F443949
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 438 | 207 | 437 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300005563|Ga0068855_100051395|Ga0068855_1000513953 |
| Length | 353 |
| Sequence | MRYPPSPYLSAKVFELNTLCLDLVLRSALYFLSGWGVSGTRVCQVRRSCFCVLLLGFTLVGCAPPRSSRIVIGAKNFTEQVVLGELLSQEIEATTGERVDRRFYLAGSYICNQALVSGRIDGYVEYTGTALTAILKQPLPPVGQRDAATVFRRVRELYESRYGIRVGDGLGFEDTFAMVVRGEDARRLGIRTISDAVRVSEPTSQSRDMGRPQMSWRLGVGYEFEERPDGLRGLEATYGLRFREAPRVMDLGLLYRALAAGQVDMVAGNSTDSPIRAMGFVVLQDDRHYFPPYEAVPLVREDSIRRHPGIAAAMERLAGKVSAEDVREMNYAVDSEHKDVAEVVREFRKRKGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 29 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 34 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 38 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 45 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 69 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 107 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 108 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 109 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 110 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 111 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 112 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 113 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 114 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 116 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 117 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 121 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 122 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 123 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 124 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 125 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 181 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 182 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 183 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 184 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 186 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 187 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 188 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 189 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 193 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 194 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 203 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 206 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 207 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0 |
| Isolates | 0.23 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.14 |
| Nodule | 0 |
| Rhizoplane | 2.74 |
| Rhizosphere | 93.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.28 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_7351479 | 2162886011 | Unclassified | 1057 |
| 2 | rootH1_10152381 | 3300003316 | Bacteria | 2252 |
| 3 | rootH2_10309358 | 3300003320 | Unclassified | 1241 |
| 4 | rootL2_10222464 | 3300003322 | Bacteria | 3413 |
| 5 | rootH1_10352155 | 3300003323 | Bacteria | 2280 |
| 6 | Ga0065712_10097801 | 3300005290 | Unclassified | 2139 |
| 7 | Ga0070658_10000010 | 3300005327 | Bacteria | 297212 |
| 8 | Ga0070658_10050708 | 3300005327 | Bacteria | 3364 |
| 9 | Ga0070658_10209609 | 3300005327 | Bacteria | 1646 |
| 10 | Ga0070683_100001264 | 3300005329 | Bacteria | 19242 |
| 11 | Ga0070683_100011583 | 3300005329 | Bacteria | 7631 |
| 12 | Ga0070683_100034144 | 3300005329 | Bacteria | 4645 |
| 13 | Ga0070683_100106475 | 3300005329 | Bacteria | 2644 |
| 14 | Ga0070670_100001274 | 3300005331 | Bacteria | 20087 |
| 15 | Ga0068869_100001599 | 3300005334 | Bacteria | 13473 |
| 16 | Ga0068869_100131161 | 3300005334 | Bacteria | 1926 |
| 17 | Ga0070666_10061935 | 3300005335 | Bacteria | 2534 |
| 18 | Ga0068868_100000384 | 3300005338 | Bacteria | 30189 |
| 19 | Ga0068868_100152215 | 3300005338 | Bacteria | 1905 |
| 20 | Ga0070660_100038722 | 3300005339 | Bacteria | 3620 |
| 21 | Ga0070660_100212349 | 3300005339 | Bacteria | 1571 |
| 22 | Ga0070661_100005501 | 3300005344 | Bacteria | 8738 |
| 23 | Ga0070661_100097755 | 3300005344 | Bacteria | 2180 |
| 24 | Ga0070668_100047969 | 3300005347 | Bacteria | 3284 |
| 25 | Ga0070669_100508596 | 3300005353 | Unclassified | 1000 |
| 26 | Ga0070671_100002611 | 3300005355 | Bacteria | 13953 |
| 27 | Ga0070659_100077667 | 3300005366 | Bacteria | 2648 |
| 28 | Ga0070667_100002702 | 3300005367 | Bacteria | 15356 |
| 29 | Ga0070667_100156462 | 3300005367 | Bacteria | 2005 |
| 30 | Ga0070714_100115294 | 3300005435 | Bacteria | 2384 |
| 31 | Ga0070714_100614345 | 3300005435 | Bacteria | 1045 |
| 32 | Ga0070713_100011389 | 3300005436 | Bacteria | 6477 |
| 33 | Ga0070663_100080998 | 3300005455 | Bacteria | 2386 |
| 34 | Ga0070663_100216075 | 3300005455 | Bacteria | 1503 |
| 35 | Ga0070678_100206555 | 3300005456 | Bacteria | 1624 |
| 36 | Ga0070681_10020502 | 3300005458 | Bacteria | 6625 |
| 37 | Ga0070679_100010253 | 3300005530 | Bacteria | 8883 |
| 38 | Ga0070679_100454171 | 3300005530 | Bacteria | 1226 |
| 39 | Ga0070684_100000393 | 3300005535 | Bacteria | 30209 |
| 40 | Ga0070684_100000769 | 3300005535 | Bacteria | 22213 |
| 41 | Ga0070684_100265675 | 3300005535 | Bacteria | 1570 |
| 42 | Ga0070684_100299272 | 3300005535 | Bacteria | 1476 |
| 43 | Ga0068853_100008997 | 3300005539 | Bacteria | 8044 |
| 44 | Ga0068853_100133502 | 3300005539 | Unclassified | 2224 |
| 45 | Ga0070672_100229157 | 3300005543 | Bacteria | 1560 |
| 46 | Ga0070665_100002508 | 3300005548 | Bacteria | 20184 |
| 47 | Ga0070665_100081388 | 3300005548 | Bacteria | 3244 |
| 48 | Ga0070665_100192455 | 3300005548 | Bacteria | 2040 |
| 49 | Ga0070665_100207493 | 3300005548 | Bacteria | 1960 |
| 50 | Ga0068855_100000966 | 3300005563 | Bacteria | 35784 |
| 51 | Ga0068855_100001596 | 3300005563 | Bacteria | 28475 |
| 52 | Ga0068855_100042079 | 3300005563 | Bacteria | 5413 |
| 53 | Ga0068855_100051395 | 3300005563 | Bacteria | 4855 |
| 54 | Ga0068855_100075410 | 3300005563 | Bacteria | 3916 |
| 55 | Ga0068855_100092126 | 3300005563 | Bacteria | 3495 |
| 56 | Ga0068855_100186546 | 3300005563 | Bacteria | 2342 |
| 57 | Ga0068855_100211757 | 3300005563 | Bacteria | 2177 |
| 58 | Ga0068855_100442403 | 3300005563 | Bacteria | 1419 |
| 59 | Ga0068857_100009010 | 3300005577 | Bacteria | 8652 |
| 60 | Ga0068857_100019504 | 3300005577 | Bacteria | 5956 |
| 61 | Ga0068857_100034840 | 3300005577 | Bacteria | 4454 |
| 62 | Ga0068857_100245871 | 3300005577 | Bacteria | 1639 |
| 63 | Ga0068854_100000691 | 3300005578 | Bacteria | 20115 |
| 64 | Ga0068854_100012781 | 3300005578 | Bacteria | 5497 |
| 65 | Ga0068854_100054568 | 3300005578 | Bacteria | 2875 |
| 66 | Ga0068854_100147218 | 3300005578 | Unclassified | 1813 |
| 67 | Ga0068856_100001047 | 3300005614 | Bacteria | 29315 |
| 68 | Ga0068856_100002586 | 3300005614 | Bacteria | 18634 |
| 69 | Ga0068856_100016682 | 3300005614 | Bacteria | 7113 |
| 70 | Ga0068856_100094952 | 3300005614 | Bacteria | 2969 |
| 71 | Ga0068852_100000247 | 3300005616 | Bacteria | 36734 |
| 72 | Ga0068852_100009574 | 3300005616 | Bacteria | 7199 |
| 73 | Ga0068852_100063954 | 3300005616 | Bacteria | 3205 |
| 74 | Ga0068859_100018763 | 3300005617 | Bacteria | 6951 |
| 75 | Ga0068864_100001344 | 3300005618 | Bacteria | 20434 |
| 76 | Ga0068864_100123954 | 3300005618 | Bacteria | 2313 |
| 77 | Ga0068851_10006997 | 3300005834 | Bacteria | 5173 |
| 78 | Ga0068851_10010762 | 3300005834 | Bacteria | 4275 |
| 79 | Ga0068863_100000464 | 3300005841 | Bacteria | 41393 |
| 80 | Ga0068863_100030082 | 3300005841 | Bacteria | 5187 |
| 81 | Ga0068863_100077963 | 3300005841 | Bacteria | 3136 |
| 82 | Ga0068858_100002355 | 3300005842 | Bacteria | 19092 |
| 83 | Ga0068858_100272880 | 3300005842 | Bacteria | 1609 |
| 84 | Ga0068860_100000665 | 3300005843 | Bacteria | 39791 |
