862 Ga0501268_010167
863 Ga0501268_019945
864 Ga0501268_020518
865 Ga0501274_001562
866 Ga0501279_017300
867 Ga0501283_003936
868 Ga0501212_016059
869 nmdc:mga05p37_236297_c1
870 nmdc:mga05p37_411732_c1
871 nmdc:mga05p37_764145_c1
872 nmdc:mga0rr50_195513_c1
873 nmdc:mga08x19_46527_c1
874 nmdc:mga0a205_156048_c1
875 nmdc:mga0a205_184513_c1
876 Ga0500616_0006608

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02621

VitK2_biosynth

Menaquinone biosynthesis

30

277

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
7an5-assembly1.cif.gz_A enzyme of biosynthetic pathway 0.9271 1 262
7an7-assembly1.cif.gz_A enzyme of biosynthetic pathway 0.9268 1 262
7ywc-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.9259 1 262
7an9-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.9254 1 262
7an6-assembly1.cif.gz_B enzyme of biosynthetic pathway 0.9248 1 262
ID Description Score Start End Superfamily
2nxoD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.873 1 263 3.40.190.10
2nxoD01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8634 1 263 3.40.190.10
2i6eA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8129 3 248 3.40.190.10
2i6eB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8053 76 169 3.40.190.10
2i6eA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7928 3 248 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2V8QG93-F1-model_v4 Chorismate dehydratase (EC 4.2.1.151) (Menaquinone biosynthetic enzyme MqnA) 0.99 1 263 GO:0009234
GO:0016836
AF-A0A2V8QG93-F1-model_v4 Chorismate dehydratase (EC 4.2.1.151) (Menaquinone biosynthetic enzyme MqnA) 0.9863 1 263 GO:0009234
GO:0016836
AF-A0A7W1DBE6-F1-model_v4 Chorismate dehydratase (EC 4.2.1.151) (Menaquinone biosynthetic enzyme MqnA) 0.9851 1 263 GO:0009234
GO:0016836
AF-A0A7W1DBE6-F1-model_v4 Chorismate dehydratase (EC 4.2.1.151) (Menaquinone biosynthetic enzyme MqnA) 0.9814 1 263 GO:0009234
GO:0016836
AF-A0A7V9TDD6-F1-model_v4 Menaquinone biosynthesis protein 0.9805 3 182 GO:0009234
GO:0016829

Map