F443976

General Info

Members Datasets Scaffolds Average Seq Length
438 186 430 273

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10025837|Ga0105237_100258376
Length 282
Sequence VNDLRINYLRAMNLANKVIIITGASSGIGKSLAIEFAKRGANLVLGARHFVNLCTIAQQIEQQYNVKAIAVQCDVTIEEDCDLLIKQALITFDHIDILINNAGISMRALFNDSSIKVLKSVMDVNFWGTVYCTKYALPHILKTQGSIVGVSSIAGYKGLPGRTGYSASKFAMNGFLDALRIENLKTGLHVMTACPGFTASNIRNTALDKNGREQRESTLNEQSMMTSEKVAQIIANGVENRSRTLIMTGEGKLTVLIGKLFPGLLDKLVYNKMKKERNSLLK

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
14 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
15 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
105 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
159 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
160 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
165 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
166 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
167 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
168 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
179 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
182 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
183 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
184 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
185 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
186 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.02
Nodule 0
Rhizoplane 0.46
Rhizosphere 89.73
Stem 0
Stem Tuber 0
Unclassified 4.79

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1003945 3300001904 Bacteria 2553
2 JGI24739J22299_10024429 3300001989 Bacteria 2131
3 JGI24737J22298_10002553 3300001990 Bacteria 6462
4 JGI24735J21928_10000028 3300002067 Bacteria 83192
5 JGI25162J39368_1000614 3300002737 Bacteria 25616
6 JGI25164J39214_1002858 3300002772 Bacteria 2409
7 JGI25165J46597_1000634 3300003214 Bacteria 29066
8 rootH1_10073390 3300003316 Bacteria 8557
9 rootH2_10016199 3300003320 Bacteria 99895
10 rootH2_10050013 3300003320 Bacteria 2230
11 rootH2_10127535 3300003320 Bacteria 5085
12 rootH2_10138767 3300003320 Bacteria 1028
13 rootH2_10289888 3300003320 Bacteria 1234
14 rootL2_10064540 3300003322 Bacteria 1851
15 rootH1_10007146 3300003323 Bacteria 1965
16 rootH1_10050118 3300003323 Bacteria 18955
17 rootH1_10066422 3300003323 Bacteria 27266
18 rootH1_10067818 3300003323 Bacteria 7584
19 rootH1_10123717 3300003323 Bacteria 3876
20 Ga0065714_10084393 3300005288 Bacteria 2201
21 Ga0070658_10000019 3300005327 Bacteria 194742
22 Ga0070658_10172383 3300005327 Bacteria 1818
23 Ga0070676_10000897 3300005328 Bacteria 14727
24 Ga0070683_100027772 3300005329 Bacteria 5106
25 Ga0070670_100148890 3300005331 Bacteria 2026
26 Ga0070670_100291723 3300005331 Unclassified 1426
27 Ga0068869_100014657 3300005334 Bacteria 5241
28 Ga0068869_100034819 3300005334 Bacteria 3565
29 Ga0068869_100037163 3300005334 Bacteria 3461
30 Ga0068869_100163790 3300005334 Bacteria 1733
31 Ga0070666_10005828 3300005335 Bacteria 7570
32 Ga0068868_100003994 3300005338 Bacteria 10292
33 Ga0068868_100012600 3300005338 Bacteria 6183
34 Ga0068868_100446966 3300005338 Bacteria 1124
35 Ga0068868_100577010 3300005338 Bacteria 994
36 Ga0070660_100071770 3300005339 Bacteria 2704
37 Ga0070660_100134036 3300005339 Bacteria 1984
38 Ga0070687_100301664 3300005343 Bacteria 1016
39 Ga0070661_100032797 3300005344 Bacteria 3761
40 Ga0070661_100036444 3300005344 Bacteria 3575
41 Ga0070661_100059318 3300005344 Unclassified 2805
42 Ga0070668_100013444 3300005347 Bacteria 6110
43 Ga0070668_100018639 3300005347 Bacteria 5211
44 Ga0070669_100011152 3300005353 Bacteria 6378
45 Ga0070669_100241812 3300005353 Bacteria 1434
46 Ga0070669_100279207 3300005353 Bacteria 1338
47 Ga0070675_100027092 3300005354 Bacteria 4603
48 Ga0070675_100129801 3300005354 Bacteria 2147
49 Ga0070675_100163912 3300005354 Bacteria 1913
50 Ga0070671_100003862 3300005355 Bacteria 11781
51 Ga0070671_100042653 3300005355 Bacteria 3771
52 Ga0070671_100070978 3300005355 Unclassified 2906
53 Ga0070671_100115526 3300005355 Bacteria 2256
54 Ga0070671_100134143 3300005355 Unclassified 2087
55 Ga0070671_100477213 3300005355 Bacteria 1071
56 Ga0070674_100035540 3300005356 Bacteria 3337
57 Ga0070674_100155366 3300005356 Unclassified 1731
58 Ga0070673_100020464 3300005364 Bacteria 4774
59 Ga0070673_100033961 3300005364 Bacteria 3855
60 Ga0070673_100253988 3300005364 Bacteria 1533
61 Ga0070688_100025998 3300005365 Bacteria 3473
62 Ga0070688_100136408 3300005365 Bacteria 1662
63 Ga0070659_100022865 3300005366 Bacteria 4777
64 Ga0070659_100152677 3300005366 Bacteria 1885
65 Ga0070659_100154148 3300005366 Bacteria 1875
66 Ga0070659_100205012 3300005366 Unclassified 1624
67 Ga0070667_100107850 3300005367 Bacteria 2412
68 Ga0070667_100202750 3300005367 Bacteria 1760
69 Ga0070667_100414141 3300005367 Bacteria 1228
70 Ga0070663_100018994 3300005455 Bacteria 4520
71 Ga0070678_100001108 3300005456 Bacteria 14126
72 Ga0070678_100037665 3300005456 Bacteria 3398
73 Ga0070678_100419048 3300005456 Bacteria 1167
74 Ga0070662_100009456 3300005457 Bacteria 6374
75 Ga0068867_100000136 3300005459 Bacteria 47486
76 Ga0068867_100030961 3300005459 Unclassified 3861
77 Ga0068867_100032253 3300005459 Bacteria 3787
78 Ga0070685_10029331 3300005466 Bacteria 3056
79 Ga0070685_10034518 3300005466 Bacteria 2849
80 Ga0070685_10080412 3300005466 Bacteria 1953
81 Ga0070685_10282230 3300005466 Bacteria 1112
82 Ga0070707_100127586 3300005468 Bacteria 2472
83 Ga0070698_100005162 3300005471 Bacteria 14281
84 Ga0070698_100017592 3300005471 Bacteria 7533
85 Ga0070699_100450379 3300005518 Bacteria 1167
86 Ga0070684_100001246 3300005535 Bacteria 18230
87 Ga0070684_100021442 3300005535 Bacteria 5377
88 Ga0070684_100043931 3300005535 Bacteria 3862
89 Ga0070684_100369808 3300005535 Bacteria 1320
90 Ga0070684_100408023 3300005535 Bacteria 1253
91 Ga0068853_100003597 3300005539 Bacteria 11868
92 Ga0068853_100101672 3300005539 Bacteria 2542
93 Ga0068853_100103039 3300005539 Unclassified 2526
94 Ga0068853_100155522 3300005539 Bacteria 2060
95 Ga0068853_100228572 3300005539 Unclassified 1701
96 Ga0068853_100309571 3300005539 Unclassified 1462
97 Ga0070672_100006670 3300005543 Bacteria 7777
98 Ga0070672_100076046 3300005543 Unclassified 2681
99 Ga0070672_100216980 3300005543 Bacteria 1604
100 Ga0070686_100171754 3300005544 Bacteria 1534
101 Ga0070665_100000003 3300005548 Bacteria 811857
102 Ga0070665_100015395 3300005548 Bacteria 7680
103 Ga0068855_100000073 3300005563 Bacteria 121126
104 Ga0068855_100000388 3300005563 Bacteria 54070
105 Ga0068855_100015168 3300005563 Bacteria 9280
106 Ga0068855_100021669 3300005563 Bacteria 7708
107 Ga0068855_100161093 3300005563 Unclassified 2547
108 Ga0070664_100024865 3300005564 Unclassified 4961
109 Ga0070664_100095799 3300005564 Bacteria 2574
110 Ga0070664_100100817 3300005564 Bacteria 2510
111 Ga0070664_100165885 3300005564 Bacteria 1957
112 Ga0070664_100215777 3300005564 Unclassified 1715
113 Ga0070664_100649781 3300005564 Bacteria 980
114 Ga0068857_100018337 3300005577 Bacteria 6141
115 Ga0068857_100042492 3300005577 Bacteria 4033
116 Ga0068857_100133366 3300005577 Unclassified 2241
117 Ga0068854_100004069 3300005578 Bacteria 9185
118 Ga0068856_100002043 3300005614 Bacteria 20938
119 Ga0068856_100006719 3300005614 Bacteria 11272
120 Ga0068856_100043736 3300005614 Bacteria 4406
121 Ga0068856_100138781 3300005614 Bacteria 2438
122 Ga0070702_100079402 3300005615 Bacteria 1961