| 85 | Ga0070717_10001551 | 3300006028 | Bacteria | 15935 |
| 86 | Ga0097621_100000983 | 3300006237 | Bacteria | 20004 |
| 87 | Ga0068871_100000648 | 3300006358 | Bacteria | 23911 |
| 88 | Ga0097620_100018763 | 3300006931 | Bacteria | 6951 |
| 89 | Ga0105240_10000187 | 3300009093 | Bacteria | 126042 |
| 90 | Ga0105240_10001148 | 3300009093 | Bacteria | 46340 |
| 91 | Ga0105240_10002927 | 3300009093 | Bacteria | 26945 |
| 92 | Ga0105240_10003423 | 3300009093 | Bacteria | 24650 |
| 93 | Ga0105240_10010492 | 3300009093 | Bacteria | 13023 |
| 94 | Ga0105240_10019330 | 3300009093 | Bacteria | 9103 |
| 95 | Ga0105240_10072193 | 3300009093 | Bacteria | 4267 |
| 96 | Ga0105240_10105548 | 3300009093 | Bacteria | 3420 |
| 97 | Ga0105240_10175129 | 3300009093 | Bacteria | 2537 |
| 98 | Ga0105240_10360236 | 3300009093 | Bacteria | 1648 |
| 99 | Ga0105245_10001333 | 3300009098 | Bacteria | 22343 |
| 100 | Ga0105247_10003250 | 3300009101 | Bacteria | 10674 |
| 101 | Ga0105247_10159777 | 3300009101 | Bacteria | 1491 |
| 102 | Ga0105243_10068597 | 3300009148 | Bacteria | 2858 |
| 103 | Ga0105241_10000313 | 3300009174 | Bacteria | 36548 |
| 104 | Ga0105241_10000472 | 3300009174 | Bacteria | 30432 |
| 105 | Ga0105241_10088645 | 3300009174 | Bacteria | 2437 |
| 106 | Ga0105241_10189247 | 3300009174 | Bacteria | 1712 |
| 107 | Ga0105248_10000011 | 3300009177 | Bacteria | 339183 |
| 108 | Ga0105248_10002466 | 3300009177 | Bacteria | 20556 |
| 109 | Ga0105248_10013722 | 3300009177 | Bacteria | 8920 |
| 110 | Ga0105248_10050299 | 3300009177 | Bacteria | 4674 |
| 111 | Ga0105248_10166950 | 3300009177 | Bacteria | 2481 |
| 112 | Ga0105248_10340294 | 3300009177 | Bacteria | 1689 |
| 113 | Ga0105237_10067194 | 3300009545 | Bacteria | 3579 |
| 114 | Ga0105237_10093922 | 3300009545 | Bacteria | 2989 |
| 115 | Ga0105237_10325299 | 3300009545 | Bacteria | 1541 |
| 116 | Ga0105237_10420181 | 3300009545 | Bacteria | 1342 |
| 117 | Ga0105238_10000395 | 3300009551 | Bacteria | 46439 |
| 118 | Ga0105238_10002128 | 3300009551 | Bacteria | 19996 |
| 119 | Ga0105238_10070836 | 3300009551 | Bacteria | 3485 |
| 120 | Ga0105249_10042856 | 3300009553 | Bacteria | 4117 |
| 121 | Ga0105239_10003401 | 3300010375 | Bacteria | 19505 |
| 122 | Ga0105239_10003500 | 3300010375 | Bacteria | 19221 |
| 123 | Ga0105239_10004456 | 3300010375 | Bacteria | 16740 |
| 124 | Ga0105246_10000383 | 3300011119 | Bacteria | 23588 |
| 125 | Ga0105246_10117939 | 3300011119 | Bacteria | 1962 |
| 126 | Ga0157370_10000066 | 3300013104 | Bacteria | 113884 |
| 127 | Ga0157370_10043382 | 3300013104 | Bacteria | 4329 |
| 128 | Ga0157370_10046670 | 3300013104 | Bacteria | 4153 |
| 129 | Ga0157370_10095253 | 3300013104 | Bacteria | 2793 |
| 130 | Ga0157370_10105434 | 3300013104 | Bacteria | 2638 |
| 131 | Ga0157370_10184139 | 3300013104 | Unclassified | 1940 |
| 132 | Ga0157370_10464553 | 3300013104 | Bacteria | 1163 |
| 133 | Ga0157369_10000188 | 3300013105 | Bacteria | 85789 |
| 134 | Ga0157369_10001568 | 3300013105 | Bacteria | 27988 |
| 135 | Ga0157369_10002371 | 3300013105 | Bacteria | 22639 |
| 136 | Ga0157369_10006629 | 3300013105 | Bacteria | 13392 |
| 137 | Ga0157369_10008084 | 3300013105 | Bacteria | 12064 |
| 138 | Ga0157369_10012042 | 3300013105 | Bacteria | 9820 |
| 139 | Ga0157369_10019768 | 3300013105 | Bacteria | 7536 |
| 140 | Ga0157369_10026027 | 3300013105 | Bacteria | 6492 |
| 141 | Ga0157369_10026507 | 3300013105 | Bacteria | 6428 |
| 142 | Ga0157369_10100136 | 3300013105 | Bacteria | 3089 |
| 143 | Ga0157369_10120379 | 3300013105 | Bacteria | 2786 |
| 144 | Ga0157369_10165090 | 3300013105 | Bacteria | 2336 |
| 145 | Ga0157374_10001002 | 3300013296 | Bacteria | 24438 |
| 146 | Ga0157374_10002414 | 3300013296 | Bacteria | 15768 |
| 147 | Ga0157374_10004017 | 3300013296 | Bacteria | 12366 |
| 148 | Ga0157374_10019906 | 3300013296 | Bacteria | 5948 |
| 149 | Ga0157374_10167391 | 3300013296 | Bacteria | 2143 |
| 150 | Ga0157374_10217108 | 3300013296 | Bacteria | 1876 |
| 151 | Ga0157378_10001685 | 3300013297 | Bacteria | 19922 |
| 152 | Ga0157378_10086840 | 3300013297 | Bacteria | 2836 |
| 153 | Ga0157378_10345138 | 3300013297 | Bacteria | 1453 |
| 154 | Ga0163162_10002694 | 3300013306 | Bacteria | 16845 |
| 155 | Ga0157372_10000114 | 3300013307 | Bacteria | 85156 |
| 156 | Ga0157372_10002853 | 3300013307 | Bacteria | 18678 |
| 157 | Ga0157372_10011455 | 3300013307 | Bacteria | 9429 |
| 158 | Ga0157372_10033258 | 3300013307 | Bacteria | 5661 |
| 159 | Ga0157372_10091771 | 3300013307 | Bacteria | 3454 |
| 160 | Ga0157372_10095592 | 3300013307 | Bacteria | 3385 |
| 161 | Ga0157372_10098253 | 3300013307 | Bacteria | 3340 |
| 162 | Ga0157372_10118127 | 3300013307 | Bacteria | 3042 |
| 163 | Ga0157372_10189400 | 3300013307 | Bacteria | 2382 |
| 164 | Ga0157372_10450490 | 3300013307 | Bacteria | 1500 |
| 165 | Ga0157375_10000856 | 3300013308 | Bacteria | 26506 |
| 166 | Ga0157375_10420891 | 3300013308 | Bacteria | 1502 |
| 167 | Ga0157375_10732295 | 3300013308 | Bacteria | 1141 |
| 168 | Ga0163163_10000740 | 3300014325 | Bacteria | 27790 |
| 169 | Ga0163163_10051723 | 3300014325 | Bacteria | 4050 |
| 170 | Ga0163163_10281010 | 3300014325 | Bacteria | 1716 |
| 171 | Ga0157379_10000286 | 3300014968 | Bacteria | 39982 |
| 172 | Ga0157379_10067354 | 3300014968 | Bacteria | 3200 |
| 173 | Ga0157376_10001538 | 3300014969 | Bacteria | 15218 |
| 174 | Ga0157376_10012541 | 3300014969 | Bacteria | 6294 |
| 175 | Ga0157376_10027534 | 3300014969 | Bacteria | 4507 |
| 176 | Ga0157376_10171032 | 3300014969 | Bacteria | 1979 |
| 177 | Ga0163161_10006873 | 3300017792 | Bacteria | 7871 |
| 178 | Ga0213872_10000931 | 3300021361 | Bacteria | 20615 |
| 179 | Ga0213872_10015269 | 3300021361 | Unclassified | 3574 |
| 180 | Ga0207656_10004327 | 3300025321 | Bacteria | 4951 |
| 181 | Ga0207710_10000299 | 3300025900 | Bacteria | 39634 |
| 182 | Ga0207680_10050765 | 3300025903 | Bacteria | 2477 |
| 183 | Ga0207647_10006183 | 3300025904 | Bacteria | 8725 |
| 184 | Ga0207647_10014623 | 3300025904 | Bacteria | 5406 |
| 185 | Ga0207705_10000016 | 3300025909 | Bacteria | 377359 |
| 186 | Ga0207705_10002666 | 3300025909 | Bacteria | 13676 |
| 187 | Ga0207705_10109631 | 3300025909 | Bacteria | 2039 |
| 188 | Ga0207654_10000487 | 3300025911 | Bacteria | 22716 |
| 189 | Ga0207654_10145055 | 3300025911 | Unclassified | 1518 |
| 190 | Ga0207695_10000052 | 3300025913 | Bacteria | 398089 |
| 191 | Ga0207695_10000108 | 3300025913 | Bacteria | 252306 |
| 192 | Ga0207695_10000253 | 3300025913 | Bacteria | 139044 |
| 193 | Ga0207695_10001120 | 3300025913 | Bacteria | 46589 |
| 194 | Ga0207695_10010544 | 3300025913 | Bacteria | 11299 |
| 195 | Ga0207695_10010731 | 3300025913 | Bacteria | 11178 |
| 196 | Ga0207695_10069887 | 3300025913 | Bacteria | 3592 |
| 197 | Ga0207695_10087543 | 3300025913 | Bacteria | 3137 |
| 198 | Ga0207695_10093249 | 3300025913 | Bacteria | 3021 |
| 199 | Ga0207695_10304036 | 3300025913 | Unclassified | 1486 |
| 200 | Ga0207671_10000081 | 3300025914 | Bacteria | 148476 |
| 201 | Ga0207671_10349765 | 3300025914 | Bacteria | 1172 |
| 202 | Ga0207657_10030564 | 3300025919 | Bacteria | 4888 |
| 203 | Ga0207657_10033939 | 3300025919 | Bacteria | 4595 |
| 204 | Ga0207649_10028029 | 3300025920 | Bacteria | 3313 |
| 205 | Ga0207652_10086203 | 3300025921 | Bacteria | 2753 |
| 206 | Ga0207694_10000029 | 3300025924 | Bacteria | 239107 |
| 207 | Ga0207694_10000313 | 3300025924 | Bacteria | 45627 |
| 208 | Ga0207694_10003163 | 3300025924 | Bacteria | 13150 |
| 209 | Ga0207694_10003655 | 3300025924 | Bacteria | 12182 |
| 210 | Ga0207694_10049276 | 3300025924 | Bacteria | 3260 |
| 211 | Ga0207650_10037223 | 3300025925 | Bacteria | 3544 |
| 212 | Ga0207687_10006866 | 3300025927 | Bacteria | 7497 |
| 213 | Ga0207700_10006281 | 3300025928 | Bacteria | 7171 |
| 214 | Ga0207700_10292877 | 3300025928 | Bacteria | 1403 |
