F443978

General Info

Members Datasets Scaffolds Average Seq Length
438 211 438 242

Family's Representative Sequence

Representative Sequence 3300011119|Ga0105246_10327210|Ga0105246_103272102
Length 283
Sequence MHWGVFRDHEGTKTRRRTKKTGSYKTFLLCAVFVPLCLRGPVAIMLIYGINPVLEALRAKRATLIRVSPRADERLTQLVRLAAEQGVTVQRVGADELDRLAGGGQRHQGVIGDVAEPGRYSVEDLVIGAKGAPLIVVLDSIEDPHNVGAILRTVDAAGGDGVIRQSRHAARLEGAAAKASAGAVAHVKIAEVVNIARAIEILKDAGVWTVGLDGEAPKRYDEVDLTVPTAVVVGAEGSGLRRLVRERCDWLVSIPMSGHVQSLNVSVATGIALFEAVRQRARK

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
139 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
140 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
143 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
154 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
155 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
156 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
163 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
164 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
165 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
166 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
205 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
206 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.57
Nodule 0
Rhizoplane 2.97
Rhizosphere 92.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10264279 3300005293 Bacteria 1129
2 Ga0070676_10036726 3300005328 Bacteria 2823
3 Ga0070676_10133658 3300005328 Bacteria 1571
4 Ga0070676_10388155 3300005328 Bacteria 968
5 Ga0070683_100026068 3300005329 Bacteria 5258
6 Ga0070690_100101899 3300005330 Bacteria 1904
7 Ga0070670_100046401 3300005331 Bacteria 3736
8 Ga0070670_100052364 3300005331 Bacteria 3506
9 Ga0070670_100053321 3300005331 Bacteria 3473
10 Ga0070670_100077813 3300005331 Bacteria 2849
11 Ga0070670_100354786 3300005331 Bacteria 1289
12 Ga0070677_10000724 3300005333 Bacteria 11010
13 Ga0068869_100140756 3300005334 Bacteria 1863
14 Ga0068869_100210306 3300005334 Bacteria 1537
15 Ga0070666_10351540 3300005335 Bacteria 1055
16 Ga0068868_100016778 3300005338 Bacteria 5445
17 Ga0068868_100082236 3300005338 Bacteria 2583
18 Ga0070689_100015901 3300005340 Bacteria 5498
19 Ga0070689_100080187 3300005340 Bacteria 2561
20 Ga0070691_10008413 3300005341 Bacteria 4724
21 Ga0070661_100035193 3300005344 Bacteria 3636
22 Ga0070692_10007847 3300005345 Bacteria 4730
23 Ga0070692_10069355 3300005345 Bacteria 1875
24 Ga0070668_100066450 3300005347 Bacteria 2798
25 Ga0070668_100495784 3300005347 Bacteria 1056
26 Ga0070669_100015657 3300005353 Bacteria 5407
27 Ga0070669_100041795 3300005353 Bacteria 3335
28 Ga0070669_100151516 3300005353 Bacteria 1795
29 Ga0070669_100159089 3300005353 Bacteria 1754
30 Ga0070669_100174388 3300005353 Bacteria 1678
31 Ga0070669_100258201 3300005353 Bacteria 1389
32 Ga0070669_100545776 3300005353 Bacteria 966
33 Ga0070675_100003283 3300005354 Bacteria 12267
34 Ga0070675_100027150 3300005354 Bacteria 4598
35 Ga0070675_100043915 3300005354 Bacteria 3655
36 Ga0070675_100051659 3300005354 Bacteria 3378
37 Ga0070675_100186791 3300005354 Bacteria 1794
38 Ga0070675_100365726 3300005354 Bacteria 1281
39 Ga0070671_100155245 3300005355 Bacteria 1933
40 Ga0070671_100237375 3300005355 Bacteria 1547
41 Ga0070671_100295195 3300005355 Bacteria 1380
42 Ga0070674_100006739 3300005356 Bacteria 6724
43 Ga0070674_100177722 3300005356 Bacteria 1627
44 Ga0070673_100030702 3300005364 Bacteria 4026
45 Ga0070673_100115048 3300005364 Bacteria 2236
46 Ga0070673_100137037 3300005364 Bacteria 2061
47 Ga0070673_100241575 3300005364 Bacteria 1571
48 Ga0070688_100024830 3300005365 Bacteria 3541
49 Ga0070688_100041386 3300005365 Bacteria 2828
50 Ga0070688_100080981 3300005365 Bacteria 2101
51 Ga0070659_100024194 3300005366 Bacteria 4654
52 Ga0070667_100019041 3300005367 Bacteria 5691
53 Ga0070667_100366005 3300005367 Bacteria 1307
54 Ga0070703_10015164 3300005406 Bacteria 2204
55 Ga0070709_10071755 3300005434 Bacteria 2236
56 Ga0070709_10231720 3300005434 Bacteria 1322
57 Ga0070701_10032093 3300005438 Bacteria 2612
58 Ga0070701_10129066 3300005438 Bacteria 1434
59 Ga0070705_100080201 3300005440 Bacteria 2001
60 Ga0070705_100186550 3300005440 Bacteria 1409
61 Ga0070705_100295333 3300005440 Bacteria 1158
62 Ga0070700_100015383 3300005441 Bacteria 4336
63 Ga0070700_100090614 3300005441 Bacteria 1994
64 Ga0070700_100308715 3300005441 Bacteria 1158
65 Ga0070694_100075458 3300005444 Bacteria 2332
66 Ga0070694_100126748 3300005444 Bacteria 1839
67 Ga0070663_100204277 3300005455 Bacteria 1543
68 Ga0070663_100441920 3300005455 Bacteria 1070
69 Ga0070678_100012255 3300005456 Bacteria 5321
70 Ga0070678_100012849 3300005456 Bacteria 5223
71 Ga0070678_100204102 3300005456 Bacteria 1633
72 Ga0070678_100350358 3300005456 Bacteria 1269
73 Ga0070678_100381478 3300005456 Bacteria 1220
74 Ga0070662_100325334 3300005457 Bacteria 1254
75 Ga0068867_100088337 3300005459 Bacteria 2348
76 Ga0068867_100429028 3300005459 Bacteria 1121
77 Ga0068867_100572183 3300005459 Bacteria 981
78 Ga0068867_100764425 3300005459 Unclassified 858
79 Ga0070685_10038803 3300005466 Bacteria 2702
80 Ga0070685_10074950 3300005466 Bacteria 2014
81 Ga0070699_100603967 3300005518 Bacteria 1000
82 Ga0070684_100057732 3300005535 Bacteria 3390
83 Ga0070672_100038211 3300005543 Bacteria 3666
84 Ga0070672_100095086 3300005543 Bacteria 2409
85 Ga0070672_100146903 3300005543 Bacteria 1948
86 Ga0070686_100006918 3300005544 Bacteria 6321
87 Ga0070686_100111506 3300005544 Bacteria 1864
88 Ga0070686_100465945 3300005544 Bacteria 974
89 Ga0070686_100638039 3300005544 Bacteria 843
90 Ga0070695_100004225 3300005545 Bacteria 8406
91 Ga0070695_100369138 3300005545 Bacteria 1080
92 Ga0070696_100015646 3300005546 Bacteria 5097
93 Ga0070696_100455174 3300005546 Bacteria 1011
94 Ga0070665_100001142 3300005548 Bacteria 32621
95 Ga0070665_100026504 3300005548 Bacteria 5836
96 Ga0070665_100076467 3300005548 Bacteria 3354
97 Ga0070665_100137053 3300005548 Bacteria 2451
98 Ga0070665_100635185 3300005548 Bacteria 1081
99 Ga0070704_100084689 3300005549 Bacteria 2344
100 Ga0070704_100206586 3300005549 Bacteria 1589
101 Ga0070704_100244836 3300005549 Bacteria 1469
102 Ga0070664_100007119 3300005564 Bacteria 9024
103 Ga0070664_100036082 3300005564 Bacteria 4152
104 Ga0070664_100372235 3300005564 Bacteria 1302
105 Ga0068857_100172762 3300005577 Bacteria 1965
106 Ga0068854_100272055 3300005578 Bacteria 1361
107 Ga0070702_100043927 3300005615 Bacteria 2520
108 Ga0068859_100012466 3300005617 Bacteria 8552
109 Ga0068859_100042478 3300005617 Bacteria 4566
110 Ga0068859_100047196 3300005617 Bacteria 4327
111 Ga0068859_100158681 3300005617 Bacteria 2340
112 Ga0068859_100691969 3300005617 Bacteria 1110
113 Ga0068864_100029638 3300005618 Bacteria 4637
114 Ga0068864_100222070 3300005618 Bacteria 1744
115 Ga0068864_100347623 3300005618 Bacteria 1398
116 Ga0068864_100500913 3300005618 Bacteria 1168
117 Ga0068866_10039190 3300005718 Bacteria 2338
118 Ga0068861_100018055 3300005719 Bacteria 5017