123 Ga0070702_100219636 3300005615 Bacteria 1270
124 Ga0070702_100248301 3300005615 Bacteria 1205
125 Ga0068852_100001701 3300005616 Bacteria 14987
126 Ga0068852_100003450 3300005616 Bacteria 11053
127 Ga0068852_100089249 3300005616 Bacteria 2755
128 Ga0068852_100205939 3300005616 Bacteria 1864
129 Ga0068859_100002370 3300005617 Bacteria 19175
130 Ga0068859_100002964 3300005617 Bacteria 17213
131 Ga0068859_100085061 3300005617 Bacteria 3208
132 Ga0068859_100728052 3300005617 Bacteria 1082
133 Ga0068864_100022551 3300005618 Bacteria 5279
134 Ga0068864_100064246 3300005618 Bacteria 3183
135 Ga0068864_100675811 3300005618 Bacteria 1007
136 Ga0068866_10010101 3300005718 Bacteria 4036
137 Ga0068866_10197524 3300005718 Bacteria 1200
138 Ga0068861_100037917 3300005719 Bacteria 3585
139 Ga0068861_100041761 3300005719 Bacteria 3436
140 Ga0068851_10097191 3300005834 Bacteria 1558
141 Ga0068851_10130304 3300005834 Bacteria 1359
142 Ga0068851_10192434 3300005834 Bacteria 1135
143 Ga0068863_100031617 3300005841 Bacteria 5050
144 Ga0068863_100237643 3300005841 Bacteria 1758
145 Ga0068858_100593025 3300005842 Bacteria 1074
146 Ga0068860_100036334 3300005843 Unclassified 4721
147 Ga0068860_100060105 3300005843 Bacteria 3613
148 Ga0068860_100498186 3300005843 Bacteria 1216
149 Ga0068862_100268440 3300005844 Bacteria 1560
150 Ga0068862_100293507 3300005844 Unclassified 1494
151 Ga0068862_100321941 3300005844 Bacteria 1427
152 Ga0070715_10027236 3300006163 Bacteria 2282
153 Ga0070715_10041655 3300006163 Bacteria 1926
154 Ga0075366_10000493 3300006195 Bacteria 18252
155 Ga0075366_10012821 3300006195 Bacteria 4764
156 Ga0097621_100000178 3300006237 Bacteria 40367
157 Ga0097621_100016366 3300006237 Bacteria 5605
158 Ga0097621_100039501 3300006237 Bacteria 3791
159 Ga0097621_100312096 3300006237 Bacteria 1391
160 Ga0097621_100532111 3300006237 Bacteria 1068
161 Ga0068871_100000652 3300006358 Bacteria 23848
162 Ga0068871_100004309 3300006358 Bacteria 9882
163 Ga0068871_100208052 3300006358 Bacteria 1691
164 Ga0068871_100374358 3300006358 Unclassified 1264
165 Ga0075428_100006320 3300006844 Bacteria 13174
166 Ga0075430_100504338 3300006846 Bacteria 999
167 Ga0075434_100229003 3300006871 Bacteria 1878
168 Ga0075429_100018833 3300006880 Bacteria 5980
169 Ga0075429_100319108 3300006880 Bacteria 1360
170 Ga0068865_100000067 3300006881 Bacteria 54449
171 Ga0068865_100146348 3300006881 Bacteria 1787
172 Ga0068865_100191055 3300006881 Bacteria 1583
173 Ga0097620_100002371 3300006931 Bacteria 19175
174 Ga0097620_100002964 3300006931 Bacteria 17213
175 Ga0097620_100085059 3300006931 Bacteria 3208
176 Ga0097620_100728046 3300006931 Bacteria 1082
177 Ga0105240_10000722 3300009093 Bacteria 60400
178 Ga0105240_10024330 3300009093 Bacteria 7986
179 Ga0105240_10025178 3300009093 Bacteria 7825
180 Ga0105240_10081521 3300009093 Bacteria 3976
181 Ga0105240_10113659 3300009093 Bacteria 3272
182 Ga0105240_10170806 3300009093 Bacteria 2576
183 Ga0105240_10293904 3300009093 Bacteria 1861
184 Ga0105240_10351435 3300009093 Bacteria 1672
185 Ga0111539_10004074 3300009094 Bacteria 19184
186 Ga0111539_10136836 3300009094 Bacteria 2868
187 Ga0111539_10639039 3300009094 Bacteria 1239
188 Ga0105245_10319963 3300009098 Bacteria 1528
189 Ga0105243_10371122 3300009148 Unclassified 1320
190 Ga0105241_10002510 3300009174 Bacteria 13785
191 Ga0105241_10014580 3300009174 Bacteria 5756
192 Ga0105241_10040648 3300009174 Bacteria 3511
193 Ga0105241_10299604 3300009174 Bacteria 1379
194 Ga0105242_10008362 3300009176 Bacteria 7951
195 Ga0105242_10052152 3300009176 Bacteria 3337
196 Ga0105242_10127064 3300009176 Bacteria 2195
197 Ga0105242_10583044 3300009176 Bacteria 1077
198 Ga0105248_10495518 3300009177 Bacteria 1377
199 Ga0105237_10000343 3300009545 Bacteria 65610
200 Ga0105237_10004139 3300009545 Bacteria 16896
201 Ga0105237_10004766 3300009545 Bacteria 15594
202 Ga0105237_10025837 3300009545 Bacteria 6004
203 Ga0105237_10164693 3300009545 Bacteria 2216
204 Ga0105238_10033212 3300009551 Bacteria 5252
205 Ga0105249_10003787 3300009553 Bacteria 13066
206 Ga0105249_10006939 3300009553 Bacteria 9879
207 Ga0105249_10023355 3300009553 Bacteria 5548
208 Ga0105249_10084224 3300009553 Bacteria 2961
209 Ga0105249_10090820 3300009553 Bacteria 2856
210 Ga0105239_10000002 3300010375 Bacteria 610298
211 Ga0105239_10004656 3300010375 Bacteria 16312
212 Ga0105239_10019429 3300010375 Bacteria 7501
213 Ga0105239_10085583 3300010375 Bacteria 3475
214 Ga0105239_10132454 3300010375 Bacteria 2774
215 Ga0105239_10155726 3300010375 Bacteria 2551
216 Ga0105239_10200952 3300010375 Bacteria 2233
217 Ga0105239_10594834 3300010375 Bacteria 1262
218 Ga0105239_10935394 3300010375 Bacteria 995
219 Ga0157373_10098865 3300013100 Unclassified 2054
220 Ga0157373_10102884 3300013100 Bacteria 2009
221 Ga0157373_10163762 3300013100 Bacteria 1565
222 Ga0157371_10000216 3300013102 Bacteria 83975
223 Ga0157371_10005073 3300013102 Bacteria 11244
224 Ga0157371_10141729 3300013102 Bacteria 1712
225 Ga0157370_10128454 3300013104 Bacteria 2365
226 Ga0157370_10426213 3300013104 Bacteria 1220
227 Ga0157370_10436639 3300013104 Bacteria 1204
228 Ga0157369_10002019 3300013105 Bacteria 24475
229 Ga0157369_10043863 3300013105 Bacteria 4872
230 Ga0157369_10057751 3300013105 Bacteria 4185
231 Ga0157369_10753551 3300013105 Bacteria 1002
232 Ga0157374_10002137 3300013296 Bacteria 16657
233 Ga0157374_10002733 3300013296 Bacteria 14810
234 Ga0157374_10004306 3300013296 Bacteria 11968
235 Ga0157374_10009140 3300013296 Bacteria 8494
236 Ga0157374_10013712 3300013296 Bacteria 7081
237 Ga0157374_10016600 3300013296 Bacteria 6476
238 Ga0157374_10131821 3300013296 Bacteria 2419
239 Ga0157374_10206835 3300013296 Bacteria 1923
240 Ga0157374_10338678 3300013296 Bacteria 1493
241 Ga0157374_10842208 3300013296 Bacteria 934
242 Ga0157378_10008154 3300013297 Bacteria 9141
243 Ga0157378_10014724 3300013297 Bacteria 6852
244 Ga0157378_10023453 3300013297 Bacteria 5431
245 Ga0157378_10026311 3300013297 Bacteria 5128
246 Ga0157378_10037924 3300013297 Bacteria 4271
247 Ga0157378_10067952 3300013297 Bacteria 3195
248 Ga0157378_10069538 3300013297 Bacteria 3158
249 Ga0157378_10290574 3300013297 Bacteria 1579
250 Ga0157378_10539646 3300013297 Bacteria 1170
251 Ga0163162_10000024 3300013306 Bacteria 188515
252 Ga0163162_10104986 3300013306 Bacteria 2920
253 Ga0163162_10108238 3300013306 Unclassified 2875
254 Ga0163162_10133336 3300013306 Bacteria 2594
255 Ga0163162_10168850 3300013306 Bacteria 2312
256 Ga0163162_10278264 3300013306 Bacteria 1805
257 Ga0157372_10000011 3300013307 Bacteria 277202
258 Ga0157372_10000196 3300013307 Bacteria 66430
259 Ga0157372_10007158 3300013307 Bacteria 11876
260 Ga0157372_10014662 3300013307 Bacteria 8385
261 Ga0157372_10064935 3300013307 Bacteria 4097
262 Ga0157372_10066047 3300013307 Bacteria 4064
263 Ga0157372_10102011 3300013307 Bacteria 3277
264 Ga0157372_10203294 3300013307 Bacteria 2295
265 Ga0157372_10233537 3300013307 Bacteria 2132
266 Ga0157372_10258249 3300013307 Bacteria 2023
267 Ga0157372_10481786 3300013307 Unclassified 1446
268 Ga0157372_10827117 3300013307 Unclassified 1075
269 Ga0157375_10002312 3300013308 Bacteria 16463
270 Ga0157375_10009183 3300013308 Bacteria 8667
271 Ga0157375_10023662 3300013308 Bacteria 5672
272 Ga0157375_10237969 3300013308 Bacteria 1980
273 Ga0163163_10004106 3300014325 Bacteria 12416
274 Ga0163163_10009151 3300014325 Bacteria 8827
275 Ga0163163_10028563 3300014325 Bacteria 5359