| 215 | Ga0207664_10090438 | 3300025929 | Bacteria | 2508 |
| 216 | Ga0207644_10003761 | 3300025931 | Bacteria | 9832 |
| 217 | Ga0207644_10004213 | 3300025931 | Bacteria | 9337 |
| 218 | Ga0207690_10001150 | 3300025932 | Bacteria | 16789 |
| 219 | Ga0207691_10138485 | 3300025940 | Bacteria | 2146 |
| 220 | Ga0207711_10000028 | 3300025941 | Bacteria | 214107 |
| 221 | Ga0207711_10002491 | 3300025941 | Bacteria | 16436 |
| 222 | Ga0207711_10022828 | 3300025941 | Bacteria | 5235 |
| 223 | Ga0207689_10003619 | 3300025942 | Bacteria | 14125 |
| 224 | Ga0207689_10026241 | 3300025942 | Bacteria | 4878 |
| 225 | Ga0207661_10000229 | 3300025944 | Bacteria | 36779 |
| 226 | Ga0207661_10036017 | 3300025944 | Bacteria | 3860 |
| 227 | Ga0207661_10083651 | 3300025944 | Unclassified | 2641 |
| 228 | Ga0207667_10002461 | 3300025949 | Bacteria | 23142 |
| 229 | Ga0207667_10003631 | 3300025949 | Bacteria | 19034 |
| 230 | Ga0207667_10021791 | 3300025949 | Bacteria | 7094 |
| 231 | Ga0207667_10054717 | 3300025949 | Bacteria | 4197 |
| 232 | Ga0207667_10064171 | 3300025949 | Bacteria | 3835 |
| 233 | Ga0207667_10088316 | 3300025949 | Bacteria | 3206 |
| 234 | Ga0207667_10141216 | 3300025949 | Bacteria | 2479 |
| 235 | Ga0207640_10000475 | 3300025981 | Bacteria | 24505 |
| 236 | Ga0207640_10071754 | 3300025981 | Unclassified | 2333 |
| 237 | Ga0207640_10087044 | 3300025981 | Unclassified | 2153 |
| 238 | Ga0207640_10127637 | 3300025981 | Bacteria | 1833 |
| 239 | Ga0207658_10001177 | 3300025986 | Bacteria | 20867 |
| 240 | Ga0207677_10000025 | 3300026023 | Bacteria | 127400 |
| 241 | Ga0207677_10000049 | 3300026023 | Bacteria | 101470 |
| 242 | Ga0207677_10204147 | 3300026023 | Bacteria | 1573 |
| 243 | Ga0207703_10000516 | 3300026035 | Bacteria | 39968 |
| 244 | Ga0207639_10000055 | 3300026041 | Bacteria | 110260 |
| 245 | Ga0207639_10000310 | 3300026041 | Bacteria | 34547 |
| 246 | Ga0207639_10020123 | 3300026041 | Bacteria | 4775 |
| 247 | Ga0207678_10018079 | 3300026067 | Bacteria | 6191 |
| 248 | Ga0207678_10037558 | 3300026067 | Bacteria | 4212 |
| 249 | Ga0207678_10048900 | 3300026067 | Bacteria | 3654 |
| 250 | Ga0207678_10153644 | 3300026067 | Bacteria | 1965 |
| 251 | Ga0207702_10000341 | 3300026078 | Bacteria | 53691 |
| 252 | Ga0207702_10002856 | 3300026078 | Bacteria | 16153 |
| 253 | Ga0207702_10011207 | 3300026078 | Bacteria | 7478 |
| 254 | Ga0207702_10099301 | 3300026078 | Bacteria | 2566 |
| 255 | Ga0207702_10103574 | 3300026078 | Unclassified | 2517 |
| 256 | Ga0207702_10118183 | 3300026078 | Bacteria | 2368 |
| 257 | Ga0207702_10393755 | 3300026078 | Unclassified | 1334 |
| 258 | Ga0207641_10002209 | 3300026088 | Bacteria | 18283 |
| 259 | Ga0207641_10045463 | 3300026088 | Bacteria | 3697 |
| 260 | Ga0207641_10188147 | 3300026088 | Bacteria | 1896 |
| 261 | Ga0207676_10005540 | 3300026095 | Bacteria | 8936 |
| 262 | Ga0207676_10010068 | 3300026095 | Bacteria | 6728 |
| 263 | Ga0207674_10001141 | 3300026116 | Bacteria | 34464 |
| 264 | Ga0207674_10013987 | 3300026116 | Bacteria | 8872 |
| 265 | Ga0207674_10315300 | 3300026116 | Bacteria | 1513 |
| 266 | Ga0207683_10000884 | 3300026121 | Bacteria | 27532 |
| 267 | Ga0207698_10000034 | 3300026142 | Bacteria | 108528 |
| 268 | Ga0207698_10000215 | 3300026142 | Bacteria | 36031 |
| 269 | Ga0207698_10056519 | 3300026142 | Unclassified | 3031 |
| 270 | Ga0268266_10035380 | 3300028379 | Bacteria | 4248 |
| 271 | Ga0268266_10043903 | 3300028379 | Bacteria | 3820 |
| 272 | Ga0268266_10118908 | 3300028379 | Bacteria | 2349 |
| 273 | Ga0268266_10196579 | 3300028379 | Bacteria | 1844 |
| 274 | Ga0268266_10281151 | 3300028379 | Bacteria | 1547 |
| 275 | Ga0268264_10000086 | 3300028381 | Bacteria | 239021 |
| 276 | Ga0268264_10109020 | 3300028381 | Bacteria | 2421 |
| 277 | Ga0265336_10001257 | 3300028666 | Bacteria | 12007 |
| 278 | Ga0265338_10112824 | 3300028800 | Bacteria | 2185 |
| 279 | Ga0265324_10029440 | 3300029957 | Bacteria | 1931 |
| 280 | Ga0265328_10012341 | 3300031239 | Bacteria | 3402 |
| 281 | Ga0265328_10015519 | 3300031239 | Bacteria | 2982 |
| 282 | Ga0265325_10004552 | 3300031241 | Bacteria | 8735 |
| 283 | Ga0265339_10000028 | 3300031249 | Bacteria | 152096 |
| 284 | Ga0265339_10012509 | 3300031249 | Bacteria | 5178 |
| 285 | Ga0265316_10022110 | 3300031344 | Bacteria | 5372 |
| 286 | Ga0265316_10027782 | 3300031344 | Unclassified | 4678 |
| 287 | Ga0265316_10075669 | 3300031344 | Bacteria | 2589 |
| 288 | Ga0265316_10284836 | 3300031344 | Bacteria | 1207 |
| 289 | Ga0265313_10030917 | 3300031595 | Bacteria | 2750 |
| 290 | Ga0265314_10019349 | 3300031711 | Bacteria | 5276 |
| 291 | Ga0265314_10091875 | 3300031711 | Bacteria | 1974 |
| 292 | Ga0265314_10094363 | 3300031711 | Bacteria | 1940 |
| 293 | Ga0265342_10003417 | 3300031712 | Bacteria | 13050 |
| 294 | Ga0373933_0093101 | 3300035724 | Unclassified | 1862 |
| 295 | Ga0373937_0045037 | 3300036401 | Bacteria | 4031 |
| 296 | Ga0373925_0226193 | 3300037068 | Unclassified | 1495 |
| 297 | Ga0395898_0547928 | 3300037466 | Bacteria | 1099 |
| 298 | Ga0436361_0285929 | 3300039447 | Unclassified | 3587 |
| 299 | Ga0436361_0502386 | 3300039447 | Bacteria | 1053 |
| 300 | Ga0436361_0947034 | 3300039447 | Bacteria | 19611 |
| 301 | Ga0466963_0021416 | 3300044694 | Unclassified | 4078 |
| 302 | Ga0466963_0116590 | 3300044694 | Bacteria | 1836 |
| 303 | Ga0466957_0135777 | 3300044842 | Unclassified | 1581 |
| 304 | Ga0466959_0061214 | 3300045049 | Bacteria | 2738 |
| 305 | Ga0466967_0001765 | 3300045976 | Bacteria | 12937 |
| 306 | Ga0466967_0062860 | 3300045976 | Bacteria | 3297 |
| 307 | Ga0495592_0184429 | 3300046454 | Bacteria | 1419 |
| 308 | Ga0495592_0194793 | 3300046454 | Unclassified | 1371 |
| 309 | Ga0495603_0008277 | 3300046455 | Bacteria | 6286 |
| 310 | Ga0495629_0018700 | 3300046459 | Bacteria | 4953 |
| 311 | Ga0495629_0030674 | 3300046459 | Bacteria | 3810 |
| 312 | Ga0495629_0120306 | 3300046459 | Unclassified | 1829 |
| 313 | Ga0495651_0002911 | 3300046462 | Bacteria | 13256 |
| 314 | Ga0495651_0010080 | 3300046462 | Bacteria | 7259 |
| 315 | Ga0495653_0002597 | 3300046463 | Bacteria | 14381 |
| 316 | Ga0495650_0000010 | 3300046471 | Bacteria | 645599 |
| 317 | Ga0495580_0029869 | 3300046472 | Bacteria | 3953 |
| 318 | Ga0495580_0062715 | 3300046472 | Bacteria | 2607 |
| 319 | Ga0495580_0089717 | 3300046472 | Bacteria | 2140 |
| 320 | Ga0495580_0125916 | 3300046472 | Bacteria | 1778 |
| 321 | Ga0495582_0017051 | 3300046473 | Bacteria | 3977 |
| 322 | Ga0495639_0001589 | 3300046475 | Bacteria | 10130 |
| 323 | Ga0495662_0000645 | 3300046476 | Bacteria | 16330 |
| 324 | Ga0495664_0010426 | 3300046477 | Bacteria | 5214 |
| 325 | Ga0495585_0029334 | 3300046492 | Bacteria | 3132 |
| 326 | Ga0495594_0001581 | 3300046499 | Bacteria | 11833 |
| 327 | Ga0495594_0013311 | 3300046499 | Bacteria | 4292 |
| 328 | Ga0495594_0017641 | 3300046499 | Bacteria | 3773 |
| 329 | Ga0495583_0024207 | 3300046506 | Bacteria | 3056 |
| 330 | Ga0495583_0089168 | 3300046506 | Bacteria | 1330 |
| 331 | Ga0495628_0001223 | 3300046516 | Bacteria | 23508 |
| 332 | Ga0495637_0121918 | 3300046520 | Bacteria | 1002 |
| 333 | Ga0495644_0000118 | 3300046523 | Bacteria | 37646 |
| 334 | Ga0495648_0083927 | 3300046524 | Unclassified | 1804 |
| 335 | Ga0495666_0020928 | 3300046526 | Bacteria | 3238 |
| 336 | Ga0495652_0003190 | 3300046529 | Bacteria | 16339 |
| 337 | Ga0495652_0061333 | 3300046529 | Bacteria | 3175 |
| 338 | Ga0495665_0011022 | 3300046531 | Bacteria | 4891 |
| 339 | Ga0495665_0052505 | 3300046531 | Bacteria | 2158 |
| 340 | Ga0495640_0002236 | 3300046533 | Bacteria | 15504 |
| 341 | Ga0495640_0151686 | 3300046533 | Bacteria | 1489 |
| 342 | Ga0495586_0001329 | 3300046535 | Bacteria | 13740 |
| 343 | Ga0495587_0032591 | 3300046536 | Bacteria | 3149 |