119 Ga0068861_100036602 3300005719 Bacteria 3644
120 Ga0068861_100080678 3300005719 Bacteria 2545
121 Ga0068861_100187173 3300005719 Bacteria 1727
122 Ga0068861_100946794 3300005719 Unclassified 819
123 Ga0068851_10234857 3300005834 Bacteria 1035
124 Ga0068870_10011884 3300005840 Bacteria 4052
125 Ga0068863_100011731 3300005841 Bacteria 8475
126 Ga0068863_100213704 3300005841 Bacteria 1857
127 Ga0068858_100019034 3300005842 Bacteria 6424
128 Ga0068858_100371789 3300005842 Bacteria 1371
129 Ga0068860_100029032 3300005843 Bacteria 5321
130 Ga0068862_100044776 3300005844 Bacteria 3775
131 Ga0068862_100065201 3300005844 Bacteria 3137
132 Ga0068862_100097934 3300005844 Bacteria 2561
133 Ga0068862_100141796 3300005844 Bacteria 2133
134 Ga0068862_100395702 3300005844 Bacteria 1291
135 Ga0068862_100501054 3300005844 Bacteria 1153
136 Ga0081455_10014307 3300005937 Bacteria 7785
137 Ga0081539_10002852 3300005985 Bacteria 23001
138 Ga0081539_10080785 3300005985 Bacteria 1709
139 Ga0075368_10022653 3300006042 Bacteria 2393
140 Ga0075364_10238732 3300006051 Bacteria 1234
141 Ga0075367_10018953 3300006178 Bacteria 3806
142 Ga0075367_10141571 3300006178 Bacteria 1490
143 Ga0075367_10149448 3300006178 Bacteria 1449
144 Ga0075366_10025811 3300006195 Bacteria 3436
145 Ga0075366_10086929 3300006195 Bacteria 1870
146 Ga0075366_10090629 3300006195 Bacteria 1831
147 Ga0097621_100075897 3300006237 Bacteria 2787
148 Ga0097621_100285958 3300006237 Bacteria 1452
149 Ga0097621_100894709 3300006237 Bacteria 827
150 Ga0075370_10009608 3300006353 Bacteria 5031
151 Ga0075370_10062774 3300006353 Bacteria 2117
152 Ga0075370_10268971 3300006353 Bacteria 1012
153 Ga0068871_100037108 3300006358 Bacteria 3885
154 Ga0068871_100243384 3300006358 Bacteria 1565
155 Ga0068871_100556285 3300006358 Bacteria 1040
156 Ga0075428_100003764 3300006844 Bacteria 16622
157 Ga0075428_100136870 3300006844 Bacteria 2663
158 Ga0075430_100121582 3300006846 Unclassified 2177
159 Ga0075430_100164319 3300006846 Bacteria 1847
160 Ga0075433_10034459 3300006852 Bacteria 4348
161 Ga0075433_10134620 3300006852 Bacteria 2196
162 Ga0075434_100007413 3300006871 Bacteria 10154
163 Ga0075434_100150384 3300006871 Bacteria 2348
164 Ga0075434_100230953 3300006871 Bacteria 1869
165 Ga0075429_100018556 3300006880 Bacteria 6024
166 Ga0075429_100126990 3300006880 Bacteria 2230
167 Ga0075429_100466364 3300006880 Bacteria 1106
168 Ga0068865_100102691 3300006881 Bacteria 2095
169 Ga0068865_100258855 3300006881 Bacteria 1377
170 Ga0097620_100012466 3300006931 Bacteria 8552
171 Ga0097620_100042479 3300006931 Bacteria 4566
172 Ga0097620_100047197 3300006931 Bacteria 4327
173 Ga0097620_100158668 3300006931 Bacteria 2340
174 Ga0097620_100692017 3300006931 Bacteria 1110
175 Ga0075435_100409833 3300007076 Bacteria 1166
176 Ga0105240_10016812 3300009093 Bacteria 9892
177 Ga0111539_10001096 3300009094 Bacteria 35773
178 Ga0111539_10001535 3300009094 Bacteria 30735
179 Ga0111539_10184558 3300009094 Bacteria 2436
180 Ga0111539_10201326 3300009094 Bacteria 2322
181 Ga0111539_10258421 3300009094 Bacteria 2028
182 Ga0111539_10533904 3300009094 Bacteria 1367
183 Ga0105247_10434064 3300009101 Bacteria 943
184 Ga0114129_10009415 3300009147 Bacteria 13923
185 Ga0114129_10040307 3300009147 Bacteria 6584
186 Ga0114129_11047009 3300009147 Bacteria 1025
187 Ga0105243_10094927 3300009148 Bacteria 2464
188 Ga0105243_10130674 3300009148 Bacteria 2130
189 Ga0105242_10008251 3300009176 Bacteria 8001
190 Ga0105248_10004266 3300009177 Bacteria 15819
191 Ga0105248_10082033 3300009177 Bacteria 3625
192 Ga0105248_10158323 3300009177 Bacteria 2555
193 Ga0105248_10160133 3300009177 Bacteria 2539
194 Ga0105248_10460875 3300009177 Bacteria 1433
195 Ga0105248_10659361 3300009177 Bacteria 1181
196 Ga0105248_10717490 3300009177 Bacteria 1128
197 Ga0105237_10518114 3300009545 Bacteria 1199
198 Ga0105249_10043419 3300009553 Bacteria 4088
199 Ga0105249_10707121 3300009553 Bacteria 1068
200 Ga0105246_10045757 3300011119 Bacteria 2982
201 Ga0105246_10327210 3300011119 Bacteria 1248
202 Ga0157371_10196800 3300013102 Bacteria 1444
203 Ga0157374_10010815 3300013296 Bacteria 7872
204 Ga0163162_10021664 3300013306 Bacteria 6331
205 Ga0163162_10437943 3300013306 Bacteria 1439
206 Ga0163162_10791580 3300013306 Bacteria 1066
207 Ga0163162_11235379 3300013306 Bacteria 848
208 Ga0157375_10045559 3300013308 Bacteria 4269
209 Ga0163163_10085080 3300014325 Bacteria 3170
210 Ga0163163_10286888 3300014325 Bacteria 1698
211 Ga0157380_10028433 3300014326 Bacteria 4262
212 Ga0157380_10171052 3300014326 Bacteria 1899
213 Ga0157377_10026667 3300014745 Bacteria 3095
214 Ga0157377_10192358 3300014745 Bacteria 1290
215 Ga0157379_10009065 3300014968 Bacteria 8670
216 Ga0157379_10014131 3300014968 Bacteria 6999
217 Ga0157379_10028505 3300014968 Bacteria 4966
218 Ga0157376_10050167 3300014969 Bacteria 3461
219 Ga0157376_10191256 3300014969 Bacteria 1877
220 Ga0157376_10278382 3300014969 Bacteria 1575
221 Ga0157376_10301247 3300014969 Bacteria 1517
222 Ga0157376_10691512 3300014969 Viruses 1024
223 Ga0207697_10007397 3300025315 Bacteria 4902
224 Ga0207697_10018418 3300025315 Bacteria 2864
225 Ga0207656_10166197 3300025321 Bacteria 1052
226 Ga0207653_10146099 3300025885 Bacteria 868
227 Ga0207682_10001234 3300025893 Bacteria 11834
228 Ga0207682_10030165 3300025893 Bacteria 2171
229 Ga0207642_10046775 3300025899 Bacteria 1930
230 Ga0207688_10001167 3300025901 Bacteria 13553
231 Ga0207680_10027843 3300025903 Bacteria 3154
232 Ga0207680_10307505 3300025903 Bacteria 1106
233 Ga0207699_10281015 3300025906 Bacteria 1157
234 Ga0207643_10006910 3300025908 Bacteria 6085
235 Ga0207695_10205413 3300025913 Bacteria 1883
236 Ga0207662_10012243 3300025918 Bacteria 4774
237 Ga0207662_10052248 3300025918 Bacteria 2432
238 Ga0207646_10636106 3300025922 Unclassified 956
239 Ga0207681_10021200 3300025923 Bacteria 4127
240 Ga0207681_10057757 3300025923 Bacteria 2653
241 Ga0207681_10085188 3300025923 Bacteria 2242
242 Ga0207681_10135172 3300025923 Bacteria 1829
243 Ga0207650_10087983 3300025925 Bacteria 2368
244 Ga0207650_10163157 3300025925 Bacteria 1767
245 Ga0207650_10527390 3300025925 Bacteria 988
246 Ga0207659_10002281 3300025926 Bacteria 11427
247 Ga0207659_10135577 3300025926 Bacteria 1905
248 Ga0207659_10159004 3300025926 Bacteria 1772
249 Ga0207659_10294415 3300025926 Bacteria 1331
250 Ga0207659_10300647 3300025926 Bacteria 1318
251 Ga0207659_10444124 3300025926 Bacteria 1091
252 Ga0207644_10048998 3300025931 Bacteria 3023
253 Ga0207644_10096619 3300025931 Bacteria 2212
254 Ga0207644_10113636 3300025931 Bacteria 2051
255 Ga0207690_10092618 3300025932 Bacteria 2139
256 Ga0207706_10024159 3300025933 Bacteria 5451
257 Ga0207706_10191123 3300025933 Bacteria 1797
258 Ga0207706_10226908 3300025933 Bacteria 1635
259 Ga0207686_10029493 3300025934 Bacteria 3236
260 Ga0207670_10009444 3300025936 Bacteria 5566
261 Ga0207670_10017414 3300025936 Bacteria 4344
262 Ga0207670_10145764 3300025936 Bacteria 1751