276 Ga0163163_10110229 3300014325 Bacteria 2780
277 Ga0163163_10124394 3300014325 Bacteria 2615
278 Ga0163163_10196479 3300014325 Bacteria 2065
279 Ga0163163_10654544 3300014325 Bacteria 1114
280 Ga0157380_10004095 3300014326 Bacteria 10075
281 Ga0157380_10078165 3300014326 Bacteria 2698
282 Ga0157377_10009264 3300014745 Bacteria 4823
283 Ga0157377_10057121 3300014745 Bacteria 2218
284 Ga0157377_10068329 3300014745 Unclassified 2047
285 Ga0157377_10270302 3300014745 Bacteria 1110
286 Ga0157379_10054939 3300014968 Bacteria 3558
287 Ga0157379_10625622 3300014968 Bacteria 1006
288 Ga0157376_10060164 3300014969 Bacteria 3189
289 Ga0157376_10096140 3300014969 Bacteria 2577
290 Ga0157376_10133028 3300014969 Bacteria 2222
291 Ga0157376_10244605 3300014969 Bacteria 1673
292 Ga0213872_10014375 3300021361 Bacteria 3693
293 Ga0207427_100103 3300025231 Bacteria 119618
294 Ga0209437_100024 3300025233 Bacteria 592878
295 Ga0209437_100101 3300025233 Bacteria 226668
296 Ga0209026_1002000 3300025250 Bacteria 8120
297 Ga0209026_1003981 3300025250 Bacteria 4609
298 Ga0209233_1000124 3300025261 Bacteria 226743
299 Ga0209233_1000396 3300025261 Bacteria 36455
300 Ga0209233_1008681 3300025261 Bacteria 3127
301 Ga0209455_1006267 3300025272 Bacteria 3539
302 Ga0207688_10171546 3300025901 Bacteria 1290
303 Ga0207647_10000051 3300025904 Bacteria 87826
304 Ga0207647_10000149 3300025904 Bacteria 55611
305 Ga0207647_10037891 3300025904 Bacteria 3053
306 Ga0207647_10122487 3300025904 Bacteria 1533
307 Ga0207645_10000067 3300025907 Bacteria 75648
308 Ga0207705_10000069 3300025909 Bacteria 133094
309 Ga0207705_10182271 3300025909 Bacteria 1585
310 Ga0207654_10001590 3300025911 Bacteria 11931
311 Ga0207654_10010520 3300025911 Bacteria 4712
312 Ga0207654_10078344 3300025911 Bacteria 1983
313 Ga0207695_10000013 3300025913 Bacteria 821265
314 Ga0207695_10009957 3300025913 Bacteria 11683
315 Ga0207695_10012845 3300025913 Bacteria 10025
316 Ga0207695_10021203 3300025913 Bacteria 7420
317 Ga0207695_10062653 3300025913 Bacteria 3838
318 Ga0207695_10264926 3300025913 Bacteria 1615
319 Ga0207695_10325540 3300025913 Unclassified 1426
320 Ga0207671_10000946 3300025914 Bacteria 36089
321 Ga0207671_10059193 3300025914 Bacteria 2840
322 Ga0207671_10063921 3300025914 Bacteria 2735
323 Ga0207671_10112343 3300025914 Bacteria 2074
324 Ga0207657_10011704 3300025919 Bacteria 8694
325 Ga0207649_10295691 3300025920 Bacteria 1182
326 Ga0207644_10010770 3300025931 Bacteria 6033
327 Ga0207690_10141629 3300025932 Unclassified 1772
328 Ga0207706_10000122 3300025933 Bacteria 83838
329 Ga0207670_10030111 3300025936 Unclassified 3465
330 Ga0207704_10000056 3300025938 Bacteria 78848
331 Ga0207689_10181605 3300025942 Bacteria 1735
332 Ga0207679_10314920 3300025945 Bacteria 1353
333 Ga0207667_10000009 3300025949 Bacteria 603135
334 Ga0207667_10003026 3300025949 Bacteria 20864
335 Ga0207667_10054291 3300025949 Bacteria 4214
336 Ga0207667_10080798 3300025949 Bacteria 3368
337 Ga0207667_10108735 3300025949 Bacteria 2860
338 Ga0207651_10030755 3300025960 Bacteria 3423
339 Ga0207651_10265830 3300025960 Bacteria 1410
340 Ga0207668_10078552 3300025972 Bacteria 2384
341 Ga0207640_10018515 3300025981 Bacteria 4095
342 Ga0207677_10015483 3300026023 Bacteria 4489
343 Ga0207677_10498956 3300026023 Unclassified 1052
344 Ga0207639_10017579 3300026041 Bacteria 5071
345 Ga0207639_10064292 3300026041 Bacteria 2844
346 Ga0207639_10156912 3300026041 Bacteria 1913
347 Ga0207678_10020288 3300026067 Bacteria 5832
348 Ga0207702_10000463 3300026078 Bacteria 45983
349 Ga0207702_10017389 3300026078 Bacteria 5949
350 Ga0207702_10313708 3300026078 Bacteria 1492
351 Ga0207648_10001841 3300026089 Bacteria 23201
352 Ga0207676_10068520 3300026095 Bacteria 2838
353 Ga0207674_10043235 3300026116 Bacteria 4646
354 Ga0207683_10046361 3300026121 Bacteria 3804
355 Ga0207698_10502684 3300026142 Bacteria 1180
356 Ga0268266_10000137 3300028379 Bacteria 140685
357 Ga0268264_10032678 3300028381 Bacteria 4270
358 Ga0307517_10002507 3300028786 Bacteria 29365
359 Ga0307515_10003653 3300028794 Bacteria 32336
360 Ga0307509_10075415 3300031507 Bacteria 3503
361 Ga0307510_10005233 3300033180 Bacteria 15419
362 Ga0373941_0002804 3300035115 Bacteria 3876
363 Ga0395899_0000033 3300037312 Bacteria 306589
364 Ga0395899_0000547 3300037312 Bacteria 40664
365 Ga0395899_0000796 3300037312 Bacteria 30874
366 Ga0395900_0000014 3300037418 Bacteria 386513
367 Ga0395900_0000362 3300037418 Bacteria 65661
368 Ga0395900_0220622 3300037418 Bacteria 1911
369 Ga0395898_0060403 3300037466 Bacteria 3684
370 Ga0395905_0000520 3300037471 Bacteria 52744
371 Ga0395905_0002984 3300037471 Bacteria 18364
372 Ga0395901_0000523 3300038443 Bacteria 44364
373 Ga0395901_0009502 3300038443 Bacteria 9865
374 Ga0395901_0209504 3300038443 Unclassified 2041
375 Ga0436361_0747603 3300039447 Bacteria 15844
376 Ga0439448_0050946 3300042005 Bacteria 1355
377 Ga0466966_0022738 3300044684 Bacteria 4110
378 Ga0466961_0096584 3300044693 Bacteria 1863
379 Ga0453684_0072966 3300044712 Bacteria 4330
380 Ga0453684_0167224 3300044712 Bacteria 2595
381 Ga0466959_0012919 3300045049 Bacteria 6045
382 Ga0495638_0101535 3300046460 Bacteria 1719
383 Ga0495651_0018311 3300046462 Bacteria 5423
384 Ga0495650_0000036 3300046471 Bacteria 400633
385 Ga0495650_0021041 3300046471 Bacteria 3163
386 Ga0495585_0000831 3300046492 Bacteria 26632
387 Ga0495585_0002023 3300046492 Bacteria 15008
388 Ga0495606_0000008 3300046507 Bacteria 321373
389 Ga0495606_0008860 3300046507 Bacteria 8624
390 Ga0495606_0042915 3300046507 Bacteria 3021
391 Ga0495610_0000757 3300046512 Bacteria 30503
392 Ga0495616_0004581 3300046513 Bacteria 8701
393 Ga0495616_0011052 3300046513 Bacteria 5187
394 Ga0495628_0142658 3300046516 Bacteria 1828
395 Ga0495631_0031348 3300046518 Bacteria 2406
396 Ga0495644_0034781 3300046523 Bacteria 1902
397 Ga0495648_0003229 3300046524 Bacteria 14455
398 Ga0495648_0037542 3300046524 Bacteria 3111
399 Ga0495609_0040871 3300046538 Bacteria 2086
400 Ga0495622_0045149 3300046557 Bacteria 2048
401 Ga0495633_0000233 3300046558 Bacteria 67958
402 Ga0495668_0000044 3300046616 Bacteria 227585
403 Ga0495625_0000379 3300046660 Bacteria 67828
404 Ga0495625_0000934 3300046660 Bacteria 39261
405 Ga0495625_0009019 3300046660 Bacteria 8424
406 Ga0495625_0027590 3300046660 Bacteria 4271
407 Ga0495625_0040278 3300046660 Bacteria 3409
408 Ga0495625_0041965 3300046660 Bacteria 3326
409 Ga0495625_0058019 3300046660 Bacteria 2751
410 Ga0495661_0001087 3300046665 Bacteria 23875
411 Ga0495661_0001778 3300046665 Bacteria 17318
412 Ga0495661_0159446 3300046665 Bacteria 1212
413 Ga0495649_0000010 3300046694 Bacteria 430552
414 Ga0495687_002607 3300047443 Bacteria 14171
415 Ga0495686_0000196 3300047472 Bacteria 112875
416 Ga0495686_0003522 3300047472 Bacteria 13510
417 Ga0495686_0033439 3300047472 Bacteria 3320
418 Ga0495614_0011363 3300048089 Bacteria 3919
419 Ga0496111_0219608 3300048914 Bacteria 1412
420 Ga0495678_031103 3300049459 Bacteria 2228
421 nmdc:mga0k408_105_c1 3300050493 Bacteria 39936
422 nmdc:mga0k408_48_c1 3300050493 Bacteria 60474
423 Ga0500635_0000796 3300053080 Bacteria 7818
424 Ga0500635_0004424 3300053080 Bacteria 3622
425 Ga0500647_0058022 3300053091 Bacteria 1862
426 Ga0500608_001013 3300053122 Bacteria 10086
427 Ga0500614_038240 3300053123 Bacteria 1208
428 Ga0500618_000013 3300053125 Bacteria 183026
429 Ga0500618_010896 3300053125 Bacteria 2426
430 Ga0500622_0000515 3300053156 Bacteria 35966