| 344 | Ga0495587_0034499 | 3300046536 | Bacteria | 3051 |
| 345 | Ga0495587_0055036 | 3300046536 | Bacteria | 2344 |
| 346 | Ga0495609_0013222 | 3300046538 | Bacteria | 3902 |
| 347 | Ga0495645_0026658 | 3300046543 | Bacteria | 4196 |
| 348 | Ga0495645_0028592 | 3300046543 | Bacteria | 4052 |
| 349 | Ga0495645_0080854 | 3300046543 | Unclassified | 2332 |
| 350 | Ga0495633_0023778 | 3300046558 | Bacteria | 3033 |
| 351 | Ga0495667_0001549 | 3300046559 | Bacteria | 15245 |
| 352 | Ga0495668_0020934 | 3300046616 | Bacteria | 3757 |
| 353 | Ga0495634_0002593 | 3300046642 | Bacteria | 14886 |
| 354 | Ga0495625_0000276 | 3300046660 | Bacteria | 79774 |
| 355 | Ga0495625_0130678 | 3300046660 | Bacteria | 1701 |
| 356 | Ga0495635_0012902 | 3300046663 | Bacteria | 5850 |
| 357 | Ga0495599_0001357 | 3300046678 | Bacteria | 13983 |
| 358 | Ga0495623_0123529 | 3300046679 | Unclassified | 1556 |
| 359 | Ga0495646_0046134 | 3300046680 | Bacteria | 2658 |
| 360 | Ga0495646_0087405 | 3300046680 | Bacteria | 1807 |
| 361 | Ga0495613_0005516 | 3300046689 | Bacteria | 9500 |
| 362 | Ga0495613_0009988 | 3300046689 | Bacteria | 7052 |
| 363 | Ga0495613_0012524 | 3300046689 | Bacteria | 6304 |
| 364 | Ga0495613_0075314 | 3300046689 | Bacteria | 2457 |
| 365 | Ga0495613_0145453 | 3300046689 | Bacteria | 1692 |
| 366 | Ga0495624_0001915 | 3300046690 | Bacteria | 15843 |
| 367 | Ga0495670_0037315 | 3300046691 | Bacteria | 2422 |
| 368 | Ga0495649_0098440 | 3300046694 | Unclassified | 1556 |
| 369 | Ga0495589_0069528 | 3300046794 | Bacteria | 1722 |
| 370 | Ga0495600_0003635 | 3300046809 | Bacteria | 9095 |
| 371 | Ga0495600_0120975 | 3300046809 | Unclassified | 1703 |
| 372 | Ga0495600_0177967 | 3300046809 | Bacteria | 1371 |
| 373 | Ga0495581_0000228 | 3300047315 | Bacteria | 26396 |
| 374 | Ga0495581_0125822 | 3300047315 | Bacteria | 1492 |
| 375 | Ga0495604_0000531 | 3300047317 | Bacteria | 33573 |
| 376 | Ga0495674_0024866 | 3300047319 | Bacteria | 5498 |
| 377 | Ga0495674_0036215 | 3300047319 | Bacteria | 4444 |
| 378 | Ga0495674_0375929 | 3300047319 | Bacteria | 1150 |
| 379 | Ga0495672_0002914 | 3300047320 | Bacteria | 15141 |
| 380 | Ga0495676_0013756 | 3300047321 | Bacteria | 7255 |
| 381 | Ga0495680_0000563 | 3300047322 | Bacteria | 41798 |
| 382 | Ga0495680_0012626 | 3300047322 | Bacteria | 7422 |
| 383 | Ga0495683_0024074 | 3300047323 | Bacteria | 3127 |
| 384 | Ga0495675_0000944 | 3300047444 | Bacteria | 17626 |
| 385 | Ga0495677_0031924 | 3300047445 | Bacteria | 1917 |
| 386 | Ga0495684_0043160 | 3300047471 | Bacteria | 3452 |
| 387 | Ga0495684_0176082 | 3300047471 | Bacteria | 1588 |
| 388 | Ga0495686_0000018 | 3300047472 | Bacteria | 434962 |
| 389 | Ga0495686_0019632 | 3300047472 | Bacteria | 4515 |
| 390 | Ga0495686_0163461 | 3300047472 | Bacteria | 1299 |
| 391 | Ga0495593_0005453 | 3300047673 | Bacteria | 7515 |
| 392 | Ga0495614_0000079 | 3300048089 | Bacteria | 32033 |
| 393 | Ga0495614_0001908 | 3300048089 | Bacteria | 9149 |
| 394 | Ga0496100_0187715 | 3300048903 | Bacteria | 1499 |
| 395 | Ga0496100_0305442 | 3300048903 | Bacteria | 1192 |
| 396 | Ga0496104_0002087 | 3300048907 | Bacteria | 17340 |
| 397 | Ga0496104_0021972 | 3300048907 | Bacteria | 5861 |
| 398 | Ga0496105_0124556 | 3300048908 | Bacteria | 2125 |
| 399 | Ga0496105_0469720 | 3300048908 | Bacteria | 991 |
| 400 | Ga0496106_0118883 | 3300048909 | Bacteria | 2064 |
| 401 | Ga0496107_0204368 | 3300048910 | Unclassified | 1468 |
| 402 | Ga0496108_0046495 | 3300048911 | Bacteria | 3626 |
| 403 | Ga0496112_0203487 | 3300048915 | Bacteria | 1938 |
| 404 | Ga0496114_0231597 | 3300048917 | Bacteria | 1623 |
| 405 | Ga0496115_0172220 | 3300048918 | Bacteria | 1790 |
| 406 | Ga0496126_0000004 | 3300048929 | Bacteria | 925026 |
| 407 | Ga0496126_0000042 | 3300048929 | Bacteria | 340121 |
| 408 | Ga0496126_0001033 | 3300048929 | Bacteria | 47113 |
| 409 | Ga0496126_0004102 | 3300048929 | Bacteria | 17631 |
| 410 | Ga0496126_0013691 | 3300048929 | Bacteria | 8234 |
| 411 | Ga0496126_0068841 | 3300048929 | Bacteria | 3159 |
| 412 | Ga0501031_0044450 | 3300049568 | Bacteria | 2899 |
| 413 | Ga0501032_0022516 | 3300049569 | Bacteria | 4367 |
| 414 | Ga0501033_0108738 | 3300049570 | Bacteria | 2019 |
| 415 | Ga0501034_0035278 | 3300049571 | Bacteria | 5071 |
| 416 | Ga0501036_0028098 | 3300049572 | Bacteria | 4755 |
| 417 | Ga0501037_0021275 | 3300049573 | Bacteria | 4793 |
| 418 | Ga0501037_0087981 | 3300049573 | Bacteria | 2248 |
| 419 | Ga0501038_0002278 | 3300049574 | Bacteria | 17853 |
| 420 | Ga0501038_0040290 | 3300049574 | Bacteria | 4082 |
| 421 | Ga0501038_0204932 | 3300049574 | Bacteria | 1581 |
| 422 | Ga0501039_0042132 | 3300049575 | Bacteria | 3528 |
| 423 | Ga0501043_0009547 | 3300049579 | Bacteria | 7606 |
| 424 | Ga0501046_0000448 | 3300049580 | Bacteria | 41389 |
| 425 | Ga0501047_0000517 | 3300049581 | Bacteria | 41739 |
| 426 | Ga0501047_0014404 | 3300049581 | Bacteria | 7519 |
| 427 | Ga0501073_0017179 | 3300049589 | Bacteria | 5240 |
| 428 | Ga0501080_0046116 | 3300049742 | Bacteria | 4060 |
| 429 | Ga0501044_0018099 | 3300049823 | Bacteria | 7555 |
| 430 | Ga0501044_0024458 | 3300049823 | Bacteria | 6409 |
| 431 | nmdc:mga0qj67_251128_c1 | 3300050509 | Unclassified | 1435 |
| 432 | nmdc:mga06r32_291789_c1 | 3300050510 | Unclassified | 1618 |
| 433 | Ga0500651_0000008 | 3300053093 | Bacteria | 287738 |
| 434 | Ga0500595_000112 | 3300053119 | Bacteria | 54078 |
| 435 | Ga0500595_019353 | 3300053119 | Bacteria | 2471 |
| 436 | Ga0500595_030389 | 3300053119 | Bacteria | 1820 |
| 437 | Ga0500661_001396 | 3300055283 | Bacteria | 4511 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005530 | Ga0070679_100454171 | Ga0070679_1004541712 | 254 |
| 2 | 3300009093 | Ga0105240_10003423 | Ga0105240_100034237 | 256 |
| 3 | 3300047472 | Ga0495686_0163461 | Ga0495686_0163461_470_1267 | 265 |
| 4 | 3300048907 | Ga0496104_0002087 | Ga0496104_0002087_10541_11338 | 265 |
| 5 | 3300005530 | Ga0070679_100010253 | Ga0070679_1000102532 | 266 |
| 6 | 3300005563 | Ga0068855_100211757 | Ga0068855_1002117572 | 266 |
| 7 | 3300005577 | Ga0068857_100019504 | Ga0068857_1000195046 | 266 |
| 8 | 3300005578 | Ga0068854_100012781 | Ga0068854_1000127816 | 266 |
| 9 | 3300009093 | Ga0105240_10019330 | Ga0105240_100193304 | 266 |
| 10 | 3300009093 | Ga0105240_10105548 | Ga0105240_101055485 | 266 |
| 11 | 3300009545 | Ga0105237_10093922 | Ga0105237_100939223 | 266 |
| 12 | 3300009551 | Ga0105238_10070836 | Ga0105238_100708362 | 266 |
| 13 | 3300013104 | Ga0157370_10043382 | Ga0157370_100433825 | 266 |
| 14 | 3300013104 | Ga0157370_10105434 | Ga0157370_101054342 | 266 |
| 15 | 3300013104 | Ga0157370_10184139 | Ga0157370_101841391 | 266 |
| 16 | 3300013105 | Ga0157369_10001568 | Ga0157369_100015682 | 266 |
| 17 | 3300013105 | Ga0157369_10012042 | Ga0157369_100120427 | 266 |
| 18 | 3300013105 | Ga0157369_10026027 | Ga0157369_100260277 | 266 |
| 19 | 3300013105 | Ga0157369_10100136 | Ga0157369_101001364 | 266 |
| 20 | 3300013307 | Ga0157372_10095592 | Ga0157372_100955923 | 266 |
| 21 | 3300013307 | Ga0157372_10189400 | Ga0157372_101894002 | 266 |
| 22 | 3300025904 | Ga0207647_10014623 | Ga0207647_100146236 | 266 |
| 23 | 3300025909 | Ga0207705_10002666 | Ga0207705_100026669 | 266 |
| 24 | 3300025913 | Ga0207695_10087543 | Ga0207695_100875432 | 266 |
| 25 | 3300025914 | Ga0207671_10349765 | Ga0207671_103497652 | 266 |
| 26 | 3300025919 | Ga0207657_10033939 | Ga0207657_100339393 | 266 |
| 27 | 3300025921 | Ga0207652_10086203 | Ga0207652_100862033 | 266 |
| 28 | 3300025924 | Ga0207694_10049276 | Ga0207694_100492764 | 266 |
| 29 | 3300025949 | Ga0207667_10064171 | Ga0207667_100641714 | 266 |
| 30 | 3300025981 | Ga0207640_10071754 | Ga0207640_100717542 | 266 |
| 31 | 3300026041 | Ga0207639_10020123 | Ga0207639_100201235 | 266 |