263 Ga0207669_10307308 3300025937 Bacteria 1208
264 Ga0207669_10367500 3300025937 Bacteria 1117
265 Ga0207704_10166144 3300025938 Bacteria 1576
266 Ga0207691_10022950 3300025940 Bacteria 5878
267 Ga0207691_10032573 3300025940 Bacteria 4859
268 Ga0207711_10041300 3300025941 Bacteria 3927
269 Ga0207711_10115936 3300025941 Bacteria 2387
270 Ga0207711_10222806 3300025941 Bacteria 1725
271 Ga0207711_10320369 3300025941 Bacteria 1433
272 Ga0207711_10427295 3300025941 Bacteria 1232
273 Ga0207689_10027509 3300025942 Bacteria 4759
274 Ga0207689_10101829 3300025942 Bacteria 2359
275 Ga0207661_10204596 3300025944 Unclassified 1737
276 Ga0207661_10401346 3300025944 Bacteria 1243
277 Ga0207679_10023425 3300025945 Bacteria 4222
278 Ga0207679_10216174 3300025945 Bacteria 1610
279 Ga0207679_10327449 3300025945 Bacteria 1328
280 Ga0207651_10036017 3300025960 Bacteria 3225
281 Ga0207651_10093393 3300025960 Bacteria 2209
282 Ga0207651_10144255 3300025960 Bacteria 1844
283 Ga0207651_10156417 3300025960 Bacteria 1781
284 Ga0207712_10009191 3300025961 Bacteria 6260
285 Ga0207712_10961248 3300025961 Bacteria 757
286 Ga0207668_10054711 3300025972 Bacteria 2771
287 Ga0207668_10258195 3300025972 Bacteria 1418
288 Ga0207668_10396516 3300025972 Bacteria 1166
289 Ga0207668_10414357 3300025972 Bacteria 1142
290 Ga0207640_10012425 3300025981 Bacteria 4848
291 Ga0207677_10206460 3300026023 Bacteria 1565
292 Ga0207703_10047520 3300026035 Bacteria 3461
293 Ga0207703_10121410 3300026035 Bacteria 2243
294 Ga0207703_10140785 3300026035 Bacteria 2093
295 Ga0207678_10076452 3300026067 Bacteria 2868
296 Ga0207678_10115973 3300026067 Bacteria 2285
297 Ga0207708_10006630 3300026075 Bacteria 8570
298 Ga0207708_10012748 3300026075 Bacteria 6269
299 Ga0207708_10034704 3300026075 Bacteria 3837
300 Ga0207708_10272951 3300026075 Bacteria 1368
301 Ga0207641_10006672 3300026088 Bacteria 9690
302 Ga0207648_10025719 3300026089 Bacteria 5239
303 Ga0207648_10084636 3300026089 Bacteria 2766
304 Ga0207648_10222235 3300026089 Bacteria 1679
305 Ga0207648_10630557 3300026089 Bacteria 990
306 Ga0207676_10025728 3300026095 Bacteria 4369
307 Ga0207674_10400617 3300026116 Bacteria 1326
308 Ga0207674_10588916 3300026116 Bacteria 1074
309 Ga0207675_100006610 3300026118 Bacteria 10968
310 Ga0207675_100023521 3300026118 Bacteria 5732
311 Ga0207675_100040133 3300026118 Bacteria 4369
312 Ga0207675_100063632 3300026118 Bacteria 3447
313 Ga0207675_100149248 3300026118 Bacteria 2224
314 Ga0207683_10004333 3300026121 Bacteria 12256
315 Ga0207683_10044756 3300026121 Bacteria 3869
316 Ga0207683_10320247 3300026121 Bacteria 1420
317 Ga0207683_10413593 3300026121 Bacteria 1241
318 Ga0207683_10687104 3300026121 Bacteria 949
319 Ga0207428_10026924 3300027907 Bacteria 4791
320 Ga0268266_10053316 3300028379 Bacteria 3474
321 Ga0268266_10069684 3300028379 Bacteria 3047
322 Ga0268266_10135374 3300028379 Bacteria 2206
323 Ga0268266_10635325 3300028379 Bacteria 1027
324 Ga0268265_10016572 3300028380 Bacteria 5066
325 Ga0268265_10031008 3300028380 Bacteria 3857
326 Ga0268265_10460344 3300028380 Bacteria 1190
327 Ga0268265_11045409 3300028380 Bacteria 808
328 Ga0268264_10108208 3300028381 Bacteria 2430
329 Ga0268264_10503821 3300028381 Bacteria 1181
330 Ga0307408_100219112 3300031548 Bacteria 1552
331 Ga0316575_10011582 3300031665 Bacteria 3266
332 Ga0316575_10048531 3300031665 Bacteria 1688
333 Ga0316576_10031857 3300031727 Bacteria 3744
334 Ga0316578_10026608 3300031728 Bacteria 3264
335 Ga0307405_10015947 3300031731 Bacteria 4084
336 Ga0307405_10064207 3300031731 Bacteria 2332
337 Ga0307405_10416339 3300031731 Bacteria 1056
338 Ga0316577_10052104 3300031733 Bacteria 2283
339 Ga0307413_10028722 3300031824 Bacteria 3102
340 Ga0307413_10108135 3300031824 Bacteria 1855
341 Ga0307406_10115173 3300031901 Bacteria 1858
342 Ga0307407_10026230 3300031903 Bacteria 3082
343 Ga0307407_10078197 3300031903 Bacteria 1992
344 Ga0307412_10002885 3300031911 Bacteria 9530
345 Ga0307409_100121712 3300031995 Bacteria 2211
346 Ga0307416_100020984 3300032002 Bacteria 4677
347 Ga0307416_100111549 3300032002 Bacteria 2411
348 Ga0307416_100498488 3300032002 Bacteria 1281
349 Ga0307416_100582186 3300032002 Bacteria 1197
350 Ga0307414_10025579 3300032004 Bacteria 3784
351 Ga0307414_10125481 3300032004 Bacteria 1982
352 Ga0307414_10155153 3300032004 Bacteria 1811
353 Ga0307411_10030021 3300032005 Bacteria 3328
354 Ga0307415_100034607 3300032126 Bacteria 3291
355 Ga0307415_100047238 3300032126 Bacteria 2897
356 Ga0373959_0017732 3300034820 Unclassified 1332
357 Ga0373940_0020938 3300035088 Bacteria 1666
358 Ga0373949_0034932 3300035090 Bacteria 1214
359 Ga0373939_0010798 3300035114 Bacteria 2294
360 Ga0373941_0043195 3300035115 Bacteria 1402
361 Ga0373957_0066814 3300035120 Bacteria 1401
362 Ga0373961_0024686 3300035241 Bacteria 1628
363 Ga0373937_0057658 3300036401 Bacteria 3568
364 Ga0373937_0428480 3300036401 Bacteria 1256
365 Ga0316582_0037610 3300036647 Bacteria 3002
366 Ga0373925_0226793 3300037068 Bacteria 1493
367 Ga0316581_0029099 3300037588 Bacteria 1658
368 Ga0439433_0027157 3300041999 Bacteria 1297
369 Ga0450908_007116 3300042184 Bacteria 2113
370 Ga0439435_0026386 3300042436 Bacteria 1546
371 Ga0451577_0091303 3300042876 Bacteria 2718
372 Ga0453684_0025507 3300044712 Bacteria 8578
373 Ga0451576_0402846 3300045051 Bacteria 1434
374 Ga0451576_0867050 3300045051 Bacteria 948
375 Ga0495638_0180403 3300046460 Unclassified 1205
376 Ga0495584_0250787 3300046491 Unclassified 900
377 Ga0495643_0002653 3300046522 Bacteria 13864
378 Ga0495640_0108676 3300046533 Bacteria 1814
379 Ga0495635_0142227 3300046663 Bacteria 1634
380 Ga0495657_0409457 3300046675 Bacteria 797
381 Ga0495658_0094757 3300046683 Bacteria 1773
382 Ga0495658_0179787 3300046683 Bacteria 1312
383 Ga0496102_0278428 3300048905 Bacteria 1577
384 Ga0496104_0036452 3300048907 Bacteria 4599
385 Ga0496106_0116881 3300048909 Bacteria 2081
386 Ga0496108_0022693 3300048911 Bacteria 5162
387 Ga0496108_0216281 3300048911 Bacteria 1664
388 Ga0496109_0044133 3300048912 Bacteria 4044
389 Ga0496109_0070043 3300048912 Bacteria 3218
390 Ga0496109_0111993 3300048912 Bacteria 2538
391 Ga0496109_0130868 3300048912 Bacteria 2342
392 Ga0496111_0287220 3300048914 Bacteria 1220
393 Ga0496112_0061243 3300048915 Bacteria 3709
394 Ga0496112_0683854 3300048915 Bacteria 954
395 Ga0496113_0141920 3300048916 Bacteria 1890
396 Ga0501031_0364075 3300049568 Bacteria 936
397 Ga0501041_0381361 3300049577 Bacteria 892
398 Ga0501048_0235146 3300049582 Bacteria 1300
399 Ga0501075_0220788 3300049591 Bacteria 1446
400 Ga0501076_0166954 3300049592 Bacteria 1794
401 Ga0501076_0278261 3300049592 Bacteria 1371
402 Ga0501079_0070473 3300049741 Bacteria 2700
403 Ga0501080_0391025 3300049742 Bacteria 1252
404 Ga0501081_0103665 3300049743 Bacteria 2013
405 Ga0501081_0397467 3300049743 Bacteria 1020
406 Ga0501045_0319168 3300049824 Bacteria 1156
407 nmdc:mga00v17_373063_c1 3300050491 Unclassified 928
408 nmdc:mga0k408_2125_c1 3300050493 Bacteria 10615
409 nmdc:mga0k408_53648_c1 3300050493 Bacteria 2337
410 nmdc:mga06z11_115872_c1 3300050494 Bacteria 1489
411 nmdc:mga07m45_105394_c1 3300050496 Bacteria 1622
412 nmdc:mga07m45_12359_c1 3300050496 Bacteria 4511
413 nmdc:mga05p37_15056_c1 3300050507 Bacteria 9285
414 nmdc:mga05p37_29304_c1 3300050507 Bacteria 6717
415 nmdc:mga09592_17140_c1 3300050508 Bacteria 5931
416 nmdc:mga09592_41685_c1 3300050508 Bacteria 3860
417 nmdc:mga09592_97349_c1 3300050508 Bacteria 2518
418 nmdc:mga0qj67_114704_c1 3300050509 Unclassified 2176
419 nmdc:mga0qj67_35002_c1 3300050509 Bacteria 3925
420 nmdc:mga06r32_172887_c1 3300050510 Bacteria 2144
421 nmdc:mga08y16_173502_c1 3300050511 Bacteria 2239
422 nmdc:mga08y16_19434_c1 3300050511 Bacteria 7162
423 nmdc:mga08y16_238911_c1 3300050511 Bacteria 1878
424 nmdc:mga08y16_313160_c1 3300050511 Bacteria 1616
425 nmdc:mga08y16_34498_c1 3300050511 Bacteria 5315
426 nmdc:mga0n895_27407_c1 3300050512 Bacteria 5413
427 nmdc:mga0n895_6124_c1 3300050512 Bacteria 10159
428 nmdc:mga0rr50_38351_c1 3300050513 Bacteria 3466
429 nmdc:mga0a205_21028_c1 3300050515 Bacteria 6168
430 nmdc:mga0a205_3001_c1 3300050515 Bacteria 14958
431 Ga0495601_0398705 3300053077 Bacteria 892
432 Ga0500555_000968 3300053103 Bacteria 9937
433 Ga0500616_0000357 3300053153 Bacteria 64980
434 Ga0500645_001011 3300053730 Bacteria 15815
435 Ga0501084_0381373 3300054114 Bacteria 1191
436 Ga0590075_028962 3300059424 Bacteria 1399
437 Ga0501082_0653525 3300060353 Bacteria 920
438 Ga0501082_0839604 3300060353 Unclassified 804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025893 Ga0207682_10030165 Ga0207682_100301652 187
2 3300048915 Ga0496112_0683854 Ga0496112_0683854_14_661 188
3 3300005985 Ga0081539_10080785 Ga0081539_100807854 219
4 3300005548 Ga0070665_100026504 Ga0070665_1000265042 220
5 3300005544 Ga0070686_100638039 Ga0070686_1006380391 221
6 3300026116 Ga0207674_10588916 Ga0207674_105889162 221
7 3300048905 Ga0496102_0278428 Ga0496102_0278428_236_994 221
8 3300048912 Ga0496109_0070043 Ga0496109_0070043_228_986 221
9 3300005331 Ga0070670_100046401 Ga0070670_1000464013 223
10 3300005353 Ga0070669_100159089 Ga0070669_1001590891 223
11 3300005354 Ga0070675_100027150 Ga0070675_1000271506 223
12 3300005364 Ga0070673_100241575 Ga0070673_1002415754 223
13 3300005456 Ga0070678_100012849 Ga0070678_1000128496 223
14 3300005459 Ga0068867_100764425 Ga0068867_1007644251 223
15 3300005564 Ga0070664_100372235 Ga0070664_1003722352 223
16 3300005844 Ga0068862_100065201 Ga0068862_1000652013 223
17 3300025923 Ga0207681_10135172 Ga0207681_101351722 223
18 3300025931 Ga0207644_10113636 Ga0207644_101136362 223
19 3300025936 Ga0207670_10145764 Ga0207670_101457641 223
20 3300025945 Ga0207679_10327449 Ga0207679_103274492 223
21 3300026089 Ga0207648_10222235 Ga0207648_102222354 223
22 3300005329 Ga0070683_100026068 Ga0070683_1000260685 224
23 3300005331 Ga0070670_100077813 Ga0070670_1000778135 224
24 3300005345 Ga0070692_10007847 Ga0070692_100078474 224
25 3300005354 Ga0070675_100186791 Ga0070675_1001867912 224
26 3300005355 Ga0070671_100295195 Ga0070671_1002951951 224
27 3300005364 Ga0070673_100115048 Ga0070673_1001150481 224
28 3300005444 Ga0070694_100126748 Ga0070694_1001267482 224
29 3300005456 Ga0070678_100204102 Ga0070678_1002041023 224
30 3300005535 Ga0070684_100057732 Ga0070684_1000577323 224
31 3300005543 Ga0070672_100095086 Ga0070672_1000950862 224
32 3300005549 Ga0070704_100084689 Ga0070704_1000846892 224
33 3300005719 Ga0068861_100946794 Ga0068861_1009467941 224
34 3300005834 Ga0068851_10234857 Ga0068851_102348571 224
35 3300006042 Ga0075368_10022653 Ga0075368_100226532 224
36 3300006178 Ga0075367_10018953 Ga0075367_100189532 224
37 3300006195 Ga0075366_10086929 Ga0075366_100869292 224
38 3300025315 Ga0207697_10018418 Ga0207697_100184185 224
39 3300025321 Ga0207656_10166197 Ga0207656_101661971 224
40 3300025925 Ga0207650_10163157 Ga0207650_101631571 224
41 3300025926 Ga0207659_10159004 Ga0207659_101590041 224
42 3300025931 Ga0207644_10096619 Ga0207644_100966192 224
43 3300025944 Ga0207661_10401346 Ga0207661_104013462 224
44 3300025960 Ga0207651_10144255 Ga0207651_101442552 224
45 3300026121 Ga0207683_10044756 Ga0207683_100447563 224
46 3300031665 Ga0316575_10048531 Ga0316575_100485312 224
47 3300031728 Ga0316578_10026608 Ga0316578_100266086 224
48 3300048912 Ga0496109_0044133 Ga0496109_0044133_2833_3600 224
49 3300049592 Ga0501076_0278261 Ga0501076_0278261_143_847 225
50 3300036401 Ga0373937_0428480 Ga0373937_0428480_162_878 226
51 3300049592 Ga0501076_0166954 Ga0501076_0166954_308_1048 226
52 3300049741 Ga0501079_0070473 Ga0501079_0070473_1102_1842 226
53 3300028381 Ga0268264_10108208 Ga0268264_101082083 227
54 3300031733 Ga0316577_10052104 Ga0316577_100521042 227
55 3300036647 Ga0316582_0037610 Ga0316582_0037610_563_1318 227
56 3300037588 Ga0316581_0029099 Ga0316581_0029099_551_1306 227
57 3300049568 Ga0501031_0364075 Ga0501031_0364075_113_826 227
58 3300049591 Ga0501075_0220788 Ga0501075_0220788_21_734 227
59 3300049824 Ga0501045_0319168 Ga0501045_0319168_270_983 227
60 3300060353 Ga0501082_0653525 Ga0501082_0653525_150_863 227
61 3300005328 Ga0070676_10388155 Ga0070676_103881552 228
62 3300005331 Ga0070670_100052364 Ga0070670_1000523646 228
63 3300005331 Ga0070670_100354786 Ga0070670_1003547863 228
64 3300005341 Ga0070691_10008413 Ga0070691_100084138 228
65 3300005345 Ga0070692_10069355 Ga0070692_100693555 228
66 3300005347 Ga0070668_100495784 Ga0070668_1004957842 228
67 3300005353 Ga0070669_100041795 Ga0070669_1000417952 228
68 3300005353 Ga0070669_100151516 Ga0070669_1001515161 228
69 3300005353 Ga0070669_100545776 Ga0070669_1005457761 228
70 3300005354 Ga0070675_100051659 Ga0070675_1000516594 228
71 3300005355 Ga0070671_100237375 Ga0070671_1002373752 228
72 3300005356 Ga0070674_100006739 Ga0070674_1000067395 228
73 3300005356 Ga0070674_100177722 Ga0070674_1001777222 228
74 3300005364 Ga0070673_100137037 Ga0070673_1001370372 228
75 3300005367 Ga0070667_100366005 Ga0070667_1003660052 228
76 3300005438 Ga0070701_10032093 Ga0070701_100320932 228
77 3300005440 Ga0070705_100080201 Ga0070705_1000802012 228
78 3300005440 Ga0070705_100295333 Ga0070705_1002953331 228
79 3300005441 Ga0070700_100015383 Ga0070700_1000153831 228
80 3300005441 Ga0070700_100308715 Ga0070700_1003087151 228
81 3300005444 Ga0070694_100075458 Ga0070694_1000754581 228
82 3300005455 Ga0070663_100204277 Ga0070663_1002042775 228
83 3300005455 Ga0070663_100441920 Ga0070663_1004419201 228
84 3300005456 Ga0070678_100381478 Ga0070678_1003814782 228
85 3300005459 Ga0068867_100088337 Ga0068867_1000883372 228
86 3300005459 Ga0068867_100572183 Ga0068867_1005721831 228
87 3300005543 Ga0070672_100146903 Ga0070672_1001469032 228
88 3300005545 Ga0070695_100004225 Ga0070695_1000042258 228
89 3300005546 Ga0070696_100015646 Ga0070696_10001564611 228
90 3300005548 Ga0070665_100001142 Ga0070665_10000114215 228
91 3300005548 Ga0070665_100076467 Ga0070665_1000764673 228
92 3300005549 Ga0070704_100206586 Ga0070704_1002065862 228
93 3300005549 Ga0070704_100244836 Ga0070704_1002448361 228
94 3300005615 Ga0070702_100043927 Ga0070702_1000439271 228
95 3300005617 Ga0068859_100158681 Ga0068859_1001586816 228
96 3300005617 Ga0068859_100691969 Ga0068859_1006919692 228
97 3300005618 Ga0068864_100222070 Ga0068864_1002220702 228
98 3300005618 Ga0068864_100347623 Ga0068864_1003476232 228
99 3300005718 Ga0068866_10039190 Ga0068866_100391906 228
100 3300005719 Ga0068861_100036602 Ga0068861_1000366026 228
101 3300005841 Ga0068863_100213704 Ga0068863_1002137046 228
102 3300005842 Ga0068858_100019034 Ga0068858_1000190342 228
103 3300005844 Ga0068862_100044776 Ga0068862_1000447762 228
104 3300005844 Ga0068862_100395702 Ga0068862_1003957022 228
105 3300006237 Ga0097621_100285958 Ga0097621_1002859582 228
106 3300006358 Ga0068871_100243384 Ga0068871_1002433842 228
107 3300006881 Ga0068865_100258855 Ga0068865_1002588551 228
108 3300006931 Ga0097620_100158668 Ga0097620_1001586686 228
109 3300006931 Ga0097620_100692017 Ga0097620_1006920172 228
110 3300009148 Ga0105243_10094927 Ga0105243_100949272 228
111 3300009148 Ga0105243_10130674 Ga0105243_101306746 228
112 3300009176 Ga0105242_10008251 Ga0105242_100082515 228
113 3300009177 Ga0105248_10004266 Ga0105248_1000426614 228
114 3300009177 Ga0105248_10082033 Ga0105248_100820333 228
115 3300009177 Ga0105248_10460875 Ga0105248_104608752 228
116 3300009545 Ga0105237_10518114 Ga0105237_105181142 228
117 3300009553 Ga0105249_10707121 Ga0105249_107071212 228
118 3300011119 Ga0105246_10327210 Ga0105246_103272102 228
119 3300013296 Ga0157374_10010815 Ga0157374_100108154 228
120 3300013306 Ga0163162_10437943 Ga0163162_104379434 228
121 3300013306 Ga0163162_10791580 Ga0163162_107915801 228
122 3300014325 Ga0163163_10085080 Ga0163163_100850802 228
123 3300014325 Ga0163163_10286888 Ga0163163_102868882 228
124 3300014326 Ga0157380_10171052 Ga0157380_101710526 228
125 3300014968 Ga0157379_10009065 Ga0157379_100090657 228
126 3300014968 Ga0157379_10028505 Ga0157379_100285056 228
127 3300014969 Ga0157376_10278382 Ga0157376_102783822 228
128 3300014969 Ga0157376_10691512 Ga0157376_106915121 228
129 3300025885 Ga0207653_10146099 Ga0207653_101460991 228
130 3300025899 Ga0207642_10046775 Ga0207642_100467752 228
131 3300025903 Ga0207680_10027843 Ga0207680_100278433 228
132 3300025923 Ga0207681_10057757 Ga0207681_100577576 228
133 3300025923 Ga0207681_10085188 Ga0207681_100851882 228
134 3300025925 Ga0207650_10087983 Ga0207650_100879832 228
135 3300025925 Ga0207650_10527390 Ga0207650_105273902 228
136 3300025926 Ga0207659_10135577 Ga0207659_101355773 228
137 3300025926 Ga0207659_10300647 Ga0207659_103006472 228
138 3300025926 Ga0207659_10444124 Ga0207659_104441242 228
139 3300025933 Ga0207706_10226908 Ga0207706_102269082 228
140 3300025934 Ga0207686_10029493 Ga0207686_100294936 228
141 3300025937 Ga0207669_10307308 Ga0207669_103073082 228
142 3300025937 Ga0207669_10367500 Ga0207669_103675002 228
143 3300025940 Ga0207691_10032573 Ga0207691_100325734 228
144 3300025941 Ga0207711_10115936 Ga0207711_101159366 228
145 3300025941 Ga0207711_10222806 Ga0207711_102228065 228
146 3300025941 Ga0207711_10320369 Ga0207711_103203692 228
147 3300025944 Ga0207661_10204596 Ga0207661_102045961 228
148 3300025960 Ga0207651_10093393 Ga0207651_100933932 228
149 3300025961 Ga0207712_10961248 Ga0207712_109612481 228
150 3300025972 Ga0207668_10258195 Ga0207668_102581952 228
151 3300025972 Ga0207668_10414357 Ga0207668_104143571 228
152 3300025981 Ga0207640_10012425 Ga0207640_100124253 228
153 3300026023 Ga0207677_10206460 Ga0207677_102064602 228
154 3300026035 Ga0207703_10047520 Ga0207703_100475203 228
155 3300026035 Ga0207703_10121410 Ga0207703_101214102 228
156 3300026067 Ga0207678_10076452 Ga0207678_100764522 228
157 3300026067 Ga0207678_10115973 Ga0207678_101159733 228
158 3300026075 Ga0207708_10006630 Ga0207708_100066302 228
159 3300026075 Ga0207708_10034704 Ga0207708_100347043 228
160 3300026075 Ga0207708_10272951 Ga0207708_102729512 228
161 3300026089 Ga0207648_10084636 Ga0207648_100846362 228
162 3300026089 Ga0207648_10630557 Ga0207648_106305572 228
163 3300026095 Ga0207676_10025728 Ga0207676_100257286 228
164 3300026118 Ga0207675_100006610 Ga0207675_1000066102 228
165 3300026118 Ga0207675_100063632 Ga0207675_1000636323 228
166 3300026118 Ga0207675_100149248 Ga0207675_1001492482 228
167 3300026121 Ga0207683_10320247 Ga0207683_103202472 228
168 3300026121 Ga0207683_10413593 Ga0207683_104135932 228
169 3300028379 Ga0268266_10053316 Ga0268266_100533162 228
170 3300028379 Ga0268266_10069684 Ga0268266_100696842 228
171 3300028380 Ga0268265_10016572 Ga0268265_100165723 228
172 3300028380 Ga0268265_11045409 Ga0268265_110454091 228
173 3300028381 Ga0268264_10503821 Ga0268264_105038212 228
174 3300031665 Ga0316575_10011582 Ga0316575_100115822 228
175 3300037068 Ga0373925_0226793 Ga0373925_0226793_485_1204 228
176 3300042184 Ga0450908_007116 Ga0450908_007116_79_837 228
177 3300046663 Ga0495635_0142227 Ga0495635_0142227_31_750 228
178 3300048907 Ga0496104_0036452 Ga0496104_0036452_107_829 228
179 3300048911 Ga0496108_0022693 Ga0496108_0022693_3006_3728 228
180 3300048912 Ga0496109_0111993 Ga0496109_0111993_1431_2153 228
181 3300048914 Ga0496111_0287220 Ga0496111_0287220_226_948 228
182 3300048915 Ga0496112_0061243 Ga0496112_0061243_2439_3161 228
183 3300048916 Ga0496113_0141920 Ga0496113_0141920_538_1260 228
184 3300049582 Ga0501048_0235146 Ga0501048_0235146_130_849 228
185 3300049742 Ga0501080_0391025 Ga0501080_0391025_318_1037 228
186 3300049743 Ga0501081_0103665 Ga0501081_0103665_235_954 228
187 3300053077 Ga0495601_0398705 Ga0495601_0398705_39_758 228
188 3300059424 Ga0590075_028962 Ga0590075_028962_74_787 228
189 3300005334 Ga0068869_100140756 Ga0068869_1001407564 229
190 3300005456 Ga0070678_100350358 Ga0070678_1003503583 229
191 3300005546 Ga0070696_100455174 Ga0070696_1004551741 229
192 3300005617 Ga0068859_100012466 Ga0068859_10001246611 229
193 3300005719 Ga0068861_100080678 Ga0068861_1000806783 229
194 3300005937 Ga0081455_10014307 Ga0081455_100143076 229
195 3300006051 Ga0075364_10238732 Ga0075364_102387322 229
196 3300006353 Ga0075370_10062774 Ga0075370_100627742 229
197 3300006353 Ga0075370_10268971 Ga0075370_102689712 229
198 3300006871 Ga0075434_100150384 Ga0075434_1001503842 229
199 3300006931 Ga0097620_100012466 Ga0097620_10001246611 229
200 3300007076 Ga0075435_100409833 Ga0075435_1004098333 229
201 3300009093 Ga0105240_10016812 Ga0105240_100168124 229
202 3300009094 Ga0111539_10533904 Ga0111539_105339042 229
203 3300009147 Ga0114129_10009415 Ga0114129_1000941514 229
204 3300025913 Ga0207695_10205413 Ga0207695_102054135 229
205 3300025922 Ga0207646_10636106 Ga0207646_106361061 229
206 3300025942 Ga0207689_10101829 Ga0207689_101018293 229
207 3300026118 Ga0207675_100040133 Ga0207675_1000401339 229
208 3300031731 Ga0307405_10064207 Ga0307405_100642072 229
209 3300031824 Ga0307413_10028722 Ga0307413_100287225 229
210 3300031901 Ga0307406_10115173 Ga0307406_101151732 229
211 3300031903 Ga0307407_10078197 Ga0307407_100781975 229
212 3300032002 Ga0307416_100111549 Ga0307416_1001115496 229
213 3300032004 Ga0307414_10025579 Ga0307414_100255794 229
214 3300032126 Ga0307415_100047238 Ga0307415_1000472382 229
215 3300035090 Ga0373949_0034932 Ga0373949_0034932_220_936 229
216 3300050491 nmdc:mga00v17_373063_c1 nmdc:mga00v17_373063_c1_177_917 229
217 3300050496 nmdc:mga07m45_105394_c1 nmdc:mga07m45_105394_c1_681_1424 229
218 3300050507 nmdc:mga05p37_15056_c1 nmdc:mga05p37_15056_c1_3154_3870 229
219 3300050511 nmdc:mga08y16_313160_c1 nmdc:mga08y16_313160_c1_742_1458 229
220 3300050512 nmdc:mga0n895_27407_c1 nmdc:mga0n895_27407_c1_3070_3786 229
221 3300050515 nmdc:mga0a205_21028_c1 nmdc:mga0a205_21028_c1_2105_2821 229
222 3300005338 Ga0068868_100082236 Ga0068868_1000822363 230
223 3300005406 Ga0070703_10015164 Ga0070703_100151644 230
224 3300005545 Ga0070695_100369138 Ga0070695_1003691382 230
225 3300005844 Ga0068862_100141796 Ga0068862_1001417963 230
226 3300009094 Ga0111539_10201326 Ga0111539_102013262 230
227 3300009177 Ga0105248_10659361 Ga0105248_106593612 230
228 3300013306 Ga0163162_11235379 Ga0163162_112353791 230
229 3300025941 Ga0207711_10427295 Ga0207711_104272952 230
230 3300026121 Ga0207683_10687104 Ga0207683_106871041 230
231 3300031727 Ga0316576_10031857 Ga0316576_100318576 230
232 3300042876 Ga0451577_0091303 Ga0451577_0091303_231_953 230
233 3300044712 Ga0453684_0025507 Ga0453684_0025507_5895_6617 230
234 3300050507 nmdc:mga05p37_29304_c1 nmdc:mga05p37_29304_c1_3513_4244 230
235 3300050511 nmdc:mga08y16_19434_c1 nmdc:mga08y16_19434_c1_6240_6971 230
236 3300005364 Ga0070673_100030702 Ga0070673_1000307024 231
237 3300005365 Ga0070688_100024830 Ga0070688_1000248303 231
238 3300005434 Ga0070709_10071755 Ga0070709_100717553 231
239 3300005518 Ga0070699_100603967 Ga0070699_1006039672 231
240 3300005544 Ga0070686_100465945 Ga0070686_1004659452 231
241 3300005548 Ga0070665_100635185 Ga0070665_1006351852 231
242 3300005578 Ga0068854_100272055 Ga0068854_1002720553 231
243 3300005617 Ga0068859_100042478 Ga0068859_1000424788 231
244 3300005842 Ga0068858_100371789 Ga0068858_1003717891 231
245 3300005985 Ga0081539_10002852 Ga0081539_100028523 231
246 3300006178 Ga0075367_10141571 Ga0075367_101415712 231
247 3300006178 Ga0075367_10149448 Ga0075367_101494482 231
248 3300006195 Ga0075366_10025811 Ga0075366_100258111 231
249 3300006195 Ga0075366_10090629 Ga0075366_100906292 231
250 3300006353 Ga0075370_10009608 Ga0075370_100096089 231
251 3300006844 Ga0075428_100136870 Ga0075428_1001368702 231
252 3300006871 Ga0075434_100230953 Ga0075434_1002309532 231
253 3300006931 Ga0097620_100042479 Ga0097620_1000424793 231
254 3300009094 Ga0111539_10258421 Ga0111539_102584213 231
255 3300009147 Ga0114129_11047009 Ga0114129_110470092 231
256 3300009177 Ga0105248_10158323 Ga0105248_101583234 231
257 3300014969 Ga0157376_10191256 Ga0157376_101912562 231
258 3300025906 Ga0207699_10281015 Ga0207699_102810152 231
259 3300025933 Ga0207706_10191123 Ga0207706_101911232 231
260 3300025941 Ga0207711_10041300 Ga0207711_100413003 231
261 3300025960 Ga0207651_10156417 Ga0207651_101564171 231
262 3300025972 Ga0207668_10396516 Ga0207668_103965161 231
263 3300028379 Ga0268266_10635325 Ga0268266_106353252 231
264 3300031731 Ga0307405_10416339 Ga0307405_104163392 231
265 3300032002 Ga0307416_100582186 Ga0307416_1005821862 231
266 3300032004 Ga0307414_10155153 Ga0307414_101551534 231
267 3300032005 Ga0307411_10030021 Ga0307411_100300213 231
268 3300035120 Ga0373957_0066814 Ga0373957_0066814_468_1208 231
269 3300036401 Ga0373937_0057658 Ga0373937_0057658_422_1162 231
270 3300046533 Ga0495640_0108676 Ga0495640_0108676_119_859 231
271 3300046675 Ga0495657_0409457 Ga0495657_0409457_43_783 231
272 3300046683 Ga0495658_0179787 Ga0495658_0179787_128_868 231
273 3300050493 nmdc:mga0k408_2125_c1 nmdc:mga0k408_2125_c1_1856_2602 231
274 3300050493 nmdc:mga0k408_53648_c1 nmdc:mga0k408_53648_c1_686_1432 231
275 3300050494 nmdc:mga06z11_115872_c1 nmdc:mga06z11_115872_c1_605_1336 231
276 3300050496 nmdc:mga07m45_12359_c1 nmdc:mga07m45_12359_c1_1911_2657 231
277 3300050511 nmdc:mga08y16_238911_c1 nmdc:mga08y16_238911_c1_779_1507 231
278 3300050513 nmdc:mga0rr50_38351_c1 nmdc:mga0rr50_38351_c1_1518_2243 231
279 3300005328 Ga0070676_10036726 Ga0070676_100367261 232
280 3300005333 Ga0070677_10000724 Ga0070677_1000072410 232
281 3300005334 Ga0068869_100210306 Ga0068869_1002103063 232
282 3300005338 Ga0068868_100016778 Ga0068868_1000167782 232
283 3300005340 Ga0070689_100080187 Ga0070689_1000801871 232
284 3300005344 Ga0070661_100035193 Ga0070661_1000351931 232
285 3300005347 Ga0070668_100066450 Ga0070668_1000664502 232
286 3300005353 Ga0070669_100015657 Ga0070669_1000156576 232
287 3300005353 Ga0070669_100258201 Ga0070669_1002582012 232
288 3300005365 Ga0070688_100041386 Ga0070688_1000413863 232
289 3300005366 Ga0070659_100024194 Ga0070659_1000241944 232
290 3300005367 Ga0070667_100019041 Ga0070667_1000190413 232
291 3300005440 Ga0070705_100186550 Ga0070705_1001865502 232
292 3300005441 Ga0070700_100090614 Ga0070700_1000906143 232
293 3300005456 Ga0070678_100012255 Ga0070678_1000122556 232
294 3300005459 Ga0068867_100429028 Ga0068867_1004290282 232
295 3300005466 Ga0070685_10074950 Ga0070685_100749501 232
296 3300005543 Ga0070672_100038211 Ga0070672_1000382111 232
297 3300005544 Ga0070686_100006918 Ga0070686_1000069185 232
298 3300005548 Ga0070665_100137053 Ga0070665_1001370532 232
299 3300005564 Ga0070664_100007119 Ga0070664_1000071192 232
300 3300005618 Ga0068864_100500913 Ga0068864_1005009132 232
301 3300005719 Ga0068861_100018055 Ga0068861_1000180556 232
302 3300005840 Ga0068870_10011884 Ga0068870_100118843 232
303 3300005841 Ga0068863_100011731 Ga0068863_1000117316 232
304 3300005843 Ga0068860_100029032 Ga0068860_1000290323 232
305 3300005844 Ga0068862_100097934 Ga0068862_1000979343 232
306 3300006237 Ga0097621_100075897 Ga0097621_1000758976 232
307 3300006358 Ga0068871_100037108 Ga0068871_1000371083 232
308 3300006844 Ga0075428_100003764 Ga0075428_10000376415 232
309 3300006846 Ga0075430_100121582 Ga0075430_1001215822 232
310 3300006846 Ga0075430_100164319 Ga0075430_1001643194 232
311 3300006852 Ga0075433_10034459 Ga0075433_100344596 232
312 3300006871 Ga0075434_100007413 Ga0075434_10000741310 232
313 3300006880 Ga0075429_100018556 Ga0075429_1000185567 232
314 3300006880 Ga0075429_100126990 Ga0075429_1001269902 232
315 3300006880 Ga0075429_100466364 Ga0075429_1004663642 232
316 3300006881 Ga0068865_100102691 Ga0068865_1001026912 232
317 3300009094 Ga0111539_10001096 Ga0111539_100010962 232
318 3300009094 Ga0111539_10184558 Ga0111539_101845581 232
319 3300009101 Ga0105247_10434064 Ga0105247_104340641 232
320 3300009177 Ga0105248_10160133 Ga0105248_101601333 232
321 3300009553 Ga0105249_10043419 Ga0105249_100434194 232
322 3300011119 Ga0105246_10045757 Ga0105246_100457573 232
323 3300013102 Ga0157371_10196800 Ga0157371_101968003 232
324 3300013306 Ga0163162_10021664 Ga0163162_100216646 232
325 3300013308 Ga0157375_10045559 Ga0157375_100455594 232
326 3300014326 Ga0157380_10028433 Ga0157380_100284332 232
327 3300014745 Ga0157377_10026667 Ga0157377_100266672 232
328 3300014968 Ga0157379_10014131 Ga0157379_100141314 232
329 3300014969 Ga0157376_10050167 Ga0157376_100501672 232
330 3300025315 Ga0207697_10007397 Ga0207697_100073974 232
331 3300025893 Ga0207682_10001234 Ga0207682_100012342 232
332 3300025901 Ga0207688_10001167 Ga0207688_1000116713 232
333 3300025908 Ga0207643_10006910 Ga0207643_100069106 232
334 3300025918 Ga0207662_10012243 Ga0207662_100122435 232
335 3300025923 Ga0207681_10021200 Ga0207681_100212005 232
336 3300025932 Ga0207690_10092618 Ga0207690_100926182 232
337 3300025933 Ga0207706_10024159 Ga0207706_100241596 232
338 3300025936 Ga0207670_10009444 Ga0207670_100094446 232
339 3300025938 Ga0207704_10166144 Ga0207704_101661442 232
340 3300025942 Ga0207689_10027509 Ga0207689_100275091 232
341 3300025945 Ga0207679_10023425 Ga0207679_100234252 232
342 3300025960 Ga0207651_10036017 Ga0207651_100360176 232
343 3300025961 Ga0207712_10009191 Ga0207712_100091912 232
344 3300025972 Ga0207668_10054711 Ga0207668_100547113 232
345 3300026035 Ga0207703_10140785 Ga0207703_101407852 232
346 3300026075 Ga0207708_10012748 Ga0207708_100127485 232
347 3300026088 Ga0207641_10006672 Ga0207641_100066723 232
348 3300026089 Ga0207648_10025719 Ga0207648_100257196 232
349 3300026118 Ga0207675_100023521 Ga0207675_1000235216 232
350 3300026121 Ga0207683_10004333 Ga0207683_100043332 232
351 3300027907 Ga0207428_10026924 Ga0207428_100269244 232
352 3300028379 Ga0268266_10135374 Ga0268266_101353742 232
353 3300028380 Ga0268265_10031008 Ga0268265_100310081 232
354 3300034820 Ga0373959_0017732 Ga0373959_0017732_88_819 232
355 3300035088 Ga0373940_0020938 Ga0373940_0020938_539_1270 232
356 3300035114 Ga0373939_0010798 Ga0373939_0010798_1036_1767 232
357 3300035115 Ga0373941_0043195 Ga0373941_0043195_552_1283 232
358 3300035241 Ga0373961_0024686 Ga0373961_0024686_486_1217 232
359 3300045051 Ga0451576_0402846 Ga0451576_0402846_355_1086 232
360 3300048909 Ga0496106_0116881 Ga0496106_0116881_948_1679 232
361 3300048911 Ga0496108_0216281 Ga0496108_0216281_885_1616 232
362 3300048912 Ga0496109_0130868 Ga0496109_0130868_126_857 232
363 3300049577 Ga0501041_0381361 Ga0501041_0381361_92_823 232
364 3300049743 Ga0501081_0397467 Ga0501081_0397467_128_859 232
365 3300050508 nmdc:mga09592_17140_c1 nmdc:mga09592_17140_c1_3085_3816 232
366 3300050508 nmdc:mga09592_41685_c1 nmdc:mga09592_41685_c1_2672_3403 232
367 3300050509 nmdc:mga0qj67_114704_c1 nmdc:mga0qj67_114704_c1_1293_2024 232
368 3300050509 nmdc:mga0qj67_35002_c1 nmdc:mga0qj67_35002_c1_1513_2244 232
369 3300050510 nmdc:mga06r32_172887_c1 nmdc:mga06r32_172887_c1_178_909 232
370 3300050511 nmdc:mga08y16_173502_c1 nmdc:mga08y16_173502_c1_135_866 232
371 3300050511 nmdc:mga08y16_34498_c1 nmdc:mga08y16_34498_c1_3250_3981 232
372 3300050512 nmdc:mga0n895_6124_c1 nmdc:mga0n895_6124_c1_463_1194 232
373 3300050515 nmdc:mga0a205_3001_c1 nmdc:mga0a205_3001_c1_11640_12371 232
374 3300054114 Ga0501084_0381373 Ga0501084_0381373_176_907 232
375 3300005434 Ga0070709_10231720 Ga0070709_102317202 233
376 3300009147 Ga0114129_10040307 Ga0114129_100403073 233
377 3300042436 Ga0439435_0026386 Ga0439435_0026386_670_1401 233
378 3300006852 Ga0075433_10134620 Ga0075433_101346204 234
379 3300053103 Ga0500555_000968 Ga0500555_000968_7072_7830 234
380 3300053153 Ga0500616_0000357 Ga0500616_0000357_46774_47535 234
381 3300053730 Ga0500645_001011 Ga0500645_001011_1439_2209 234
382 3300005354 Ga0070675_100003283 Ga0070675_1000032835 235
383 3300005719 Ga0068861_100187173 Ga0068861_1001871733 235
384 3300006237 Ga0097621_100894709 Ga0097621_1008947091 235
385 3300006358 Ga0068871_100556285 Ga0068871_1005562851 235
386 3300009094 Ga0111539_10001535 Ga0111539_1000153527 235
387 3300009177 Ga0105248_10717490 Ga0105248_107174903 235
388 3300014745 Ga0157377_10192358 Ga0157377_101923582 235
389 3300025926 Ga0207659_10002281 Ga0207659_100022815 235
390 3300041999 Ga0439433_0027157 Ga0439433_0027157_357_1097 235
391 3300046460 Ga0495638_0180403 Ga0495638_0180403_144_896 235
392 3300005354 Ga0070675_100365726 Ga0070675_1003657263 237
393 3300014969 Ga0157376_10301247 Ga0157376_103012474 237
394 3300025926 Ga0207659_10294415 Ga0207659_102944152 237
395 3300031548 Ga0307408_100219112 Ga0307408_1002191122 237
396 3300045051 Ga0451576_0867050 Ga0451576_0867050_111_857 237
397 3300032002 Ga0307416_100020984 Ga0307416_1000209844 238
398 3300046491 Ga0495584_0250787 Ga0495584_0250787_54_797 238
399 3300046522 Ga0495643_0002653 Ga0495643_0002653_2037_2783 239
400 3300005353 Ga0070669_100174388 Ga0070669_1001743884 240
401 3300005438 Ga0070701_10129066 Ga0070701_101290661 240
402 3300031731 Ga0307405_10015947 Ga0307405_100159476 242
403 3300031824 Ga0307413_10108135 Ga0307413_101081352 242
404 3300031903 Ga0307407_10026230 Ga0307407_100262302 242
405 3300031911 Ga0307412_10002885 Ga0307412_1000288510 242
406 3300031995 Ga0307409_100121712 Ga0307409_1001217122 242
407 3300032002 Ga0307416_100498488 Ga0307416_1004984882 242
408 3300032004 Ga0307414_10125481 Ga0307414_101254812 242
409 3300032126 Ga0307415_100034607 Ga0307415_1000346073 242
410 3300046683 Ga0495658_0094757 Ga0495658_0094757_352_1143 242
411 3300060353 Ga0501082_0839604 Ga0501082_0839604_38_793 242
412 3300005293 Ga0065715_10264279 Ga0065715_102642792 244
413 3300005328 Ga0070676_10133658 Ga0070676_101336584 244
414 3300005330 Ga0070690_100101899 Ga0070690_1001018994 244
415 3300005331 Ga0070670_100053321 Ga0070670_1000533213 244
416 3300005335 Ga0070666_10351540 Ga0070666_103515402 244
417 3300005340 Ga0070689_100015901 Ga0070689_1000159015 244
418 3300005354 Ga0070675_100043915 Ga0070675_1000439156 244
419 3300005355 Ga0070671_100155245 Ga0070671_1001552454 244
420 3300005365 Ga0070688_100080981 Ga0070688_1000809816 244
421 3300005457 Ga0070662_100325334 Ga0070662_1003253342 244
422 3300005466 Ga0070685_10038803 Ga0070685_100388036 244
423 3300005544 Ga0070686_100111506 Ga0070686_1001115064 244
424 3300005564 Ga0070664_100036082 Ga0070664_1000360824 244
425 3300005577 Ga0068857_100172762 Ga0068857_1001727622 244
426 3300005617 Ga0068859_100047196 Ga0068859_1000471963 244
427 3300005618 Ga0068864_100029638 Ga0068864_1000296386 244
428 3300005844 Ga0068862_100501054 Ga0068862_1005010542 244
429 3300006931 Ga0097620_100047197 Ga0097620_1000471973 244
430 3300025903 Ga0207680_10307505 Ga0207680_103075052 244
431 3300025918 Ga0207662_10052248 Ga0207662_100522482 244
432 3300025931 Ga0207644_10048998 Ga0207644_100489983 244
433 3300025936 Ga0207670_10017414 Ga0207670_100174141 244
434 3300025940 Ga0207691_10022950 Ga0207691_100229505 244
435 3300025945 Ga0207679_10216174 Ga0207679_102161742 244
436 3300026116 Ga0207674_10400617 Ga0207674_104006172 244
437 3300028380 Ga0268265_10460344 Ga0268265_104603442 244
438 3300050508 nmdc:mga09592_97349_c1 nmdc:mga09592_97349_c1_841_1599 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

133

274

0.96

PF08032

SpoU_sub_bind

RNA 2'-O ribose methyltransferase substrate binding

46

120

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz0-assembly4.cif.gz_E 23s ribosomal rna g2251 2'o-methyltransferase rlmb 0.9184 74 227
2ha8-assembly1.cif.gz_B methyltransferase domain of human tar (hiv-1) rna binding protein 1 0.9049 89 230
2fc3-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8769 1 69
3jcs-assembly1.cif.gz_d 2.8 angstrom cryo-em structure of the large ribosomal subunit from the eukaryotic parasite leishmania 0.8734 1 70
1sds-assembly1.cif.gz_A structure of protein l7ae bound to a k-turn derived from an archaeal box h/aca srna 0.8708 1 70
ID Description Score Start End Superfamily
af_P63177_1_76_3.30.1330.30 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.9535 1 70 3.30.1330.30
af_A0A0R0FE30_2_163_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9474 134 229 3.40.1280.10
af_Q2G2M3_1_72_3.30.1330.30 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.9325 1 68 3.30.1330.30
af_P0AGJ2_1_204_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9291 87 231 3.40.1280.10
1gz0F01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.9236 3 69 3.30.1330.30
ID Description Score Start End GO Terms
AF-A0A3M1SV54-F1-model_v4 RNA methyltransferase 0.9908 134 231 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A316M382-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9837 146 227 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A259P4I9-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9786 139 236 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A355WDE0-F1-model_v4 23S rRNA (Guanosine(2251)-2'-O)-methyltransferase RlmB 0.9749 134 228 GO:0003723
GO:0005829
GO:0006396
GO:0008173
GO:0032259
AF-A0A7Y5QUH2-F1-model_v4 deleted 0.9744 143 229

Feature Viewer

pLDDT pTM Quality
86 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map