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005614 Ga0068856_100002043 Ga0068856_10000204320 259
2 3300026078 Ga0207702_10000463 Ga0207702_1000046341 259
3 3300009093 Ga0105240_10081521 Ga0105240_100815213 260
4 3300025913 Ga0207695_10062653 Ga0207695_100626533 260
5 3300013297 Ga0157378_10023453 Ga0157378_100234532 262
6 3300005338 Ga0068868_100577010 Ga0068868_1005770101 266
7 3300003322 rootL2_10064540 rootL2_100645402 267
8 3300003323 rootH1_10007146 rootH1_100071462 267
9 3300005329 Ga0070683_100027772 Ga0070683_1000277725 267
10 3300005331 Ga0070670_100148890 Ga0070670_1001488902 267
11 3300005331 Ga0070670_100291723 Ga0070670_1002917232 267
12 3300005334 Ga0068869_100014657 Ga0068869_1000146573 267
13 3300005334 Ga0068869_100034819 Ga0068869_1000348191 267
14 3300005334 Ga0068869_100037163 Ga0068869_1000371632 267
15 3300005334 Ga0068869_100163790 Ga0068869_1001637902 267
16 3300005335 Ga0070666_10005828 Ga0070666_100058285 267
17 3300005338 Ga0068868_100446966 Ga0068868_1004469661 267
18 3300005343 Ga0070687_100301664 Ga0070687_1003016641 267
19 3300005344 Ga0070661_100032797 Ga0070661_1000327972 267
20 3300005344 Ga0070661_100036444 Ga0070661_1000364446 267
21 3300005344 Ga0070661_100059318 Ga0070661_1000593181 267
22 3300005347 Ga0070668_100013444 Ga0070668_1000134441 267
23 3300005347 Ga0070668_100018639 Ga0070668_1000186391 267
24 3300005353 Ga0070669_100011152 Ga0070669_1000111523 267
25 3300005353 Ga0070669_100241812 Ga0070669_1002418122 267
26 3300005353 Ga0070669_100279207 Ga0070669_1002792072 267
27 3300005354 Ga0070675_100027092 Ga0070675_1000270922 267
28 3300005354 Ga0070675_100129801 Ga0070675_1001298012 267
29 3300005354 Ga0070675_100163912 Ga0070675_1001639122 267
30 3300005355 Ga0070671_100042653 Ga0070671_1000426533 267
31 3300005355 Ga0070671_100070978 Ga0070671_1000709782 267
32 3300005355 Ga0070671_100115526 Ga0070671_1001155264 267
33 3300005355 Ga0070671_100134143 Ga0070671_1001341432 267
34 3300005355 Ga0070671_100477213 Ga0070671_1004772132 267
35 3300005356 Ga0070674_100035540 Ga0070674_1000355402 267
36 3300005356 Ga0070674_100155366 Ga0070674_1001553662 267
37 3300005364 Ga0070673_100033961 Ga0070673_1000339611 267
38 3300005364 Ga0070673_100253988 Ga0070673_1002539882 267
39 3300005365 Ga0070688_100025998 Ga0070688_1000259982 267
40 3300005365 Ga0070688_100136408 Ga0070688_1001364081 267
41 3300005366 Ga0070659_100022865 Ga0070659_1000228655 267
42 3300005366 Ga0070659_100152677 Ga0070659_1001526772 267
43 3300005366 Ga0070659_100154148 Ga0070659_1001541482 267
44 3300005367 Ga0070667_100107850 Ga0070667_1001078503 267
45 3300005367 Ga0070667_100202750 Ga0070667_1002027502 267
46 3300005367 Ga0070667_100414141 Ga0070667_1004141411 267
47 3300005456 Ga0070678_100037665 Ga0070678_1000376653 267
48 3300005456 Ga0070678_100419048 Ga0070678_1004190481 267
49 3300005459 Ga0068867_100030961 Ga0068867_1000309614 267
50 3300005459 Ga0068867_100032253 Ga0068867_1000322532 267
51 3300005466 Ga0070685_10029331 Ga0070685_100293314 267
52 3300005466 Ga0070685_10034518 Ga0070685_100345183 267
53 3300005466 Ga0070685_10080412 Ga0070685_100804121 267
54 3300005466 Ga0070685_10282230 Ga0070685_102822301 267
55 3300005468 Ga0070707_100127586 Ga0070707_1001275861 267
56 3300005471 Ga0070698_100005162 Ga0070698_1000051624 267
57 3300005471 Ga0070698_100017592 Ga0070698_1000175921 267
58 3300005518 Ga0070699_100450379 Ga0070699_1004503792 267
59 3300005535 Ga0070684_100001246 Ga0070684_1000012462 267
60 3300005535 Ga0070684_100021442 Ga0070684_1000214423 267
61 3300005535 Ga0070684_100043931 Ga0070684_1000439312 267
62 3300005535 Ga0070684_100369808 Ga0070684_1003698081 267
63 3300005535 Ga0070684_100408023 Ga0070684_1004080231 267
64 3300005539 Ga0068853_100003597 Ga0068853_1000035977 267
65 3300005539 Ga0068853_100101672 Ga0068853_1001016724 267
66 3300005539 Ga0068853_100228572 Ga0068853_1002285721 267
67 3300005543 Ga0070672_100006670 Ga0070672_1000066703 267
68 3300005543 Ga0070672_100076046 Ga0070672_1000760462 267
69 3300005543 Ga0070672_100216980 Ga0070672_1002169802 267
70 3300005544 Ga0070686_100171754 Ga0070686_1001717541 267
71 3300005548 Ga0070665_100015395 Ga0070665_1000153955 267
72 3300005564 Ga0070664_100024865 Ga0070664_1000248654 267
73 3300005564 Ga0070664_100095799 Ga0070664_1000957994 267
74 3300005564 Ga0070664_100100817 Ga0070664_1001008174 267
75 3300005564 Ga0070664_100165885 Ga0070664_1001658852 267
76 3300005564 Ga0070664_100215777 Ga0070664_1002157771 267
77 3300005564 Ga0070664_100649781 Ga0070664_1006497811 267
78 3300005577 Ga0068857_100042492 Ga0068857_1000424926 267
79 3300005577 Ga0068857_100133366 Ga0068857_1001333663 267
80 3300005615 Ga0070702_100079402 Ga0070702_1000794022 267
81 3300005615 Ga0070702_100219636 Ga0070702_1002196361 267
82 3300005615 Ga0070702_100248301 Ga0070702_1002483012 267
83 3300005616 Ga0068852_100003450 Ga0068852_1000034508 267
84 3300005616 Ga0068852_100089249 Ga0068852_1000892492 267
85 3300005616 Ga0068852_100205939 Ga0068852_1002059392 267
86 3300005617 Ga0068859_100002370 Ga0068859_10000237019 267
87 3300005617 Ga0068859_100002964 Ga0068859_10000296413 267
88 3300005617 Ga0068859_100085061 Ga0068859_1000850612 267
89 3300005617 Ga0068859_100728052 Ga0068859_1007280522 267
90 3300005618 Ga0068864_100022551 Ga0068864_1000225513 267
91 3300005618 Ga0068864_100064246 Ga0068864_1000642461 267
92 3300005618 Ga0068864_100675811 Ga0068864_1006758111 267
93 3300005718 Ga0068866_10010101 Ga0068866_100101013 267
94 3300005718 Ga0068866_10197524 Ga0068866_101975241 267
95 3300005719 Ga0068861_100037917 Ga0068861_1000379171 267
96 3300005719 Ga0068861_100041761 Ga0068861_1000417613 267
97 3300005834 Ga0068851_10097191 Ga0068851_100971912 267
98 3300005834 Ga0068851_10130304 Ga0068851_101303042 267
99 3300005834 Ga0068851_10192434 Ga0068851_101924341 267
100 3300005841 Ga0068863_100031617 Ga0068863_1000316172 267
101 3300005841 Ga0068863_100237643 Ga0068863_1002376432 267
102 3300005842 Ga0068858_100593025 Ga0068858_1005930252 267
103 3300005843 Ga0068860_100036334 Ga0068860_1000363342 267
104 3300005843 Ga0068860_100060105 Ga0068860_1000601054 267
105 3300005843 Ga0068860_100498186 Ga0068860_1004981861 267
106 3300005844 Ga0068862_100268440 Ga0068862_1002684402 267
107 3300005844 Ga0068862_100293507 Ga0068862_1002935071 267
108 3300005844 Ga0068862_100321941 Ga0068862_1003219412 267
109 3300006163 Ga0070715_10027236 Ga0070715_100272363 267
110 3300006163 Ga0070715_10041655 Ga0070715_100416552 267
111 3300006237 Ga0097621_100016366 Ga0097621_1000163664 267
112 3300006237 Ga0097621_100039501 Ga0097621_1000395012 267
113 3300006237 Ga0097621_100312096 Ga0097621_1003120962 267
114 3300006237 Ga0097621_100532111 Ga0097621_1005321111 267
115 3300006358 Ga0068871_100004309 Ga0068871_1000043098 267
116 3300006358 Ga0068871_100208052 Ga0068871_1002080523 267
117 3300006358 Ga0068871_100374358 Ga0068871_1003743582 267
118 3300006844 Ga0075428_100006320 Ga0075428_1000063204 267
119 3300006846 Ga0075430_100504338 Ga0075430_1005043382 267
120 3300006871 Ga0075434_100229003 Ga0075434_1002290033 267
121 3300006880 Ga0075429_100018833 Ga0075429_1000188337 267
122 3300006880 Ga0075429_100319108 Ga0075429_1003191081 267
123 3300006881 Ga0068865_100146348 Ga0068865_1001463482 267
124 3300006881 Ga0068865_100191055 Ga0068865_1001910553 267
125 3300006931 Ga0097620_100002371 Ga0097620_1000023712 267
126 3300006931 Ga0097620_100002964 Ga0097620_1000029643 267
127 3300006931 Ga0097620_100085059 Ga0097620_1000850592 267
128 3300006931 Ga0097620_100728046 Ga0097620_1007280463 267
129 3300009094 Ga0111539_10004074 Ga0111539_1000407416 267
130 3300009094 Ga0111539_10136836 Ga0111539_101368365 267
131 3300009094 Ga0111539_10639039 Ga0111539_106390392 267
132 3300009098 Ga0105245_10319963 Ga0105245_103199632 267
133 3300009148 Ga0105243_10371122 Ga0105243_103711222 267
134 3300009176 Ga0105242_10052152 Ga0105242_100521523 267
135 3300009176 Ga0105242_10127064 Ga0105242_101270643 267
136 3300009176 Ga0105242_10583044 Ga0105242_105830441 267
137 3300009177 Ga0105248_10495518 Ga0105248_104955182 267
138 3300009553 Ga0105249_10003787 Ga0105249_100037873 267
139 3300009553 Ga0105249_10006939 Ga0105249_100069398 267
140 3300009553 Ga0105249_10023355 Ga0105249_100233551 267
141 3300009553 Ga0105249_10084224 Ga0105249_100842242 267
142 3300009553 Ga0105249_10090820 Ga0105249_100908202 267
143 3300013100 Ga0157373_10163762 Ga0157373_101637622 267
144 3300013102 Ga0157371_10141729 Ga0157371_101417292 267
145 3300013104 Ga0157370_10128454 Ga0157370_101284541 267
146 3300013104 Ga0157370_10436639 Ga0157370_104366392 267
147 3300013105 Ga0157369_10043863 Ga0157369_100438634 267
148 3300013296 Ga0157374_10002733 Ga0157374_100027332 267
149 3300013296 Ga0157374_10013712 Ga0157374_100137123 267
150 3300013296 Ga0157374_10016600 Ga0157374_100166004 267
151 3300013296 Ga0157374_10131821 Ga0157374_101318212 267
152 3300013296 Ga0157374_10206835 Ga0157374_102068351 267
153 3300013296 Ga0157374_10338678 Ga0157374_103386782 267
154 3300013297 Ga0157378_10008154 Ga0157378_100081543 267
155 3300013297 Ga0157378_10026311 Ga0157378_100263116 267
156 3300013297 Ga0157378_10037924 Ga0157378_100379242 267
157 3300013297 Ga0157378_10067952 Ga0157378_100679522 267
158 3300013297 Ga0157378_10290574 Ga0157378_102905743 267
159 3300013297 Ga0157378_10539646 Ga0157378_105396461 267
160 3300013306 Ga0163162_10108238 Ga0163162_101082382 267
161 3300013306 Ga0163162_10133336 Ga0163162_101333364 267
162 3300013306 Ga0163162_10168850 Ga0163162_101688503 267
163 3300013306 Ga0163162_10278264 Ga0163162_102782643 267
164 3300013307 Ga0157372_10014662 Ga0157372_100146621 267
165 3300013307 Ga0157372_10064935 Ga0157372_100649357 267
166 3300013307 Ga0157372_10102011 Ga0157372_101020113 267
167 3300013307 Ga0157372_10203294 Ga0157372_102032942 267
168 3300013307 Ga0157372_10233537 Ga0157372_102335373 267
169 3300013307 Ga0157372_10481786 Ga0157372_104817862 267
170 3300013308 Ga0157375_10002312 Ga0157375_1000231214 267
171 3300013308 Ga0157375_10009183 Ga0157375_100091836 267
172 3300013308 Ga0157375_10237969 Ga0157375_102379692 267
173 3300014325 Ga0163163_10004106 Ga0163163_100041065 267
174 3300014325 Ga0163163_10009151 Ga0163163_100091519 267
175 3300014325 Ga0163163_10028563 Ga0163163_100285639 267
176 3300014325 Ga0163163_10110229 Ga0163163_101102293 267
177 3300014325 Ga0163163_10196479 Ga0163163_101964793 267
178 3300014325 Ga0163163_10654544 Ga0163163_106545442 267
179 3300014326 Ga0157380_10004095 Ga0157380_100040952 267
180 3300014326 Ga0157380_10078165 Ga0157380_100781652 267
181 3300014745 Ga0157377_10009264 Ga0157377_100092645 267
182 3300014745 Ga0157377_10068329 Ga0157377_100683293 267
183 3300014745 Ga0157377_10270302 Ga0157377_102703021 267
184 3300014968 Ga0157379_10054939 Ga0157379_100549393 267
185 3300014968 Ga0157379_10625622 Ga0157379_106256221 267
186 3300014969 Ga0157376_10060164 Ga0157376_100601643 267
187 3300014969 Ga0157376_10096140 Ga0157376_100961401 267
188 3300014969 Ga0157376_10244605 Ga0157376_102446052 267
189 3300025901 Ga0207688_10171546 Ga0207688_101715462 267
190 3300025904 Ga0207647_10122487 Ga0207647_101224873 267
191 3300025920 Ga0207649_10295691 Ga0207649_102956911 267
192 3300025932 Ga0207690_10141629 Ga0207690_101416292 267
193 3300025936 Ga0207670_10030111 Ga0207670_100301115 267
194 3300025942 Ga0207689_10181605 Ga0207689_101816052 267
195 3300025945 Ga0207679_10314920 Ga0207679_103149202 267
196 3300025960 Ga0207651_10265830 Ga0207651_102658302 267
197 3300025972 Ga0207668_10078552 Ga0207668_100785523 267
198 3300026095 Ga0207676_10068520 Ga0207676_100685203 267
199 3300026116 Ga0207674_10043235 Ga0207674_100432357 267
200 3300026142 Ga0207698_10502684 Ga0207698_105026841 267
201 3300028381 Ga0268264_10032678 Ga0268264_100326783 267
202 3300044712 Ga0453684_0167224 Ga0453684_0167224_1754_2578 267
203 3300048914 Ga0496111_0219608 Ga0496111_0219608_234_1190 267
204 iso_pu_bacteria 2599185184 2599480993 267
205 iso_pu_bacteria 2852623160 2852623490 267
206 iso_pu_bacteria 2884933994 2884937610 267
207 iso_pu_bacteria 2919437846 2919438405 267
208 iso_pu_bacteria 2928078545 2928080904 267
209 iso_pu_bacteria 2928147474 2928150188 267
210 iso_pu_bacteria 2932082852 2932088245 267
211 iso_pu_bacteria 2977232053 2977236771 267
212 3300003320 rootH2_10289888 rootH2_102898881 268
213 3300003323 rootH1_10066422 rootH1_1006642210 268
214 3300044712 Ga0453684_0072966 Ga0453684_0072966_1018_1824 268
215 3300045049 Ga0466959_0012919 Ga0466959_0012919_4845_5657 268
216 3300001904 JGI24736J21556_1003945 JGI24736J21556_10039453 271
217 3300001989 JGI24739J22299_10024429 JGI24739J22299_100244292 271
218 3300001990 JGI24737J22298_10002553 JGI24737J22298_100025535 271
219 3300002067 JGI24735J21928_10000028 JGI24735J21928_1000002869 271
220 3300002737 JGI25162J39368_1000614 JGI25162J39368_100061422 271
221 3300002772 JGI25164J39214_1002858 JGI25164J39214_10028582 271
222 3300003214 JGI25165J46597_1000634 JGI25165J46597_100063428 271
223 3300003316 rootH1_10073390 rootH1_100733908 271
224 3300003320 rootH2_10016199 rootH2_1001619910 271
225 3300003320 rootH2_10050013 rootH2_100500133 271
226 3300003320 rootH2_10127535 rootH2_101275353 271
227 3300003320 rootH2_10138767 rootH2_101387671 271
228 3300003323 rootH1_10050118 rootH1_1005011810 271
229 3300003323 rootH1_10067818 rootH1_100678189 271
230 3300003323 rootH1_10123717 rootH1_101237173 271
231 3300005288 Ga0065714_10084393 Ga0065714_100843932 271
232 3300005327 Ga0070658_10000019 Ga0070658_1000001911 271
233 3300005327 Ga0070658_10172383 Ga0070658_101723832 271
234 3300005328 Ga0070676_10000897 Ga0070676_100008978 271
235 3300005338 Ga0068868_100003994 Ga0068868_1000039944 271
236 3300005338 Ga0068868_100012600 Ga0068868_1000126004 271
237 3300005339 Ga0070660_100071770 Ga0070660_1000717703 271
238 3300005339 Ga0070660_100134036 Ga0070660_1001340361 271
239 3300005355 Ga0070671_100003862 Ga0070671_1000038626 271
240 3300005364 Ga0070673_100020464 Ga0070673_1000204643 271
241 3300005366 Ga0070659_100205012 Ga0070659_1002050122 271
242 3300005455 Ga0070663_100018994 Ga0070663_1000189943 271
243 3300005456 Ga0070678_100001108 Ga0070678_1000011084 271
244 3300005457 Ga0070662_100009456 Ga0070662_1000094565 271
245 3300005459 Ga0068867_100000136 Ga0068867_10000013613 271
246 3300005539 Ga0068853_100103039 Ga0068853_1001030394 271
247 3300005539 Ga0068853_100155522 Ga0068853_1001555222 271
248 3300005539 Ga0068853_100309571 Ga0068853_1003095711 271
249 3300005548 Ga0070665_100000003 Ga0070665_10000000341 271
250 3300005563 Ga0068855_100000073 Ga0068855_100000073130 271
251 3300005563 Ga0068855_100000388 Ga0068855_10000038811 271
252 3300005563 Ga0068855_100015168 Ga0068855_1000151689 271
253 3300005563 Ga0068855_100021669 Ga0068855_1000216695 271
254 3300005563 Ga0068855_100161093 Ga0068855_1001610932 271
255 3300005577 Ga0068857_100018337 Ga0068857_1000183375 271
256 3300005578 Ga0068854_100004069 Ga0068854_1000040698 271
257 3300005614 Ga0068856_100006719 Ga0068856_1000067199 271
258 3300005614 Ga0068856_100043736 Ga0068856_1000437362 271
259 3300005614 Ga0068856_100138781 Ga0068856_1001387812 271
260 3300005616 Ga0068852_100001701 Ga0068852_1000017014 271
261 3300006195 Ga0075366_10000493 Ga0075366_100004939 271
262 3300006195 Ga0075366_10012821 Ga0075366_100128212 271
263 3300006237 Ga0097621_100000178 Ga0097621_10000017840 271
264 3300006358 Ga0068871_100000652 Ga0068871_1000006524 271
265 3300006881 Ga0068865_100000067 Ga0068865_10000006728 271
266 3300009093 Ga0105240_10000722 Ga0105240_1000072254 271
267 3300009093 Ga0105240_10024330 Ga0105240_100243306 271
268 3300009093 Ga0105240_10025178 Ga0105240_1002517810 271
269 3300009093 Ga0105240_10113659 Ga0105240_101136592 271
270 3300009093 Ga0105240_10170806 Ga0105240_101708064 271
271 3300009093 Ga0105240_10293904 Ga0105240_102939042 271
272 3300009093 Ga0105240_10351435 Ga0105240_103514351 271
273 3300009174 Ga0105241_10002510 Ga0105241_100025102 271
274 3300009174 Ga0105241_10014580 Ga0105241_100145803 271
275 3300009174 Ga0105241_10040648 Ga0105241_100406482 271
276 3300009174 Ga0105241_10299604 Ga0105241_102996042 271
277 3300009176 Ga0105242_10008362 Ga0105242_100083624 271
278 3300009545 Ga0105237_10000343 Ga0105237_1000034325 271
279 3300009545 Ga0105237_10004139 Ga0105237_100041398 271
280 3300009545 Ga0105237_10004766 Ga0105237_1000476614 271
281 3300009545 Ga0105237_10025837 Ga0105237_100258376 271
282 3300009545 Ga0105237_10164693 Ga0105237_101646932 271
283 3300009551 Ga0105238_10033212 Ga0105238_100332122 271
284 3300010375 Ga0105239_10000002 Ga0105239_10000002355 271
285 3300010375 Ga0105239_10004656 Ga0105239_1000465614 271
286 3300010375 Ga0105239_10019429 Ga0105239_100194294 271
287 3300010375 Ga0105239_10085583 Ga0105239_100855833 271
288 3300010375 Ga0105239_10132454 Ga0105239_101324542 271
289 3300010375 Ga0105239_10155726 Ga0105239_101557262 271
290 3300010375 Ga0105239_10200952 Ga0105239_102009523 271
291 3300010375 Ga0105239_10594834 Ga0105239_105948342 271
292 3300010375 Ga0105239_10935394 Ga0105239_109353941 271
293 3300013100 Ga0157373_10098865 Ga0157373_100988652 271
294 3300013100 Ga0157373_10102884 Ga0157373_101028842 271
295 3300013102 Ga0157371_10000216 Ga0157371_1000021676 271
296 3300013102 Ga0157371_10005073 Ga0157371_100050738 271
297 3300013104 Ga0157370_10426213 Ga0157370_104262132 271
298 3300013105 Ga0157369_10002019 Ga0157369_1000201916 271
299 3300013105 Ga0157369_10057751 Ga0157369_100577515 271
300 3300013105 Ga0157369_10753551 Ga0157369_107535511 271
301 3300013296 Ga0157374_10002137 Ga0157374_100021372 271
302 3300013296 Ga0157374_10004306 Ga0157374_100043062 271
303 3300013296 Ga0157374_10009140 Ga0157374_100091405 271
304 3300013296 Ga0157374_10842208 Ga0157374_108422081 271
305 3300013297 Ga0157378_10014724 Ga0157378_100147244 271
306 3300013297 Ga0157378_10069538 Ga0157378_100695382 271
307 3300013306 Ga0163162_10000024 Ga0163162_1000002416 271
308 3300013306 Ga0163162_10104986 Ga0163162_101049862 271
309 3300013307 Ga0157372_10000011 Ga0157372_1000001192 271
310 3300013307 Ga0157372_10000196 Ga0157372_1000019634 271
311 3300013307 Ga0157372_10007158 Ga0157372_100071589 271
312 3300013307 Ga0157372_10066047 Ga0157372_100660474 271
313 3300013307 Ga0157372_10258249 Ga0157372_102582493 271
314 3300013307 Ga0157372_10827117 Ga0157372_108271172 271
315 3300013308 Ga0157375_10023662 Ga0157375_100236622 271
316 3300014325 Ga0163163_10124394 Ga0163163_101243942 271
317 3300014745 Ga0157377_10057121 Ga0157377_100571212 271
318 3300014969 Ga0157376_10133028 Ga0157376_101330282 271
319 3300021361 Ga0213872_10014375 Ga0213872_100143752 271
320 3300025231 Ga0207427_100103 Ga0207427_100103112 271
321 3300025233 Ga0209437_100024 Ga0209437_10002455 271
322 3300025233 Ga0209437_100101 Ga0209437_100101133 271
323 3300025250 Ga0209026_1002000 Ga0209026_10020005 271
324 3300025250 Ga0209026_1003981 Ga0209026_10039812 271
325 3300025261 Ga0209233_1000124 Ga0209233_1000124104 271
326 3300025261 Ga0209233_1000396 Ga0209233_100039610 271
327 3300025261 Ga0209233_1008681 Ga0209233_10086814 271
328 3300025272 Ga0209455_1006267 Ga0209455_10062673 271
329 3300025904 Ga0207647_10000051 Ga0207647_1000005180 271
330 3300025904 Ga0207647_10000149 Ga0207647_1000014937 271
331 3300025904 Ga0207647_10037891 Ga0207647_100378914 271
332 3300025907 Ga0207645_10000067 Ga0207645_1000006735 271
333 3300025909 Ga0207705_10000069 Ga0207705_1000006911 271
334 3300025909 Ga0207705_10182271 Ga0207705_101822712 271
335 3300025911 Ga0207654_10001590 Ga0207654_1000159014 271
336 3300025911 Ga0207654_10010520 Ga0207654_100105205 271
337 3300025911 Ga0207654_10078344 Ga0207654_100783442 271
338 3300025913 Ga0207695_10000013 Ga0207695_10000013110 271
339 3300025913 Ga0207695_10009957 Ga0207695_1000995710 271
340 3300025913 Ga0207695_10012845 Ga0207695_100128454 271
341 3300025913 Ga0207695_10021203 Ga0207695_100212032 271
342 3300025913 Ga0207695_10264926 Ga0207695_102649262 271
343 3300025913 Ga0207695_10325540 Ga0207695_103255402 271
344 3300025914 Ga0207671_10000946 Ga0207671_100009465 271
345 3300025914 Ga0207671_10059193 Ga0207671_100591933 271
346 3300025914 Ga0207671_10063921 Ga0207671_100639212 271
347 3300025914 Ga0207671_10112343 Ga0207671_101123432 271
348 3300025919 Ga0207657_10011704 Ga0207657_100117049 271
349 3300025931 Ga0207644_10010770 Ga0207644_100107702 271
350 3300025933 Ga0207706_10000122 Ga0207706_100001222 271
351 3300025938 Ga0207704_10000056 Ga0207704_1000005640 271
352 3300025949 Ga0207667_10000009 Ga0207667_10000009268 271
353 3300025949 Ga0207667_10003026 Ga0207667_1000302614 271
354 3300025949 Ga0207667_10054291 Ga0207667_100542913 271
355 3300025949 Ga0207667_10080798 Ga0207667_100807984 271
356 3300025949 Ga0207667_10108735 Ga0207667_101087353 271
357 3300025960 Ga0207651_10030755 Ga0207651_100307554 271
358 3300025981 Ga0207640_10018515 Ga0207640_100185154 271
359 3300026023 Ga0207677_10015483 Ga0207677_100154834 271
360 3300026023 Ga0207677_10498956 Ga0207677_104989562 271
361 3300026041 Ga0207639_10017579 Ga0207639_100175791 271
362 3300026041 Ga0207639_10064292 Ga0207639_100642922 271
363 3300026041 Ga0207639_10156912 Ga0207639_101569122 271
364 3300026067 Ga0207678_10020288 Ga0207678_100202884 271
365 3300026078 Ga0207702_10017389 Ga0207702_100173894 271
366 3300026078 Ga0207702_10313708 Ga0207702_103137082 271
367 3300026089 Ga0207648_10001841 Ga0207648_1000184112 271
368 3300026121 Ga0207683_10046361 Ga0207683_100463614 271
369 3300028379 Ga0268266_10000137 Ga0268266_1000013739 271
370 3300028786 Ga0307517_10002507 Ga0307517_1000250712 271
371 3300028794 Ga0307515_10003653 Ga0307515_1000365317 271
372 3300031507 Ga0307509_10075415 Ga0307509_100754154 271
373 3300033180 Ga0307510_10005233 Ga0307510_100052336 271
374 3300035115 Ga0373941_0002804 Ga0373941_0002804_291_1106 271
375 3300037312 Ga0395899_0000033 Ga0395899_0000033_210581_211396 271
376 3300037312 Ga0395899_0000547 Ga0395899_0000547_20856_21671 271
377 3300037312 Ga0395899_0000796 Ga0395899_0000796_22268_23083 271
378 3300037418 Ga0395900_0000014 Ga0395900_0000014_363986_364801 271
379 3300037418 Ga0395900_0000362 Ga0395900_0000362_45623_46441 271
380 3300037418 Ga0395900_0220622 Ga0395900_0220622_923_1738 271
381 3300037466 Ga0395898_0060403 Ga0395898_0060403_2332_3147 271
382 3300037471 Ga0395905_0000520 Ga0395905_0000520_38286_39101 271
383 3300037471 Ga0395905_0002984 Ga0395905_0002984_12823_13638 271
384 3300038443 Ga0395901_0000523 Ga0395901_0000523_35017_35832 271
385 3300038443 Ga0395901_0009502 Ga0395901_0009502_192_1007 271
386 3300038443 Ga0395901_0209504 Ga0395901_0209504_883_1698 271
387 3300039447 Ga0436361_0747603 Ga0436361_0747603_1204_2019 271
388 3300042005 Ga0439448_0050946 Ga0439448_0050946_34_849 271
389 3300044684 Ga0466966_0022738 Ga0466966_0022738_361_1176 271
390 3300044693 Ga0466961_0096584 Ga0466961_0096584_596_1411 271
391 3300046460 Ga0495638_0101535 Ga0495638_0101535_88_903 271
392 3300046462 Ga0495651_0018311 Ga0495651_0018311_967_1782 271
393 3300046471 Ga0495650_0000036 Ga0495650_0000036_354266_355081 271
394 3300046471 Ga0495650_0021041 Ga0495650_0021041_1697_2512 271
395 3300046492 Ga0495585_0000831 Ga0495585_0000831_24221_25036 271
396 3300046492 Ga0495585_0002023 Ga0495585_0002023_1510_2325 271
397 3300046507 Ga0495606_0000008 Ga0495606_0000008_11019_11834 271
398 3300046507 Ga0495606_0008860 Ga0495606_0008860_16_831 271
399 3300046507 Ga0495606_0042915 Ga0495606_0042915_233_1048 271
400 3300046512 Ga0495610_0000757 Ga0495610_0000757_10193_11008 271
401 3300046513 Ga0495616_0004581 Ga0495616_0004581_4966_5781 271
402 3300046513 Ga0495616_0011052 Ga0495616_0011052_3304_4119 271
403 3300046516 Ga0495628_0142658 Ga0495628_0142658_650_1465 271
404 3300046518 Ga0495631_0031348 Ga0495631_0031348_24_839 271
405 3300046523 Ga0495644_0034781 Ga0495644_0034781_134_949 271
406 3300046524 Ga0495648_0003229 Ga0495648_0003229_9933_10748 271
407 3300046524 Ga0495648_0037542 Ga0495648_0037542_1730_2545 271
408 3300046538 Ga0495609_0040871 Ga0495609_0040871_1061_1876 271
409 3300046557 Ga0495622_0045149 Ga0495622_0045149_1076_1891 271
410 3300046558 Ga0495633_0000233 Ga0495633_0000233_10283_11098 271
411 3300046616 Ga0495668_0000044 Ga0495668_0000044_208145_208960 271
412 3300046660 Ga0495625_0000379 Ga0495625_0000379_48021_48836 271
413 3300046660 Ga0495625_0000934 Ga0495625_0000934_7691_8506 271
414 3300046660 Ga0495625_0009019 Ga0495625_0009019_6264_7079 271
415 3300046660 Ga0495625_0027590 Ga0495625_0027590_2525_3340 271
416 3300046660 Ga0495625_0040278 Ga0495625_0040278_1636_2451 271
417 3300046660 Ga0495625_0041965 Ga0495625_0041965_195_1010 271
418 3300046660 Ga0495625_0058019 Ga0495625_0058019_1357_2172 271
419 3300046665 Ga0495661_0001087 Ga0495661_0001087_13949_14764 271
420 3300046665 Ga0495661_0001778 Ga0495661_0001778_8307_9122 271
421 3300046665 Ga0495661_0159446 Ga0495661_0159446_223_1038 271
422 3300046694 Ga0495649_0000010 Ga0495649_0000010_410736_411551 271
423 3300047443 Ga0495687_002607 Ga0495687_002607_12261_13076 271
424 3300047472 Ga0495686_0000196 Ga0495686_0000196_44592_45407 271
425 3300047472 Ga0495686_0003522 Ga0495686_0003522_3763_4578 271
426 3300047472 Ga0495686_0033439 Ga0495686_0033439_2166_2981 271
427 3300048089 Ga0495614_0011363 Ga0495614_0011363_2406_3221 271
428 3300049459 Ga0495678_031103 Ga0495678_031103_722_1537 271
429 3300050493 nmdc:mga0k408_105_c1 nmdc:mga0k408_105_c1_18895_19710 271
430 3300050493 nmdc:mga0k408_48_c1 nmdc:mga0k408_48_c1_53074_53889 271
431 3300053080 Ga0500635_0000796 Ga0500635_0000796_2999_3814 271
432 3300053080 Ga0500635_0004424 Ga0500635_0004424_494_1309 271
433 3300053091 Ga0500647_0058022 Ga0500647_0058022_841_1656 271
434 3300053122 Ga0500608_001013 Ga0500608_001013_1775_2590 271
435 3300053123 Ga0500614_038240 Ga0500614_038240_313_1128 271
436 3300053125 Ga0500618_000013 Ga0500618_000013_165030_165845 271
437 3300053125 Ga0500618_010896 Ga0500618_010896_1560_2375 271
438 3300053156 Ga0500622_0000515 Ga0500622_0000515_6552_7367 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

17

211

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

23

250

0.92

PF08659

KR

KR domain

17

196

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4trr-assembly1.cif.gz_D crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 0.9579 3 187
2et6-assembly1.cif.gz_A (3r)-hydroxyacyl-coa dehydrogenase domain of candida tropicalis peroxisomal multifunctional enzyme type 2 0.9566 2 184
4trr-assembly1.cif.gz_C crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315 0.9563 2 187
6zzo-assembly2.cif.gz_C crystal structure of (r)-3-hydroxybutyrate dehydrogenase from psychrobacter arcticus complexed with nad+ and acetoacetate 0.9539 2 191
5g4k-assembly1.cif.gz_A-2 phloroglucinol reductase from clostridium sp. apo-form 0.9519 2 187
ID Description Score Start End Superfamily
af_A0A0R0IEI4_1_176_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9603 51 185 3.40.50.720
af_Q99J47_40_321_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9602 3 260 3.40.50.720
3lf2A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9583 7 187 3.40.50.720
af_O16881_32_305_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9567 5 194 3.40.50.720
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9563 6 56 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q6E8B1-F1-model_v4 Short chain dehydrogenase 0.9905 3 271 GO:0016020
GO:0016491
AF-A0A1Q6E8B1-F1-model_v4 Short chain dehydrogenase 0.976 3 271 GO:0016020
GO:0016491
AF-A0A1D7UTX8-F1-model_v4 Short-chain dehydrogenase 0.9736 1 265 GO:0016020
GO:0016491
AF-A0A354J2B0-F1-model_v4 NAD(P)-dependent oxidoreductase 0.9708 2 123 GO:0006633
GO:0016616
GO:0048038
AF-A0A2D4QZQ0-F1-model_v4 Short-chain dehydrogenase 0.9702 3 92 GO:0016491

Feature Viewer

pLDDT pTM Quality
91.59 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map