| 32 | 3300026067 | Ga0207678_10037558 | Ga0207678_100375583 | 266 |
| 33 | 3300026116 | Ga0207674_10001141 | Ga0207674_1000114119 | 266 |
| 34 | 3300044694 | Ga0466963_0116590 | Ga0466963_0116590_1004_1804 | 266 |
| 35 | 3300048929 | Ga0496126_0004102 | Ga0496126_0004102_1044_1844 | 266 |
| 36 | 3300049574 | Ga0501038_0040290 | Ga0501038_0040290_1676_2488 | 266 |
| 37 | 3300009093 | Ga0105240_10175129 | Ga0105240_101751293 | 267 |
| 38 | 3300009177 | Ga0105248_10166950 | Ga0105248_101669502 | 267 |
| 39 | 3300009545 | Ga0105237_10067194 | Ga0105237_100671944 | 267 |
| 40 | 3300014968 | Ga0157379_10067354 | Ga0157379_100673543 | 267 |
| 41 | 3300014969 | Ga0157376_10012541 | Ga0157376_100125415 | 267 |
| 42 | 3300026095 | Ga0207676_10010068 | Ga0207676_100100681 | 267 |
| 43 | 3300046454 | Ga0495592_0184429 | Ga0495592_0184429_386_1201 | 267 |
| 44 | 3300046455 | Ga0495603_0008277 | Ga0495603_0008277_2318_3133 | 267 |
| 45 | 3300046459 | Ga0495629_0018700 | Ga0495629_0018700_551_1366 | 267 |
| 46 | 3300046459 | Ga0495629_0030674 | Ga0495629_0030674_2760_3575 | 267 |
| 47 | 3300046462 | Ga0495651_0010080 | Ga0495651_0010080_6051_6866 | 267 |
| 48 | 3300046463 | Ga0495653_0002597 | Ga0495653_0002597_13146_13961 | 267 |
| 49 | 3300046472 | Ga0495580_0089717 | Ga0495580_0089717_79_894 | 267 |
| 50 | 3300046472 | Ga0495580_0125916 | Ga0495580_0125916_793_1608 | 267 |
| 51 | 3300046473 | Ga0495582_0017051 | Ga0495582_0017051_803_1618 | 267 |
| 52 | 3300046475 | Ga0495639_0001589 | Ga0495639_0001589_6472_7287 | 267 |
| 53 | 3300046476 | Ga0495662_0000645 | Ga0495662_0000645_4320_5135 | 267 |
| 54 | 3300046477 | Ga0495664_0010426 | Ga0495664_0010426_3762_4577 | 267 |
| 55 | 3300046499 | Ga0495594_0001581 | Ga0495594_0001581_8241_9056 | 267 |
| 56 | 3300046499 | Ga0495594_0013311 | Ga0495594_0013311_2279_3094 | 267 |
| 57 | 3300046499 | Ga0495594_0017641 | Ga0495594_0017641_2537_3352 | 267 |
| 58 | 3300046506 | Ga0495583_0089168 | Ga0495583_0089168_54_869 | 267 |
| 59 | 3300046516 | Ga0495628_0001223 | Ga0495628_0001223_2738_3553 | 267 |
| 60 | 3300046523 | Ga0495644_0000118 | Ga0495644_0000118_24646_25461 | 267 |
| 61 | 3300046526 | Ga0495666_0020928 | Ga0495666_0020928_703_1518 | 267 |
| 62 | 3300046529 | Ga0495652_0003190 | Ga0495652_0003190_12918_13733 | 267 |
| 63 | 3300046531 | Ga0495665_0011022 | Ga0495665_0011022_443_1258 | 267 |
| 64 | 3300046533 | Ga0495640_0002236 | Ga0495640_0002236_3634_4449 | 267 |
| 65 | 3300046533 | Ga0495640_0151686 | Ga0495640_0151686_634_1449 | 267 |
| 66 | 3300046535 | Ga0495586_0001329 | Ga0495586_0001329_11992_12807 | 267 |
| 67 | 3300046536 | Ga0495587_0055036 | Ga0495587_0055036_299_1114 | 267 |
| 68 | 3300046538 | Ga0495609_0013222 | Ga0495609_0013222_269_1084 | 267 |
| 69 | 3300046543 | Ga0495645_0026658 | Ga0495645_0026658_2429_3244 | 267 |
| 70 | 3300046558 | Ga0495633_0023778 | Ga0495633_0023778_622_1437 | 267 |
| 71 | 3300046559 | Ga0495667_0001549 | Ga0495667_0001549_3428_4243 | 267 |
| 72 | 3300046616 | Ga0495668_0020934 | Ga0495668_0020934_2529_3344 | 267 |
| 73 | 3300046642 | Ga0495634_0002593 | Ga0495634_0002593_1154_1969 | 267 |
| 74 | 3300046663 | Ga0495635_0012902 | Ga0495635_0012902_3473_4288 | 267 |
| 75 | 3300046678 | Ga0495599_0001357 | Ga0495599_0001357_2332_3147 | 267 |
| 76 | 3300046680 | Ga0495646_0046134 | Ga0495646_0046134_1563_2378 | 267 |
| 77 | 3300046689 | Ga0495613_0005516 | Ga0495613_0005516_2298_3113 | 267 |
| 78 | 3300046689 | Ga0495613_0009988 | Ga0495613_0009988_3922_4737 | 267 |
| 79 | 3300046690 | Ga0495624_0001915 | Ga0495624_0001915_299_1114 | 267 |
| 80 | 3300046691 | Ga0495670_0037315 | Ga0495670_0037315_888_1703 | 267 |
| 81 | 3300046794 | Ga0495589_0069528 | Ga0495589_0069528_157_972 | 267 |
| 82 | 3300046809 | Ga0495600_0003635 | Ga0495600_0003635_3176_3991 | 267 |
| 83 | 3300046809 | Ga0495600_0177967 | Ga0495600_0177967_538_1353 | 267 |
| 84 | 3300047315 | Ga0495581_0000228 | Ga0495581_0000228_2873_3688 | 267 |
| 85 | 3300047315 | Ga0495581_0125822 | Ga0495581_0125822_660_1475 | 267 |
| 86 | 3300047317 | Ga0495604_0000531 | Ga0495604_0000531_32457_33272 | 267 |
| 87 | 3300047319 | Ga0495674_0036215 | Ga0495674_0036215_1825_2640 | 267 |
| 88 | 3300047321 | Ga0495676_0013756 | Ga0495676_0013756_1805_2620 | 267 |
| 89 | 3300047322 | Ga0495680_0012626 | Ga0495680_0012626_3612_4427 | 267 |
| 90 | 3300047323 | Ga0495683_0024074 | Ga0495683_0024074_653_1468 | 267 |
| 91 | 3300047444 | Ga0495675_0000944 | Ga0495675_0000944_13554_14369 | 267 |
| 92 | 3300047445 | Ga0495677_0031924 | Ga0495677_0031924_220_1035 | 267 |
| 93 | 3300047471 | Ga0495684_0043160 | Ga0495684_0043160_2593_3408 | 267 |
| 94 | 3300047673 | Ga0495593_0005453 | Ga0495593_0005453_3114_3929 | 267 |
| 95 | 3300048089 | Ga0495614_0000079 | Ga0495614_0000079_5532_6347 | 267 |
| 96 | 3300048089 | Ga0495614_0001908 | Ga0495614_0001908_7279_8094 | 267 |
| 97 | 3300048908 | Ga0496105_0469720 | Ga0496105_0469720_145_960 | 267 |
| 98 | 3300048915 | Ga0496112_0203487 | Ga0496112_0203487_19_834 | 267 |
| 99 | 3300048917 | Ga0496114_0231597 | Ga0496114_0231597_386_1201 | 267 |
| 100 | 3300048929 | Ga0496126_0001033 | Ga0496126_0001033_25817_26632 | 267 |
| 101 | 3300046492 | Ga0495585_0029334 | Ga0495585_0029334_783_1634 | 272 |
| 102 | 3300049581 | Ga0501047_0014404 | Ga0501047_0014404_371_1267 | 272 |
| 103 | iso_pu_bacteria | 2884215851 | 2884216155 | 273 |
| 104 | 3300005435 | Ga0070714_100614345 | Ga0070714_1006143451 | 274 |
| 105 | 3300005563 | Ga0068855_100075410 | Ga0068855_1000754104 | 274 |
| 106 | 3300025949 | Ga0207667_10141216 | Ga0207667_101412163 | 274 |
| 107 | 3300010375 | Ga0105239_10003401 | Ga0105239_1000340112 | 276 |
| 108 | 3300046462 | Ga0495651_0002911 | Ga0495651_0002911_10615_11499 | 276 |
| 109 | 3300046543 | Ga0495645_0080854 | Ga0495645_0080854_1311_2195 | 276 |
| 110 | 3300046809 | Ga0495600_0120975 | Ga0495600_0120975_329_1213 | 276 |
| 111 | 3300047322 | Ga0495680_0000563 | Ga0495680_0000563_30384_31268 | 276 |
| 112 | 3300013308 | Ga0157375_10420891 | Ga0157375_104208912 | 277 |
| 113 | 3300013105 | Ga0157369_10165090 | Ga0157369_101650902 | 278 |
| 114 | 3300025949 | Ga0207667_10054717 | Ga0207667_100547174 | 278 |
| 115 | 3300026067 | Ga0207678_10018079 | Ga0207678_100180794 | 278 |
| 116 | 3300046472 | Ga0495580_0062715 | Ga0495580_0062715_995_1840 | 278 |
| 117 | 3300046694 | Ga0495649_0098440 | Ga0495649_0098440_88_942 | 278 |
| 118 | 3300048903 | Ga0496100_0187715 | Ga0496100_0187715_127_972 | 278 |
| 119 | 3300026078 | Ga0207702_10118183 | Ga0207702_101181831 | 279 |
| 120 | 3300045049 | Ga0466959_0061214 | Ga0466959_0061214_1799_2659 | 279 |
| 121 | 3300045976 | Ga0466967_0062860 | Ga0466967_0062860_1067_1927 | 279 |
| 122 | 3300049574 | Ga0501038_0204932 | Ga0501038_0204932_453_1310 | 279 |
| 123 | 3300049823 | Ga0501044_0018099 | Ga0501044_0018099_983_1840 | 279 |
| 124 | 3300049568 | Ga0501031_0044450 | Ga0501031_0044450_1465_2325 | 280 |
| 125 | 3300049569 | Ga0501032_0022516 | Ga0501032_0022516_3449_4309 | 280 |
| 126 | 3300049570 | Ga0501033_0108738 | Ga0501033_0108738_843_1703 | 280 |
| 127 | 3300049571 | Ga0501034_0035278 | Ga0501034_0035278_4148_5008 | 280 |
| 128 | 3300049572 | Ga0501036_0028098 | Ga0501036_0028098_72_932 | 280 |
| 129 | 3300049573 | Ga0501037_0021275 | Ga0501037_0021275_3784_4644 | 280 |
| 130 | 3300049575 | Ga0501039_0042132 | Ga0501039_0042132_649_1509 | 280 |
| 131 | 3300049579 | Ga0501043_0009547 | Ga0501043_0009547_3553_4413 | 280 |
| 132 | 3300049580 | Ga0501046_0000448 | Ga0501046_0000448_34646_35506 | 280 |
| 133 | 3300049581 | Ga0501047_0000517 | Ga0501047_0000517_8382_9242 | 280 |
| 134 | 3300049742 | Ga0501080_0046116 | Ga0501080_0046116_2672_3532 | 280 |
| 135 | 3300049823 | Ga0501044_0024458 | Ga0501044_0024458_4550_5410 | 280 |
| 136 | 3300005539 | Ga0068853_100008997 | Ga0068853_10000899710 | 281 |
| 137 | 3300005578 | Ga0068854_100000691 | Ga0068854_1000006911 | 281 |
| 138 | 3300009093 | Ga0105240_10010492 | Ga0105240_1001049215 | 281 |
| 139 | 3300013104 | Ga0157370_10464553 | Ga0157370_104645531 | 281 |
| 140 | 3300025932 | Ga0207690_10001150 | Ga0207690_1000115010 | 281 |
| 141 | 3300025981 | Ga0207640_10000475 | Ga0207640_100004751 | 281 |
| 142 | 3300026041 | Ga0207639_10000310 | Ga0207639_1000031020 | 281 |
| 143 | 3300048929 | Ga0496126_0000042 | Ga0496126_0000042_6489_7346 | 282 |
| 144 | 3300053119 | Ga0500595_030389 | Ga0500595_030389_809_1675 | 282 |
| 145 | 3300005329 | Ga0070683_100106475 | Ga0070683_1001064752 | 283 |
| 146 | 3300005339 | Ga0070660_100038722 | Ga0070660_1000387222 | 283 |
| 147 | 3300005366 | Ga0070659_100077667 | Ga0070659_1000776672 | 283 |
| 148 | 3300005455 | Ga0070663_100216075 | Ga0070663_1002160752 | 283 |
| 149 | 3300005458 | Ga0070681_10020502 | Ga0070681_100205023 | 283 |
| 150 | 3300005535 | Ga0070684_100299272 | Ga0070684_1002992721 | 283 |
| 151 | 3300005539 | Ga0068853_100133502 | Ga0068853_1001335023 | 283 |
| 152 | 3300039447 | Ga0436361_0285929 | Ga0436361_0285929_1703_2563 | 283 |
| 153 | 3300005327 | Ga0070658_10000010 | Ga0070658_10000010199 | 284 |
| 154 | 3300005327 | Ga0070658_10209609 | Ga0070658_102096092 | 284 |
| 155 | 3300005455 | Ga0070663_100080998 | Ga0070663_1000809983 | 284 |
| 156 | 3300005563 | Ga0068855_100042079 | Ga0068855_1000420794 | 284 |
| 157 | 3300005563 | Ga0068855_100092126 | Ga0068855_1000921262 | 284 |
| 158 | 3300009093 | Ga0105240_10072193 | Ga0105240_100721933 | 284 |
| 159 | 3300013104 | Ga0157370_10046670 | Ga0157370_100466703 | 284 |
| 160 | 3300013104 | Ga0157370_10095253 | Ga0157370_100952533 | 284 |
| 161 | 3300025909 | Ga0207705_10000016 | Ga0207705_10000016265 | 284 |
| 162 | 3300025913 | Ga0207695_10093249 | Ga0207695_100932492 | 284 |
| 163 | 3300025949 | Ga0207667_10002461 | Ga0207667_1000246119 | 284 |
| 164 | 3300026067 | Ga0207678_10048900 | Ga0207678_100489003 | 284 |
| 165 | 3300048929 | Ga0496126_0000004 | Ga0496126_0000004_89309_90181 | 284 |
| 166 | 3300049573 | Ga0501037_0087981 | Ga0501037_0087981_186_1064 | 284 |
| 167 | 3300049589 | Ga0501073_0017179 | Ga0501073_0017179_4340_5218 | 284 |
| 168 | 3300005327 | Ga0070658_10050708 | Ga0070658_100507084 | 285 |
| 169 | 3300005367 | Ga0070667_100156462 | Ga0070667_1001564622 | 285 |
| 170 | 3300005548 | Ga0070665_100081388 | Ga0070665_1000813884 | 285 |
| 171 | 3300005548 | Ga0070665_100192455 | Ga0070665_1001924552 | 285 |
| 172 | 3300005618 | Ga0068864_100123954 | Ga0068864_1001239543 | 285 |
| 173 | 3300005841 | Ga0068863_100030082 | Ga0068863_1000300823 | 285 |
| 174 | 3300009177 | Ga0105248_10340294 | Ga0105248_103402942 | 285 |
| 175 | 3300013105 | Ga0157369_10120379 | Ga0157369_101203793 | 285 |
| 176 | 3300013296 | Ga0157374_10001002 | Ga0157374_100010024 | 285 |
| 177 | 3300013296 | Ga0157374_10019906 | Ga0157374_100199063 | 285 |
| 178 | 3300013307 | Ga0157372_10033258 | Ga0157372_100332583 | 285 |
| 179 | 3300013308 | Ga0157375_10732295 | Ga0157375_107322952 | 285 |
| 180 | 3300014325 | Ga0163163_10051723 | Ga0163163_100517234 | 285 |
| 181 | 3300025903 | Ga0207680_10050765 | Ga0207680_100507653 | 285 |
| 182 | 3300025931 | Ga0207644_10004213 | Ga0207644_100042134 | 285 |
| 183 | 3300026088 | Ga0207641_10045463 | Ga0207641_100454634 | 285 |
| 184 | 3300028379 | Ga0268266_10035380 | Ga0268266_100353802 | 285 |
| 185 | 3300028379 | Ga0268266_10043903 | Ga0268266_100439033 | 285 |
| 186 | 3300028379 | Ga0268266_10118908 | Ga0268266_101189084 | 285 |
| 187 | 3300028379 | Ga0268266_10281151 | Ga0268266_102811512 | 285 |
| 188 | 3300046471 | Ga0495650_0000010 | Ga0495650_0000010_575582_576493 | 285 |
| 189 | 3300046524 | Ga0495648_0083927 | Ga0495648_0083927_554_1501 | 285 |
| 190 | 3300046660 | Ga0495625_0000276 | Ga0495625_0000276_22634_23536 | 285 |
| 191 | 3300047320 | Ga0495672_0002914 | Ga0495672_0002914_1185_2072 | 285 |
| 192 | 3300048918 | Ga0496115_0172220 | Ga0496115_0172220_195_1082 | 285 |
| 193 | 3300049574 | Ga0501038_0002278 | Ga0501038_0002278_13027_13932 | 285 |
| 194 | 3300053093 | Ga0500651_0000008 | Ga0500651_0000008_158286_159179 | 285 |
| 195 | 3300055283 | Ga0500661_001396 | Ga0500661_001396_1120_2031 | 285 |
| 196 | 3300005339 | Ga0070660_100212349 | Ga0070660_1002123492 | 286 |
| 197 | 3300025913 | Ga0207695_10069887 | Ga0207695_100698874 | 286 |
| 198 | 3300046506 | Ga0495583_0024207 | Ga0495583_0024207_421_1341 | 286 |
| 199 | 3300046660 | Ga0495625_0130678 | Ga0495625_0130678_76_996 | 286 |
| 200 | 3300048929 | Ga0496126_0013691 | Ga0496126_0013691_3750_4616 | 286 |
| 201 | 3300053119 | Ga0500595_000112 | Ga0500595_000112_16929_17855 | 286 |
| 202 | 3300003323 | rootH1_10352155 | rootH1_103521552 | 287 |
| 203 | 3300009177 | Ga0105248_10013722 | Ga0105248_100137222 | 287 |
| 204 | 3300047472 | Ga0495686_0000018 | Ga0495686_0000018_169574_170452 | 287 |
| 205 | 3300047472 | Ga0495686_0019632 | Ga0495686_0019632_3257_4135 | 287 |
| 206 | 3300048908 | Ga0496105_0124556 | Ga0496105_0124556_155_1075 | 287 |
| 207 | 3300048911 | Ga0496108_0046495 | Ga0496108_0046495_1972_2892 | 287 |
| 208 | 3300003316 | rootH1_10152381 | rootH1_101523812 | 288 |
| 209 | 3300003320 | rootH2_10309358 | rootH2_103093581 | 288 |
| 210 | 3300003322 | rootL2_10222464 | rootL2_102224643 | 288 |
| 211 | 3300005329 | Ga0070683_100001264 | Ga0070683_1000012649 | 288 |
| 212 | 3300005329 | Ga0070683_100011583 | Ga0070683_1000115836 | 288 |
| 213 | 3300005329 | Ga0070683_100034144 | Ga0070683_1000341444 | 288 |
| 214 | 3300005331 | Ga0070670_100001274 | Ga0070670_10000127412 | 288 |
| 215 | 3300005334 | Ga0068869_100001599 | Ga0068869_1000015999 | 288 |
| 216 | 3300005334 | Ga0068869_100131161 | Ga0068869_1001311611 | 288 |
| 217 | 3300005335 | Ga0070666_10061935 | Ga0070666_100619352 | 288 |
| 218 | 3300005338 | Ga0068868_100000384 | Ga0068868_10000038413 | 288 |
| 219 | 3300005338 | Ga0068868_100152215 | Ga0068868_1001522153 | 288 |
| 220 | 3300005344 | Ga0070661_100005501 | Ga0070661_1000055012 | 288 |
| 221 | 3300005344 | Ga0070661_100097755 | Ga0070661_1000977552 | 288 |
| 222 | 3300005347 | Ga0070668_100047969 | Ga0070668_1000479692 | 288 |
| 223 | 3300005353 | Ga0070669_100508596 | Ga0070669_1005085961 | 288 |
| 224 | 3300005355 | Ga0070671_100002611 | Ga0070671_1000026116 | 288 |
| 225 | 3300005367 | Ga0070667_100002702 | Ga0070667_1000027025 | 288 |
| 226 | 3300005435 | Ga0070714_100115294 | Ga0070714_1001152943 | 288 |
| 227 | 3300005436 | Ga0070713_100011389 | Ga0070713_1000113892 | 288 |
| 228 | 3300005456 | Ga0070678_100206555 | Ga0070678_1002065552 | 288 |
| 229 | 3300005535 | Ga0070684_100000393 | Ga0070684_10000039313 | 288 |
| 230 | 3300005535 | Ga0070684_100000769 | Ga0070684_10000076916 | 288 |
| 231 | 3300005535 | Ga0070684_100265675 | Ga0070684_1002656752 | 288 |
| 232 | 3300005543 | Ga0070672_100229157 | Ga0070672_1002291571 | 288 |
| 233 | 3300005548 | Ga0070665_100002508 | Ga0070665_1000025088 | 288 |
| 234 | 3300005548 | Ga0070665_100207493 | Ga0070665_1002074932 | 288 |
| 235 | 3300005563 | Ga0068855_100000966 | Ga0068855_10000096623 | 288 |
| 236 | 3300005563 | Ga0068855_100001596 | Ga0068855_10000159615 | 288 |
| 237 | 3300005563 | Ga0068855_100051395 | Ga0068855_1000513953 | 288 |
| 238 | 3300005563 | Ga0068855_100186546 | Ga0068855_1001865462 | 288 |
| 239 | 3300005563 | Ga0068855_100442403 | Ga0068855_1004424032 | 288 |
| 240 | 3300005577 | Ga0068857_100009010 | Ga0068857_1000090103 | 288 |
| 241 | 3300005577 | Ga0068857_100034840 | Ga0068857_1000348404 | 288 |
| 242 | 3300005577 | Ga0068857_100245871 | Ga0068857_1002458712 | 288 |
| 243 | 3300005578 | Ga0068854_100054568 | Ga0068854_1000545684 | 288 |
| 244 | 3300005578 | Ga0068854_100147218 | Ga0068854_1001472182 | 288 |
| 245 | 3300005614 | Ga0068856_100001047 | Ga0068856_10000104714 | 288 |
| 246 | 3300005614 | Ga0068856_100002586 | Ga0068856_1000025864 | 288 |
| 247 | 3300005614 | Ga0068856_100016682 | Ga0068856_1000166822 | 288 |
| 248 | 3300005614 | Ga0068856_100094952 | Ga0068856_1000949523 | 288 |
| 249 | 3300005616 | Ga0068852_100000247 | Ga0068852_10000024723 | 288 |
| 250 | 3300005616 | Ga0068852_100009574 | Ga0068852_1000095747 | 288 |
| 251 | 3300005616 | Ga0068852_100063954 | Ga0068852_1000639542 | 288 |
| 252 | 3300005617 | Ga0068859_100018763 | Ga0068859_1000187632 | 288 |
| 253 | 3300005618 | Ga0068864_100001344 | Ga0068864_1000013446 | 288 |
| 254 | 3300005834 | Ga0068851_10006997 | Ga0068851_100069972 | 288 |
| 255 | 3300005834 | Ga0068851_10010762 | Ga0068851_100107622 | 288 |
| 256 | 3300005841 | Ga0068863_100000464 | Ga0068863_10000046428 | 288 |
| 257 | 3300005841 | Ga0068863_100077963 | Ga0068863_1000779633 | 288 |
| 258 | 3300005842 | Ga0068858_100002355 | Ga0068858_10000235510 | 288 |
| 259 | 3300005842 | Ga0068858_100272880 | Ga0068858_1002728802 | 288 |
| 260 | 3300005843 | Ga0068860_100000665 | Ga0068860_10000066524 | 288 |
| 261 | 3300006028 | Ga0070717_10001551 | Ga0070717_100015519 | 288 |
| 262 | 3300006237 | Ga0097621_100000983 | Ga0097621_10000098310 | 288 |
| 263 | 3300006358 | Ga0068871_100000648 | Ga0068871_1000006489 | 288 |
| 264 | 3300006931 | Ga0097620_100018763 | Ga0097620_1000187632 | 288 |
| 265 | 3300009093 | Ga0105240_10000187 | Ga0105240_1000018758 | 288 |
| 266 | 3300009093 | Ga0105240_10001148 | Ga0105240_1000114814 | 288 |
| 267 | 3300009093 | Ga0105240_10002927 | Ga0105240_100029274 | 288 |
| 268 | 3300009098 | Ga0105245_10001333 | Ga0105245_100013338 | 288 |
| 269 | 3300009101 | Ga0105247_10003250 | Ga0105247_100032505 | 288 |
| 270 | 3300009101 | Ga0105247_10159777 | Ga0105247_101597772 | 288 |
| 271 | 3300009148 | Ga0105243_10068597 | Ga0105243_100685972 | 288 |
| 272 | 3300009174 | Ga0105241_10000313 | Ga0105241_100003134 | 288 |
| 273 | 3300009174 | Ga0105241_10000472 | Ga0105241_1000047210 | 288 |
| 274 | 3300009174 | Ga0105241_10088645 | Ga0105241_100886453 | 288 |
| 275 | 3300009174 | Ga0105241_10189247 | Ga0105241_101892471 | 288 |
| 276 | 3300009177 | Ga0105248_10000011 | Ga0105248_10000011117 | 288 |
| 277 | 3300009177 | Ga0105248_10002466 | Ga0105248_1000246613 | 288 |
| 278 | 3300009177 | Ga0105248_10050299 | Ga0105248_100502996 | 288 |
| 279 | 3300009545 | Ga0105237_10325299 | Ga0105237_103252992 | 288 |
| 280 | 3300009545 | Ga0105237_10420181 | Ga0105237_104201812 | 288 |
| 281 | 3300009551 | Ga0105238_10000395 | Ga0105238_1000039514 | 288 |
| 282 | 3300009551 | Ga0105238_10002128 | Ga0105238_1000212810 | 288 |
| 283 | 3300009553 | Ga0105249_10042856 | Ga0105249_100428562 | 288 |
| 284 | 3300010375 | Ga0105239_10003500 | Ga0105239_100035002 | 288 |
| 285 | 3300010375 | Ga0105239_10004456 | Ga0105239_100044566 | 288 |
| 286 | 3300011119 | Ga0105246_10000383 | Ga0105246_100003839 | 288 |
| 287 | 3300011119 | Ga0105246_10117939 | Ga0105246_101179391 | 288 |
| 288 | 3300013104 | Ga0157370_10000066 | Ga0157370_1000006657 | 288 |
| 289 | 3300013105 | Ga0157369_10000188 | Ga0157369_1000018833 | 288 |
| 290 | 3300013105 | Ga0157369_10002371 | Ga0157369_100023712 | 288 |
| 291 | 3300013105 | Ga0157369_10006629 | Ga0157369_1000662910 | 288 |
| 292 | 3300013105 | Ga0157369_10008084 | Ga0157369_100080843 | 288 |
| 293 | 3300013105 | Ga0157369_10019768 | Ga0157369_100197689 | 288 |
| 294 | 3300013105 | Ga0157369_10026507 | Ga0157369_100265076 | 288 |
| 295 | 3300013296 | Ga0157374_10002414 | Ga0157374_100024143 | 288 |
| 296 | 3300013296 | Ga0157374_10004017 | Ga0157374_100040178 | 288 |
| 297 | 3300013296 | Ga0157374_10167391 | Ga0157374_101673912 | 288 |
| 298 | 3300013296 | Ga0157374_10217108 | Ga0157374_102171082 | 288 |
| 299 | 3300013297 | Ga0157378_10001685 | Ga0157378_100016855 | 288 |
| 300 | 3300013297 | Ga0157378_10086840 | Ga0157378_100868403 | 288 |
| 301 | 3300013297 | Ga0157378_10345138 | Ga0157378_103451382 | 288 |
| 302 | 3300013306 | Ga0163162_10002694 | Ga0163162_100026942 | 288 |
| 303 | 3300013307 | Ga0157372_10000114 | Ga0157372_100001147 | 288 |
| 304 | 3300013307 | Ga0157372_10002853 | Ga0157372_100028534 | 288 |
| 305 | 3300013307 | Ga0157372_10011455 | Ga0157372_100114556 | 288 |
| 306 | 3300013307 | Ga0157372_10091771 | Ga0157372_100917713 | 288 |
| 307 | 3300013307 | Ga0157372_10098253 | Ga0157372_100982533 | 288 |
| 308 | 3300013307 | Ga0157372_10118127 | Ga0157372_101181274 | 288 |
| 309 | 3300013307 | Ga0157372_10450490 | Ga0157372_104504902 | 288 |
| 310 | 3300013308 | Ga0157375_10000856 | Ga0157375_1000085612 | 288 |
| 311 | 3300014325 | Ga0163163_10000740 | Ga0163163_1000074014 | 288 |
| 312 | 3300014325 | Ga0163163_10281010 | Ga0163163_102810102 | 288 |
| 313 | 3300014968 | Ga0157379_10000286 | Ga0157379_1000028623 | 288 |
| 314 | 3300014969 | Ga0157376_10001538 | Ga0157376_100015389 | 288 |
| 315 | 3300014969 | Ga0157376_10027534 | Ga0157376_100275342 | 288 |
| 316 | 3300014969 | Ga0157376_10171032 | Ga0157376_101710323 | 288 |
| 317 | 3300017792 | Ga0163161_10006873 | Ga0163161_100068731 | 288 |
| 318 | 3300021361 | Ga0213872_10000931 | Ga0213872_1000093118 | 288 |
| 319 | 3300021361 | Ga0213872_10015269 | Ga0213872_100152693 | 288 |
| 320 | 3300025321 | Ga0207656_10004327 | Ga0207656_100043272 | 288 |
| 321 | 3300025900 | Ga0207710_10000299 | Ga0207710_1000029921 | 288 |
| 322 | 3300025904 | Ga0207647_10006183 | Ga0207647_1000618311 | 288 |
| 323 | 3300025909 | Ga0207705_10109631 | Ga0207705_101096312 | 288 |
| 324 | 3300025911 | Ga0207654_10000487 | Ga0207654_1000048716 | 288 |
| 325 | 3300025911 | Ga0207654_10145055 | Ga0207654_101450552 | 288 |
| 326 | 3300025913 | Ga0207695_10000052 | Ga0207695_10000052256 | 288 |
| 327 | 3300025913 | Ga0207695_10000108 | Ga0207695_1000010874 | 288 |
| 328 | 3300025913 | Ga0207695_10000253 | Ga0207695_1000025372 | 288 |
| 329 | 3300025913 | Ga0207695_10001120 | Ga0207695_1000112025 | 288 |
| 330 | 3300025913 | Ga0207695_10010544 | Ga0207695_100105449 | 288 |
| 331 | 3300025913 | Ga0207695_10010731 | Ga0207695_100107315 | 288 |
| 332 | 3300025913 | Ga0207695_10304036 | Ga0207695_103040362 | 288 |
| 333 | 3300025914 | Ga0207671_10000081 | Ga0207671_1000008141 | 288 |
| 334 | 3300025919 | Ga0207657_10030564 | Ga0207657_100305643 | 288 |
| 335 | 3300025920 | Ga0207649_10028029 | Ga0207649_100280293 | 288 |
| 336 | 3300025924 | Ga0207694_10000029 | Ga0207694_10000029181 | 288 |
| 337 | 3300025924 | Ga0207694_10000313 | Ga0207694_1000031325 | 288 |
| 338 | 3300025924 | Ga0207694_10003163 | Ga0207694_100031638 | 288 |
| 339 | 3300025924 | Ga0207694_10003655 | Ga0207694_100036554 | 288 |
| 340 | 3300025925 | Ga0207650_10037223 | Ga0207650_100372234 | 288 |
| 341 | 3300025927 | Ga0207687_10006866 | Ga0207687_100068665 | 288 |
| 342 | 3300025928 | Ga0207700_10006281 | Ga0207700_100062814 | 288 |
| 343 | 3300025928 | Ga0207700_10292877 | Ga0207700_102928771 | 288 |
| 344 | 3300025929 | Ga0207664_10090438 | Ga0207664_100904383 | 288 |
| 345 | 3300025931 | Ga0207644_10003761 | Ga0207644_100037612 | 288 |
| 346 | 3300025940 | Ga0207691_10138485 | Ga0207691_101384852 | 288 |
| 347 | 3300025941 | Ga0207711_10000028 | Ga0207711_1000002854 | 288 |
| 348 | 3300025941 | Ga0207711_10002491 | Ga0207711_100024912 | 288 |
| 349 | 3300025941 | Ga0207711_10022828 | Ga0207711_100228284 | 288 |
| 350 | 3300025942 | Ga0207689_10003619 | Ga0207689_100036195 | 288 |
| 351 | 3300025942 | Ga0207689_10026241 | Ga0207689_100262412 | 288 |
| 352 | 3300025944 | Ga0207661_10000229 | Ga0207661_100002295 | 288 |
| 353 | 3300025944 | Ga0207661_10036017 | Ga0207661_100360172 | 288 |
| 354 | 3300025944 | Ga0207661_10083651 | Ga0207661_100836512 | 288 |
| 355 | 3300025949 | Ga0207667_10003631 | Ga0207667_100036315 | 288 |
| 356 | 3300025949 | Ga0207667_10021791 | Ga0207667_100217913 | 288 |
| 357 | 3300025949 | Ga0207667_10088316 | Ga0207667_100883163 | 288 |
| 358 | 3300025981 | Ga0207640_10087044 | Ga0207640_100870442 | 288 |
| 359 | 3300025981 | Ga0207640_10127637 | Ga0207640_101276372 | 288 |
| 360 | 3300025986 | Ga0207658_10001177 | Ga0207658_100011772 | 288 |
| 361 | 3300026023 | Ga0207677_10000025 | Ga0207677_1000002577 | 288 |
| 362 | 3300026023 | Ga0207677_10000049 | Ga0207677_1000004965 | 288 |
| 363 | 3300026023 | Ga0207677_10204147 | Ga0207677_102041472 | 288 |
| 364 | 3300026035 | Ga0207703_10000516 | Ga0207703_100005165 | 288 |
| 365 | 3300026041 | Ga0207639_10000055 | Ga0207639_1000005512 | 288 |
| 366 | 3300026067 | Ga0207678_10153644 | Ga0207678_101536441 | 288 |
| 367 | 3300026078 | Ga0207702_10000341 | Ga0207702_1000034127 | 288 |
| 368 | 3300026078 | Ga0207702_10002856 | Ga0207702_1000285611 | 288 |
| 369 | 3300026078 | Ga0207702_10011207 | Ga0207702_100112073 | 288 |
| 370 | 3300026078 | Ga0207702_10099301 | Ga0207702_100993012 | 288 |
| 371 | 3300026078 | Ga0207702_10103574 | Ga0207702_101035742 | 288 |
| 372 | 3300026078 | Ga0207702_10393755 | Ga0207702_103937552 | 288 |
| 373 | 3300026088 | Ga0207641_10002209 | Ga0207641_100022095 | 288 |
| 374 | 3300026088 | Ga0207641_10188147 | Ga0207641_101881472 | 288 |
| 375 | 3300026095 | Ga0207676_10005540 | Ga0207676_100055406 | 288 |
| 376 | 3300026116 | Ga0207674_10013987 | Ga0207674_100139873 | 288 |
| 377 | 3300026116 | Ga0207674_10315300 | Ga0207674_103153002 | 288 |
| 378 | 3300026121 | Ga0207683_10000884 | Ga0207683_1000088418 | 288 |
| 379 | 3300026142 | Ga0207698_10000034 | Ga0207698_1000003480 | 288 |
| 380 | 3300026142 | Ga0207698_10000215 | Ga0207698_1000021525 | 288 |
| 381 | 3300026142 | Ga0207698_10056519 | Ga0207698_100565193 | 288 |
| 382 | 3300028379 | Ga0268266_10196579 | Ga0268266_101965792 | 288 |
| 383 | 3300028381 | Ga0268264_10000086 | Ga0268264_1000008613 | 288 |
| 384 | 3300028381 | Ga0268264_10109020 | Ga0268264_101090203 | 288 |
| 385 | 3300028666 | Ga0265336_10001257 | Ga0265336_100012579 | 288 |
| 386 | 3300028800 | Ga0265338_10112824 | Ga0265338_101128243 | 288 |
| 387 | 3300029957 | Ga0265324_10029440 | Ga0265324_100294402 | 288 |
| 388 | 3300031239 | Ga0265328_10012341 | Ga0265328_100123414 | 288 |
| 389 | 3300031239 | Ga0265328_10015519 | Ga0265328_100155193 | 288 |
| 390 | 3300031241 | Ga0265325_10004552 | Ga0265325_100045526 | 288 |
| 391 | 3300031249 | Ga0265339_10000028 | Ga0265339_1000002889 | 288 |
| 392 | 3300031249 | Ga0265339_10012509 | Ga0265339_100125093 | 288 |
| 393 | 3300031344 | Ga0265316_10022110 | Ga0265316_100221106 | 288 |
| 394 | 3300031344 | Ga0265316_10027782 | Ga0265316_100277826 | 288 |
| 395 | 3300031344 | Ga0265316_10075669 | Ga0265316_100756693 | 288 |
| 396 | 3300031344 | Ga0265316_10284836 | Ga0265316_102848362 | 288 |
| 397 | 3300031595 | Ga0265313_10030917 | Ga0265313_100309172 | 288 |
| 398 | 3300031711 | Ga0265314_10019349 | Ga0265314_100193494 | 288 |
| 399 | 3300031711 | Ga0265314_10091875 | Ga0265314_100918752 | 288 |
| 400 | 3300031711 | Ga0265314_10094363 | Ga0265314_100943633 | 288 |
| 401 | 3300031712 | Ga0265342_10003417 | Ga0265342_100034178 | 288 |
| 402 | 3300035724 | Ga0373933_0093101 | Ga0373933_0093101_230_1117 | 288 |
| 403 | 3300036401 | Ga0373937_0045037 | Ga0373937_0045037_903_1787 | 288 |
| 404 | 3300037068 | Ga0373925_0226193 | Ga0373925_0226193_479_1363 | 288 |
| 405 | 3300037466 | Ga0395898_0547928 | Ga0395898_0547928_170_1066 | 288 |
| 406 | 3300039447 | Ga0436361_0502386 | Ga0436361_0502386_50_934 | 288 |
| 407 | 3300039447 | Ga0436361_0947034 | Ga0436361_0947034_4275_5162 | 288 |
| 408 | 3300044694 | Ga0466963_0021416 | Ga0466963_0021416_2284_3168 | 288 |
| 409 | 3300044842 | Ga0466957_0135777 | Ga0466957_0135777_447_1331 | 288 |
| 410 | 3300045976 | Ga0466967_0001765 | Ga0466967_0001765_7542_8426 | 288 |
| 411 | 3300046454 | Ga0495592_0194793 | Ga0495592_0194793_96_1031 | 288 |
| 412 | 3300046459 | Ga0495629_0120306 | Ga0495629_0120306_778_1662 | 288 |
| 413 | 3300046472 | Ga0495580_0029869 | Ga0495580_0029869_28_912 | 288 |
| 414 | 3300046520 | Ga0495637_0121918 | Ga0495637_0121918_101_982 | 288 |
| 415 | 3300046529 | Ga0495652_0061333 | Ga0495652_0061333_885_1769 | 288 |
| 416 | 3300046531 | Ga0495665_0052505 | Ga0495665_0052505_850_1734 | 288 |
| 417 | 3300046536 | Ga0495587_0032591 | Ga0495587_0032591_623_1507 | 288 |
| 418 | 3300046536 | Ga0495587_0034499 | Ga0495587_0034499_1049_1933 | 288 |
| 419 | 3300046543 | Ga0495645_0028592 | Ga0495645_0028592_680_1564 | 288 |
| 420 | 3300046679 | Ga0495623_0123529 | Ga0495623_0123529_183_1070 | 288 |
| 421 | 3300046680 | Ga0495646_0087405 | Ga0495646_0087405_372_1256 | 288 |
| 422 | 3300046689 | Ga0495613_0012524 | Ga0495613_0012524_3181_4065 | 288 |
| 423 | 3300046689 | Ga0495613_0075314 | Ga0495613_0075314_486_1370 | 288 |
| 424 | 3300046689 | Ga0495613_0145453 | Ga0495613_0145453_477_1361 | 288 |
| 425 | 3300047319 | Ga0495674_0024866 | Ga0495674_0024866_3885_4820 | 288 |
| 426 | 3300047319 | Ga0495674_0375929 | Ga0495674_0375929_159_1043 | 288 |
| 427 | 3300047471 | Ga0495684_0176082 | Ga0495684_0176082_235_1119 | 288 |
| 428 | 3300048903 | Ga0496100_0305442 | Ga0496100_0305442_184_1068 | 288 |
| 429 | 3300048907 | Ga0496104_0021972 | Ga0496104_0021972_3989_4873 | 288 |
| 430 | 3300048909 | Ga0496106_0118883 | Ga0496106_0118883_621_1505 | 288 |
| 431 | 3300048910 | Ga0496107_0204368 | Ga0496107_0204368_375_1259 | 288 |
| 432 | 3300048929 | Ga0496126_0068841 | Ga0496126_0068841_450_1355 | 288 |
| 433 | 3300053119 | Ga0500595_019353 | Ga0500595_019353_1270_2148 | 288 |
| 434 | 3300009093 | Ga0105240_10360236 | Ga0105240_103602362 | 290 |
| 435 | 2162886011 | MRS1b_contig_7351479 | MRS1b_0477.00001500 | 294 |
| 436 | 3300005290 | Ga0065712_10097801 | Ga0065712_100978012 | 294 |
| 437 | 3300050509 | nmdc:mga0qj67_251128_c1 | nmdc:mga0qj67_251128_c1_313_1197 | 294 |
| 438 | 3300050510 | nmdc:mga06r32_291789_c1 | nmdc:mga06r32_291789_c1_581_1465 | 294 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3o66-assembly2.cif.gz_B | crystal structure of glycine betaine/carnitine/choline abc transporter | 0.9638 | 22 | 287 |
| 6efr-assembly1.cif.gz_A | crystal structure of inicsnfr 1.0 | 0.952 | 19 | 287 |
| 3o66-assembly1.cif.gz_A | crystal structure of glycine betaine/carnitine/choline abc transporter | 0.9517 | 21 | 287 |
| 7s7w-assembly1.cif.gz_A | crystal structure of inicsnfr3a nicotine sensor precursor binding protein | 0.9466 | 21 | 287 |
| 4z7e-assembly2.cif.gz_B | soluble binding domain of lmo1422 abc-transporter | 0.9412 | 21 | 287 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FVH0_34_306_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9656 | 22 | 287 | 3.40.190.10 |
| af_Q2FVH0_34_306_3.40.190.10 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.938 | 22 | 287 | 3.40.190.10 |
| 5nxyC01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9369 | 21 | 287 | 3.40.190.10 |
| 3ppnA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Osmoprotection protein (prox); domain 2 | 0.9346 | 123 | 227 | 3.40.190.120 |
| 4z7eB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9328 | 21 | 287 | 3.40.190.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-J9HQ39-F1-model_v4 | deleted | 0.9799 | 37 | 287 |
|
| AF-A0A4Z0RAK3-F1-model_v4 | Glycine/betaine ABC transporter substrate-binding protein | 0.9765 | 62 | 287 |
GO:0022857
GO:0043190 |
| AF-A0A4Q2WGU3-F1-model_v4 | deleted | 0.9763 | 85 | 287 |
|
| AF-A0A2V7YWI5-F1-model_v4 | ABC transporter permease | 0.9758 | 86 | 285 |
GO:0022857
GO:0031460 GO:0043190 |
| AF-A0A285BD77-F1-model_v4 | Osmoprotectant transport system substrate-binding protein | 0.9755 | 37 | 287 |
GO:0022857
GO:0043190 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar