F443949

General Info

Members Datasets Scaffolds Average Seq Length
438 207 437 291

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100051395|Ga0068855_1000513953
Length 353
Sequence MRYPPSPYLSAKVFELNTLCLDLVLRSALYFLSGWGVSGTRVCQVRRSCFCVLLLGFTLVGCAPPRSSRIVIGAKNFTEQVVLGELLSQEIEATTGERVDRRFYLAGSYICNQALVSGRIDGYVEYTGTALTAILKQPLPPVGQRDAATVFRRVRELYESRYGIRVGDGLGFEDTFAMVVRGEDARRLGIRTISDAVRVSEPTSQSRDMGRPQMSWRLGVGYEFEERPDGLRGLEATYGLRFREAPRVMDLGLLYRALAAGQVDMVAGNSTDSPIRAMGFVVLQDDRHYFPPYEAVPLVREDSIRRHPGIAAAMERLAGKVSAEDVREMNYAVDSEHKDVAEVVREFRKRKGL

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
109 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
110 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
111 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
115 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
116 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
126 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
127 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
128 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
129 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
130 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
141 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
178 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
182 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
206 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
207 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.14
Nodule 0
Rhizoplane 2.74
Rhizosphere 93.84
Stem 0
Stem Tuber 0
Unclassified 2.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_7351479 2162886011 Unclassified 1057
2 rootH1_10152381 3300003316 Bacteria 2252
3 rootH2_10309358 3300003320 Unclassified 1241
4 rootL2_10222464 3300003322 Bacteria 3413
5 rootH1_10352155 3300003323 Bacteria 2280
6 Ga0065712_10097801 3300005290 Unclassified 2139
7 Ga0070658_10000010 3300005327 Bacteria 297212
8 Ga0070658_10050708 3300005327 Bacteria 3364
9 Ga0070658_10209609 3300005327 Bacteria 1646
10 Ga0070683_100001264 3300005329 Bacteria 19242
11 Ga0070683_100011583 3300005329 Bacteria 7631
12 Ga0070683_100034144 3300005329 Bacteria 4645
13 Ga0070683_100106475 3300005329 Bacteria 2644
14 Ga0070670_100001274 3300005331 Bacteria 20087
15 Ga0068869_100001599 3300005334 Bacteria 13473
16 Ga0068869_100131161 3300005334 Bacteria 1926
17 Ga0070666_10061935 3300005335 Bacteria 2534
18 Ga0068868_100000384 3300005338 Bacteria 30189
19 Ga0068868_100152215 3300005338 Bacteria 1905
20 Ga0070660_100038722 3300005339 Bacteria 3620
21 Ga0070660_100212349 3300005339 Bacteria 1571
22 Ga0070661_100005501 3300005344 Bacteria 8738
23 Ga0070661_100097755 3300005344 Bacteria 2180
24 Ga0070668_100047969 3300005347 Bacteria 3284
25 Ga0070669_100508596 3300005353 Unclassified 1000
26 Ga0070671_100002611 3300005355 Bacteria 13953
27 Ga0070659_100077667 3300005366 Bacteria 2648
28 Ga0070667_100002702 3300005367 Bacteria 15356
29 Ga0070667_100156462 3300005367 Bacteria 2005
30 Ga0070714_100115294 3300005435 Bacteria 2384
31 Ga0070714_100614345 3300005435 Bacteria 1045
32 Ga0070713_100011389 3300005436 Bacteria 6477
33 Ga0070663_100080998 3300005455 Bacteria 2386
34 Ga0070663_100216075 3300005455 Bacteria 1503
35 Ga0070678_100206555 3300005456 Bacteria 1624
36 Ga0070681_10020502 3300005458 Bacteria 6625
37 Ga0070679_100010253 3300005530 Bacteria 8883
38 Ga0070679_100454171 3300005530 Bacteria 1226
39 Ga0070684_100000393 3300005535 Bacteria 30209
40 Ga0070684_100000769 3300005535 Bacteria 22213
41 Ga0070684_100265675 3300005535 Bacteria 1570
42 Ga0070684_100299272 3300005535 Bacteria 1476
43 Ga0068853_100008997 3300005539 Bacteria 8044
44 Ga0068853_100133502 3300005539 Unclassified 2224
45 Ga0070672_100229157 3300005543 Bacteria 1560
46 Ga0070665_100002508 3300005548 Bacteria 20184
47 Ga0070665_100081388 3300005548 Bacteria 3244
48 Ga0070665_100192455 3300005548 Bacteria 2040
49 Ga0070665_100207493 3300005548 Bacteria 1960
50 Ga0068855_100000966 3300005563 Bacteria 35784
51 Ga0068855_100001596 3300005563 Bacteria 28475
52 Ga0068855_100042079 3300005563 Bacteria 5413
53 Ga0068855_100051395 3300005563 Bacteria 4855
54 Ga0068855_100075410 3300005563 Bacteria 3916
55 Ga0068855_100092126 3300005563 Bacteria 3495
56 Ga0068855_100186546 3300005563 Bacteria 2342
57 Ga0068855_100211757 3300005563 Bacteria 2177
58 Ga0068855_100442403 3300005563 Bacteria 1419
59 Ga0068857_100009010 3300005577 Bacteria 8652
60 Ga0068857_100019504 3300005577 Bacteria 5956
61 Ga0068857_100034840 3300005577 Bacteria 4454
62 Ga0068857_100245871 3300005577 Bacteria 1639
63 Ga0068854_100000691 3300005578 Bacteria 20115
64 Ga0068854_100012781 3300005578 Bacteria 5497
65 Ga0068854_100054568 3300005578 Bacteria 2875
66 Ga0068854_100147218 3300005578 Unclassified 1813
67 Ga0068856_100001047 3300005614 Bacteria 29315
68 Ga0068856_100002586 3300005614 Bacteria 18634
69 Ga0068856_100016682 3300005614 Bacteria 7113
70 Ga0068856_100094952 3300005614 Bacteria 2969
71 Ga0068852_100000247 3300005616 Bacteria 36734
72 Ga0068852_100009574 3300005616 Bacteria 7199
73 Ga0068852_100063954 3300005616 Bacteria 3205
74 Ga0068859_100018763 3300005617 Bacteria 6951
75 Ga0068864_100001344 3300005618 Bacteria 20434
76 Ga0068864_100123954 3300005618 Bacteria 2313
77 Ga0068851_10006997 3300005834 Bacteria 5173
78 Ga0068851_10010762 3300005834 Bacteria 4275
79 Ga0068863_100000464 3300005841 Bacteria 41393
80 Ga0068863_100030082 3300005841 Bacteria 5187
81 Ga0068863_100077963 3300005841 Bacteria 3136
82 Ga0068858_100002355 3300005842 Bacteria 19092
83 Ga0068858_100272880 3300005842 Bacteria 1609
84 Ga0068860_100000665 3300005843 Bacteria 39791
85 Ga0070717_10001551 3300006028 Bacteria 15935
86 Ga0097621_100000983 3300006237 Bacteria 20004
87 Ga0068871_100000648 3300006358 Bacteria 23911
88 Ga0097620_100018763 3300006931 Bacteria 6951
89 Ga0105240_10000187 3300009093 Bacteria 126042
90 Ga0105240_10001148 3300009093 Bacteria 46340
91 Ga0105240_10002927 3300009093 Bacteria 26945
92 Ga0105240_10003423 3300009093 Bacteria 24650
93 Ga0105240_10010492 3300009093 Bacteria 13023
94 Ga0105240_10019330 3300009093 Bacteria 9103
95 Ga0105240_10072193 3300009093 Bacteria 4267
96 Ga0105240_10105548 3300009093 Bacteria 3420
97 Ga0105240_10175129 3300009093 Bacteria 2537
98 Ga0105240_10360236 3300009093 Bacteria 1648
99 Ga0105245_10001333 3300009098 Bacteria 22343
100 Ga0105247_10003250 3300009101 Bacteria 10674
101 Ga0105247_10159777 3300009101 Bacteria 1491
102 Ga0105243_10068597 3300009148 Bacteria 2858
103 Ga0105241_10000313 3300009174 Bacteria 36548
104 Ga0105241_10000472 3300009174 Bacteria 30432
105 Ga0105241_10088645 3300009174 Bacteria 2437
106 Ga0105241_10189247 3300009174 Bacteria 1712
107 Ga0105248_10000011 3300009177 Bacteria 339183
108 Ga0105248_10002466 3300009177 Bacteria 20556
109 Ga0105248_10013722 3300009177 Bacteria 8920
110 Ga0105248_10050299 3300009177 Bacteria 4674
111 Ga0105248_10166950 3300009177 Bacteria 2481
112 Ga0105248_10340294 3300009177 Bacteria 1689
113 Ga0105237_10067194 3300009545 Bacteria 3579
114 Ga0105237_10093922 3300009545 Bacteria 2989
115 Ga0105237_10325299 3300009545 Bacteria 1541
116 Ga0105237_10420181 3300009545 Bacteria 1342
117 Ga0105238_10000395 3300009551 Bacteria 46439
118 Ga0105238_10002128 3300009551 Bacteria 19996
119 Ga0105238_10070836 3300009551 Bacteria 3485
120 Ga0105249_10042856 3300009553 Bacteria 4117
121 Ga0105239_10003401 3300010375 Bacteria 19505
122 Ga0105239_10003500 3300010375 Bacteria 19221
123 Ga0105239_10004456 3300010375 Bacteria 16740
124 Ga0105246_10000383 3300011119 Bacteria 23588
125 Ga0105246_10117939 3300011119 Bacteria 1962
126 Ga0157370_10000066 3300013104 Bacteria 113884
127 Ga0157370_10043382 3300013104 Bacteria 4329
128 Ga0157370_10046670 3300013104 Bacteria 4153
129 Ga0157370_10095253 3300013104 Bacteria 2793
130 Ga0157370_10105434 3300013104 Bacteria 2638
131 Ga0157370_10184139 3300013104 Unclassified 1940
132 Ga0157370_10464553 3300013104 Bacteria 1163
133 Ga0157369_10000188 3300013105 Bacteria 85789
134 Ga0157369_10001568 3300013105 Bacteria 27988
135 Ga0157369_10002371 3300013105 Bacteria 22639
136 Ga0157369_10006629 3300013105 Bacteria 13392
137 Ga0157369_10008084 3300013105 Bacteria 12064
138 Ga0157369_10012042 3300013105 Bacteria 9820
139 Ga0157369_10019768 3300013105 Bacteria 7536
140 Ga0157369_10026027 3300013105 Bacteria 6492
141 Ga0157369_10026507 3300013105 Bacteria 6428
142 Ga0157369_10100136 3300013105 Bacteria 3089
143 Ga0157369_10120379 3300013105 Bacteria 2786
144 Ga0157369_10165090 3300013105 Bacteria 2336
145 Ga0157374_10001002 3300013296 Bacteria 24438
146 Ga0157374_10002414 3300013296 Bacteria 15768
147 Ga0157374_10004017 3300013296 Bacteria 12366
148 Ga0157374_10019906 3300013296 Bacteria 5948
149 Ga0157374_10167391 3300013296 Bacteria 2143
150 Ga0157374_10217108 3300013296 Bacteria 1876
151 Ga0157378_10001685 3300013297 Bacteria 19922
152 Ga0157378_10086840 3300013297 Bacteria 2836
153 Ga0157378_10345138 3300013297 Bacteria 1453
154 Ga0163162_10002694 3300013306 Bacteria 16845
155 Ga0157372_10000114 3300013307 Bacteria 85156
156 Ga0157372_10002853 3300013307 Bacteria 18678
157 Ga0157372_10011455 3300013307 Bacteria 9429
158 Ga0157372_10033258 3300013307 Bacteria 5661
159 Ga0157372_10091771 3300013307 Bacteria 3454
160 Ga0157372_10095592 3300013307 Bacteria 3385
161 Ga0157372_10098253 3300013307 Bacteria 3340
162 Ga0157372_10118127 3300013307 Bacteria 3042
163 Ga0157372_10189400 3300013307 Bacteria 2382
164 Ga0157372_10450490 3300013307 Bacteria 1500
165 Ga0157375_10000856 3300013308 Bacteria 26506
166 Ga0157375_10420891 3300013308 Bacteria 1502
167 Ga0157375_10732295 3300013308 Bacteria 1141
168 Ga0163163_10000740 3300014325 Bacteria 27790
169 Ga0163163_10051723 3300014325 Bacteria 4050
170 Ga0163163_10281010 3300014325 Bacteria 1716
171 Ga0157379_10000286 3300014968 Bacteria 39982
172 Ga0157379_10067354 3300014968 Bacteria 3200
173 Ga0157376_10001538 3300014969 Bacteria 15218
174 Ga0157376_10012541 3300014969 Bacteria 6294
175 Ga0157376_10027534 3300014969 Bacteria 4507
176 Ga0157376_10171032 3300014969 Bacteria 1979
177 Ga0163161_10006873 3300017792 Bacteria 7871
178 Ga0213872_10000931 3300021361 Bacteria 20615
179 Ga0213872_10015269 3300021361 Unclassified 3574
180 Ga0207656_10004327 3300025321 Bacteria 4951
181 Ga0207710_10000299 3300025900 Bacteria 39634
182 Ga0207680_10050765 3300025903 Bacteria 2477
183 Ga0207647_10006183 3300025904 Bacteria 8725
184 Ga0207647_10014623 3300025904 Bacteria 5406
185 Ga0207705_10000016 3300025909 Bacteria 377359
186 Ga0207705_10002666 3300025909 Bacteria 13676
187 Ga0207705_10109631 3300025909 Bacteria 2039
188 Ga0207654_10000487 3300025911 Bacteria 22716
189 Ga0207654_10145055 3300025911 Unclassified 1518
190 Ga0207695_10000052 3300025913 Bacteria 398089
191 Ga0207695_10000108 3300025913 Bacteria 252306
192 Ga0207695_10000253 3300025913 Bacteria 139044
193 Ga0207695_10001120 3300025913 Bacteria 46589
194 Ga0207695_10010544 3300025913 Bacteria 11299
195 Ga0207695_10010731 3300025913 Bacteria 11178
196 Ga0207695_10069887 3300025913 Bacteria 3592
197 Ga0207695_10087543 3300025913 Bacteria 3137
198 Ga0207695_10093249 3300025913 Bacteria 3021
199 Ga0207695_10304036 3300025913 Unclassified 1486
200 Ga0207671_10000081 3300025914 Bacteria 148476
201 Ga0207671_10349765 3300025914 Bacteria 1172
202 Ga0207657_10030564 3300025919 Bacteria 4888
203 Ga0207657_10033939 3300025919 Bacteria 4595
204 Ga0207649_10028029 3300025920 Bacteria 3313
205 Ga0207652_10086203 3300025921 Bacteria 2753
206 Ga0207694_10000029 3300025924 Bacteria 239107
207 Ga0207694_10000313 3300025924 Bacteria 45627
208 Ga0207694_10003163 3300025924 Bacteria 13150
209 Ga0207694_10003655 3300025924 Bacteria 12182
210 Ga0207694_10049276 3300025924 Bacteria 3260
211 Ga0207650_10037223 3300025925 Bacteria 3544
212 Ga0207687_10006866 3300025927 Bacteria 7497
213 Ga0207700_10006281 3300025928 Bacteria 7171
214 Ga0207700_10292877 3300025928 Bacteria 1403
215 Ga0207664_10090438 3300025929 Bacteria 2508
216 Ga0207644_10003761 3300025931 Bacteria 9832
217 Ga0207644_10004213 3300025931 Bacteria 9337
218 Ga0207690_10001150 3300025932 Bacteria 16789
219 Ga0207691_10138485 3300025940 Bacteria 2146
220 Ga0207711_10000028 3300025941 Bacteria 214107
221 Ga0207711_10002491 3300025941 Bacteria 16436
222 Ga0207711_10022828 3300025941 Bacteria 5235
223 Ga0207689_10003619 3300025942 Bacteria 14125
224 Ga0207689_10026241 3300025942 Bacteria 4878
225 Ga0207661_10000229 3300025944 Bacteria 36779
226 Ga0207661_10036017 3300025944 Bacteria 3860
227 Ga0207661_10083651 3300025944 Unclassified 2641
228 Ga0207667_10002461 3300025949 Bacteria 23142
229 Ga0207667_10003631 3300025949 Bacteria 19034
230 Ga0207667_10021791 3300025949 Bacteria 7094
231 Ga0207667_10054717 3300025949 Bacteria 4197
232 Ga0207667_10064171 3300025949 Bacteria 3835
233 Ga0207667_10088316 3300025949 Bacteria 3206
234 Ga0207667_10141216 3300025949 Bacteria 2479
235 Ga0207640_10000475 3300025981 Bacteria 24505
236 Ga0207640_10071754 3300025981 Unclassified 2333
237 Ga0207640_10087044 3300025981 Unclassified 2153
238 Ga0207640_10127637 3300025981 Bacteria 1833
239 Ga0207658_10001177 3300025986 Bacteria 20867
240 Ga0207677_10000025 3300026023 Bacteria 127400
241 Ga0207677_10000049 3300026023 Bacteria 101470
242 Ga0207677_10204147 3300026023 Bacteria 1573
243 Ga0207703_10000516 3300026035 Bacteria 39968
244 Ga0207639_10000055 3300026041 Bacteria 110260
245 Ga0207639_10000310 3300026041 Bacteria 34547
246 Ga0207639_10020123 3300026041 Bacteria 4775
247 Ga0207678_10018079 3300026067 Bacteria 6191
248 Ga0207678_10037558 3300026067 Bacteria 4212
249 Ga0207678_10048900 3300026067 Bacteria 3654
250 Ga0207678_10153644 3300026067 Bacteria 1965
251 Ga0207702_10000341 3300026078 Bacteria 53691
252 Ga0207702_10002856 3300026078 Bacteria 16153
253 Ga0207702_10011207 3300026078 Bacteria 7478
254 Ga0207702_10099301 3300026078 Bacteria 2566
255 Ga0207702_10103574 3300026078 Unclassified 2517
256 Ga0207702_10118183 3300026078 Bacteria 2368
257 Ga0207702_10393755 3300026078 Unclassified 1334
258 Ga0207641_10002209 3300026088 Bacteria 18283
259 Ga0207641_10045463 3300026088 Bacteria 3697
260 Ga0207641_10188147 3300026088 Bacteria 1896
261 Ga0207676_10005540 3300026095 Bacteria 8936
262 Ga0207676_10010068 3300026095 Bacteria 6728
263 Ga0207674_10001141 3300026116 Bacteria 34464
264 Ga0207674_10013987 3300026116 Bacteria 8872
265 Ga0207674_10315300 3300026116 Bacteria 1513
266 Ga0207683_10000884 3300026121 Bacteria 27532
267 Ga0207698_10000034 3300026142 Bacteria 108528
268 Ga0207698_10000215 3300026142 Bacteria 36031
269 Ga0207698_10056519 3300026142 Unclassified 3031
270 Ga0268266_10035380 3300028379 Bacteria 4248
271 Ga0268266_10043903 3300028379 Bacteria 3820
272 Ga0268266_10118908 3300028379 Bacteria 2349
273 Ga0268266_10196579 3300028379 Bacteria 1844
274 Ga0268266_10281151 3300028379 Bacteria 1547
275 Ga0268264_10000086 3300028381 Bacteria 239021
276 Ga0268264_10109020 3300028381 Bacteria 2421
277 Ga0265336_10001257 3300028666 Bacteria 12007
278 Ga0265338_10112824 3300028800 Bacteria 2185
279 Ga0265324_10029440 3300029957 Bacteria 1931
280 Ga0265328_10012341 3300031239 Bacteria 3402
281 Ga0265328_10015519 3300031239 Bacteria 2982
282 Ga0265325_10004552 3300031241 Bacteria 8735
283 Ga0265339_10000028 3300031249 Bacteria 152096
284 Ga0265339_10012509 3300031249 Bacteria 5178
285 Ga0265316_10022110 3300031344 Bacteria 5372
286 Ga0265316_10027782 3300031344 Unclassified 4678
287 Ga0265316_10075669 3300031344 Bacteria 2589
288 Ga0265316_10284836 3300031344 Bacteria 1207
289 Ga0265313_10030917 3300031595 Bacteria 2750
290 Ga0265314_10019349 3300031711 Bacteria 5276
291 Ga0265314_10091875 3300031711 Bacteria 1974
292 Ga0265314_10094363 3300031711 Bacteria 1940
293 Ga0265342_10003417 3300031712 Bacteria 13050
294 Ga0373933_0093101 3300035724 Unclassified 1862
295 Ga0373937_0045037 3300036401 Bacteria 4031
296 Ga0373925_0226193 3300037068 Unclassified 1495
297 Ga0395898_0547928 3300037466 Bacteria 1099
298 Ga0436361_0285929 3300039447 Unclassified 3587
299 Ga0436361_0502386 3300039447 Bacteria 1053
300 Ga0436361_0947034 3300039447 Bacteria 19611
301 Ga0466963_0021416 3300044694 Unclassified 4078
302 Ga0466963_0116590 3300044694 Bacteria 1836
303 Ga0466957_0135777 3300044842 Unclassified 1581
304 Ga0466959_0061214 3300045049 Bacteria 2738
305 Ga0466967_0001765 3300045976 Bacteria 12937
306 Ga0466967_0062860 3300045976 Bacteria 3297
307 Ga0495592_0184429 3300046454 Bacteria 1419
308 Ga0495592_0194793 3300046454 Unclassified 1371
309 Ga0495603_0008277 3300046455 Bacteria 6286
310 Ga0495629_0018700 3300046459 Bacteria 4953
311 Ga0495629_0030674 3300046459 Bacteria 3810
312 Ga0495629_0120306 3300046459 Unclassified 1829
313 Ga0495651_0002911 3300046462 Bacteria 13256
314 Ga0495651_0010080 3300046462 Bacteria 7259
315 Ga0495653_0002597 3300046463 Bacteria 14381
316 Ga0495650_0000010 3300046471 Bacteria 645599
317 Ga0495580_0029869 3300046472 Bacteria 3953
318 Ga0495580_0062715 3300046472 Bacteria 2607
319 Ga0495580_0089717 3300046472 Bacteria 2140
320 Ga0495580_0125916 3300046472 Bacteria 1778
321 Ga0495582_0017051 3300046473 Bacteria 3977
322 Ga0495639_0001589 3300046475 Bacteria 10130
323 Ga0495662_0000645 3300046476 Bacteria 16330
324 Ga0495664_0010426 3300046477 Bacteria 5214
325 Ga0495585_0029334 3300046492 Bacteria 3132
326 Ga0495594_0001581 3300046499 Bacteria 11833
327 Ga0495594_0013311 3300046499 Bacteria 4292
328 Ga0495594_0017641 3300046499 Bacteria 3773
329 Ga0495583_0024207 3300046506 Bacteria 3056
330 Ga0495583_0089168 3300046506 Bacteria 1330
331 Ga0495628_0001223 3300046516 Bacteria 23508
332 Ga0495637_0121918 3300046520 Bacteria 1002
333 Ga0495644_0000118 3300046523 Bacteria 37646
334 Ga0495648_0083927 3300046524 Unclassified 1804
335 Ga0495666_0020928 3300046526 Bacteria 3238
336 Ga0495652_0003190 3300046529 Bacteria 16339
337 Ga0495652_0061333 3300046529 Bacteria 3175
338 Ga0495665_0011022 3300046531 Bacteria 4891
339 Ga0495665_0052505 3300046531 Bacteria 2158
340 Ga0495640_0002236 3300046533 Bacteria 15504
341 Ga0495640_0151686 3300046533 Bacteria 1489
342 Ga0495586_0001329 3300046535 Bacteria 13740
343 Ga0495587_0032591 3300046536 Bacteria 3149
344 Ga0495587_0034499 3300046536 Bacteria 3051
345 Ga0495587_0055036 3300046536 Bacteria 2344
346 Ga0495609_0013222 3300046538 Bacteria 3902
347 Ga0495645_0026658 3300046543 Bacteria 4196
348 Ga0495645_0028592 3300046543 Bacteria 4052
349 Ga0495645_0080854 3300046543 Unclassified 2332
350 Ga0495633_0023778 3300046558 Bacteria 3033
351 Ga0495667_0001549 3300046559 Bacteria 15245
352 Ga0495668_0020934 3300046616 Bacteria 3757
353 Ga0495634_0002593 3300046642 Bacteria 14886
354 Ga0495625_0000276 3300046660 Bacteria 79774
355 Ga0495625_0130678 3300046660 Bacteria 1701
356 Ga0495635_0012902 3300046663 Bacteria 5850
357 Ga0495599_0001357 3300046678 Bacteria 13983
358 Ga0495623_0123529 3300046679 Unclassified 1556
359 Ga0495646_0046134 3300046680 Bacteria 2658
360 Ga0495646_0087405 3300046680 Bacteria 1807
361 Ga0495613_0005516 3300046689 Bacteria 9500
362 Ga0495613_0009988 3300046689 Bacteria 7052
363 Ga0495613_0012524 3300046689 Bacteria 6304
364 Ga0495613_0075314 3300046689 Bacteria 2457
365 Ga0495613_0145453 3300046689 Bacteria 1692
366 Ga0495624_0001915 3300046690 Bacteria 15843
367 Ga0495670_0037315 3300046691 Bacteria 2422
368 Ga0495649_0098440 3300046694 Unclassified 1556
369 Ga0495589_0069528 3300046794 Bacteria 1722
370 Ga0495600_0003635 3300046809 Bacteria 9095
371 Ga0495600_0120975 3300046809 Unclassified 1703
372 Ga0495600_0177967 3300046809 Bacteria 1371
373 Ga0495581_0000228 3300047315 Bacteria 26396
374 Ga0495581_0125822 3300047315 Bacteria 1492
375 Ga0495604_0000531 3300047317 Bacteria 33573
376 Ga0495674_0024866 3300047319 Bacteria 5498
377 Ga0495674_0036215 3300047319 Bacteria 4444
378 Ga0495674_0375929 3300047319 Bacteria 1150
379 Ga0495672_0002914 3300047320 Bacteria 15141
380 Ga0495676_0013756 3300047321 Bacteria 7255
381 Ga0495680_0000563 3300047322 Bacteria 41798
382 Ga0495680_0012626 3300047322 Bacteria 7422
383 Ga0495683_0024074 3300047323 Bacteria 3127
384 Ga0495675_0000944 3300047444 Bacteria 17626
385 Ga0495677_0031924 3300047445 Bacteria 1917
386 Ga0495684_0043160 3300047471 Bacteria 3452
387 Ga0495684_0176082 3300047471 Bacteria 1588
388 Ga0495686_0000018 3300047472 Bacteria 434962
389 Ga0495686_0019632 3300047472 Bacteria 4515
390 Ga0495686_0163461 3300047472 Bacteria 1299
391 Ga0495593_0005453 3300047673 Bacteria 7515
392 Ga0495614_0000079 3300048089 Bacteria 32033
393 Ga0495614_0001908 3300048089 Bacteria 9149
394 Ga0496100_0187715 3300048903 Bacteria 1499
395 Ga0496100_0305442 3300048903 Bacteria 1192
396 Ga0496104_0002087 3300048907 Bacteria 17340
397 Ga0496104_0021972 3300048907 Bacteria 5861
398 Ga0496105_0124556 3300048908 Bacteria 2125
399 Ga0496105_0469720 3300048908 Bacteria 991
400 Ga0496106_0118883 3300048909 Bacteria 2064
401 Ga0496107_0204368 3300048910 Unclassified 1468
402 Ga0496108_0046495 3300048911 Bacteria 3626
403 Ga0496112_0203487 3300048915 Bacteria 1938
404 Ga0496114_0231597 3300048917 Bacteria 1623
405 Ga0496115_0172220 3300048918 Bacteria 1790
406 Ga0496126_0000004 3300048929 Bacteria 925026
407 Ga0496126_0000042 3300048929 Bacteria 340121
408 Ga0496126_0001033 3300048929 Bacteria 47113
409 Ga0496126_0004102 3300048929 Bacteria 17631
410 Ga0496126_0013691 3300048929 Bacteria 8234
411 Ga0496126_0068841 3300048929 Bacteria 3159
412 Ga0501031_0044450 3300049568 Bacteria 2899
413 Ga0501032_0022516 3300049569 Bacteria 4367
414 Ga0501033_0108738 3300049570 Bacteria 2019
415 Ga0501034_0035278 3300049571 Bacteria 5071
416 Ga0501036_0028098 3300049572 Bacteria 4755
417 Ga0501037_0021275 3300049573 Bacteria 4793
418 Ga0501037_0087981 3300049573 Bacteria 2248
419 Ga0501038_0002278 3300049574 Bacteria 17853
420 Ga0501038_0040290 3300049574 Bacteria 4082
421 Ga0501038_0204932 3300049574 Bacteria 1581
422 Ga0501039_0042132 3300049575 Bacteria 3528
423 Ga0501043_0009547 3300049579 Bacteria 7606
424 Ga0501046_0000448 3300049580 Bacteria 41389
425 Ga0501047_0000517 3300049581 Bacteria 41739
426 Ga0501047_0014404 3300049581 Bacteria 7519
427 Ga0501073_0017179 3300049589 Bacteria 5240
428 Ga0501080_0046116 3300049742 Bacteria 4060
429 Ga0501044_0018099 3300049823 Bacteria 7555
430 Ga0501044_0024458 3300049823 Bacteria 6409
431 nmdc:mga0qj67_251128_c1 3300050509 Unclassified 1435
432 nmdc:mga06r32_291789_c1 3300050510 Unclassified 1618
433 Ga0500651_0000008 3300053093 Bacteria 287738
434 Ga0500595_000112 3300053119 Bacteria 54078
435 Ga0500595_019353 3300053119 Bacteria 2471
436 Ga0500595_030389 3300053119 Bacteria 1820
437 Ga0500661_001396 3300055283 Bacteria 4511

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005530 Ga0070679_100454171 Ga0070679_1004541712 254
2 3300009093 Ga0105240_10003423 Ga0105240_100034237 256
3 3300047472 Ga0495686_0163461 Ga0495686_0163461_470_1267 265
4 3300048907 Ga0496104_0002087 Ga0496104_0002087_10541_11338 265
5 3300005530 Ga0070679_100010253 Ga0070679_1000102532 266
6 3300005563 Ga0068855_100211757 Ga0068855_1002117572 266
7 3300005577 Ga0068857_100019504 Ga0068857_1000195046 266
8 3300005578 Ga0068854_100012781 Ga0068854_1000127816 266
9 3300009093 Ga0105240_10019330 Ga0105240_100193304 266
10 3300009093 Ga0105240_10105548 Ga0105240_101055485 266
11 3300009545 Ga0105237_10093922 Ga0105237_100939223 266
12 3300009551 Ga0105238_10070836 Ga0105238_100708362 266
13 3300013104 Ga0157370_10043382 Ga0157370_100433825 266
14 3300013104 Ga0157370_10105434 Ga0157370_101054342 266
15 3300013104 Ga0157370_10184139 Ga0157370_101841391 266
16 3300013105 Ga0157369_10001568 Ga0157369_100015682 266
17 3300013105 Ga0157369_10012042 Ga0157369_100120427 266
18 3300013105 Ga0157369_10026027 Ga0157369_100260277 266
19 3300013105 Ga0157369_10100136 Ga0157369_101001364 266
20 3300013307 Ga0157372_10095592 Ga0157372_100955923 266
21 3300013307 Ga0157372_10189400 Ga0157372_101894002 266
22 3300025904 Ga0207647_10014623 Ga0207647_100146236 266
23 3300025909 Ga0207705_10002666 Ga0207705_100026669 266
24 3300025913 Ga0207695_10087543 Ga0207695_100875432 266
25 3300025914 Ga0207671_10349765 Ga0207671_103497652 266
26 3300025919 Ga0207657_10033939 Ga0207657_100339393 266
27 3300025921 Ga0207652_10086203 Ga0207652_100862033 266
28 3300025924 Ga0207694_10049276 Ga0207694_100492764 266
29 3300025949 Ga0207667_10064171 Ga0207667_100641714 266
30 3300025981 Ga0207640_10071754 Ga0207640_100717542 266
31 3300026041 Ga0207639_10020123 Ga0207639_100201235 266
32 3300026067 Ga0207678_10037558 Ga0207678_100375583 266
33 3300026116 Ga0207674_10001141 Ga0207674_1000114119 266
34 3300044694 Ga0466963_0116590 Ga0466963_0116590_1004_1804 266
35 3300048929 Ga0496126_0004102 Ga0496126_0004102_1044_1844 266
36 3300049574 Ga0501038_0040290 Ga0501038_0040290_1676_2488 266
37 3300009093 Ga0105240_10175129 Ga0105240_101751293 267
38 3300009177 Ga0105248_10166950 Ga0105248_101669502 267
39 3300009545 Ga0105237_10067194 Ga0105237_100671944 267
40 3300014968 Ga0157379_10067354 Ga0157379_100673543 267
41 3300014969 Ga0157376_10012541 Ga0157376_100125415 267
42 3300026095 Ga0207676_10010068 Ga0207676_100100681 267
43 3300046454 Ga0495592_0184429 Ga0495592_0184429_386_1201 267
44 3300046455 Ga0495603_0008277 Ga0495603_0008277_2318_3133 267
45 3300046459 Ga0495629_0018700 Ga0495629_0018700_551_1366 267
46 3300046459 Ga0495629_0030674 Ga0495629_0030674_2760_3575 267
47 3300046462 Ga0495651_0010080 Ga0495651_0010080_6051_6866 267
48 3300046463 Ga0495653_0002597 Ga0495653_0002597_13146_13961 267
49 3300046472 Ga0495580_0089717 Ga0495580_0089717_79_894 267
50 3300046472 Ga0495580_0125916 Ga0495580_0125916_793_1608 267
51 3300046473 Ga0495582_0017051 Ga0495582_0017051_803_1618 267
52 3300046475 Ga0495639_0001589 Ga0495639_0001589_6472_7287 267
53 3300046476 Ga0495662_0000645 Ga0495662_0000645_4320_5135 267
54 3300046477 Ga0495664_0010426 Ga0495664_0010426_3762_4577 267
55 3300046499 Ga0495594_0001581 Ga0495594_0001581_8241_9056 267
56 3300046499 Ga0495594_0013311 Ga0495594_0013311_2279_3094 267
57 3300046499 Ga0495594_0017641 Ga0495594_0017641_2537_3352 267
58 3300046506 Ga0495583_0089168 Ga0495583_0089168_54_869 267
59 3300046516 Ga0495628_0001223 Ga0495628_0001223_2738_3553 267
60 3300046523 Ga0495644_0000118 Ga0495644_0000118_24646_25461 267
61 3300046526 Ga0495666_0020928 Ga0495666_0020928_703_1518 267
62 3300046529 Ga0495652_0003190 Ga0495652_0003190_12918_13733 267
63 3300046531 Ga0495665_0011022 Ga0495665_0011022_443_1258 267
64 3300046533 Ga0495640_0002236 Ga0495640_0002236_3634_4449 267
65 3300046533 Ga0495640_0151686 Ga0495640_0151686_634_1449 267
66 3300046535 Ga0495586_0001329 Ga0495586_0001329_11992_12807 267
67 3300046536 Ga0495587_0055036 Ga0495587_0055036_299_1114 267
68 3300046538 Ga0495609_0013222 Ga0495609_0013222_269_1084 267
69 3300046543 Ga0495645_0026658 Ga0495645_0026658_2429_3244 267
70 3300046558 Ga0495633_0023778 Ga0495633_0023778_622_1437 267
71 3300046559 Ga0495667_0001549 Ga0495667_0001549_3428_4243 267
72 3300046616 Ga0495668_0020934 Ga0495668_0020934_2529_3344 267
73 3300046642 Ga0495634_0002593 Ga0495634_0002593_1154_1969 267
74 3300046663 Ga0495635_0012902 Ga0495635_0012902_3473_4288 267
75 3300046678 Ga0495599_0001357 Ga0495599_0001357_2332_3147 267
76 3300046680 Ga0495646_0046134 Ga0495646_0046134_1563_2378 267
77 3300046689 Ga0495613_0005516 Ga0495613_0005516_2298_3113 267
78 3300046689 Ga0495613_0009988 Ga0495613_0009988_3922_4737 267
79 3300046690 Ga0495624_0001915 Ga0495624_0001915_299_1114 267
80 3300046691 Ga0495670_0037315 Ga0495670_0037315_888_1703 267
81 3300046794 Ga0495589_0069528 Ga0495589_0069528_157_972 267
82 3300046809 Ga0495600_0003635 Ga0495600_0003635_3176_3991 267
83 3300046809 Ga0495600_0177967 Ga0495600_0177967_538_1353 267
84 3300047315 Ga0495581_0000228 Ga0495581_0000228_2873_3688 267
85 3300047315 Ga0495581_0125822 Ga0495581_0125822_660_1475 267
86 3300047317 Ga0495604_0000531 Ga0495604_0000531_32457_33272 267
87 3300047319 Ga0495674_0036215 Ga0495674_0036215_1825_2640 267
88 3300047321 Ga0495676_0013756 Ga0495676_0013756_1805_2620 267
89 3300047322 Ga0495680_0012626 Ga0495680_0012626_3612_4427 267
90 3300047323 Ga0495683_0024074 Ga0495683_0024074_653_1468 267
91 3300047444 Ga0495675_0000944 Ga0495675_0000944_13554_14369 267
92 3300047445 Ga0495677_0031924 Ga0495677_0031924_220_1035 267
93 3300047471 Ga0495684_0043160 Ga0495684_0043160_2593_3408 267
94 3300047673 Ga0495593_0005453 Ga0495593_0005453_3114_3929 267
95 3300048089 Ga0495614_0000079 Ga0495614_0000079_5532_6347 267
96 3300048089 Ga0495614_0001908 Ga0495614_0001908_7279_8094 267
97 3300048908 Ga0496105_0469720 Ga0496105_0469720_145_960 267
98 3300048915 Ga0496112_0203487 Ga0496112_0203487_19_834 267
99 3300048917 Ga0496114_0231597 Ga0496114_0231597_386_1201 267
100 3300048929 Ga0496126_0001033 Ga0496126_0001033_25817_26632 267
101 3300046492 Ga0495585_0029334 Ga0495585_0029334_783_1634 272
102 3300049581 Ga0501047_0014404 Ga0501047_0014404_371_1267 272
103 iso_pu_bacteria 2884215851 2884216155 273
104 3300005435 Ga0070714_100614345 Ga0070714_1006143451 274
105 3300005563 Ga0068855_100075410 Ga0068855_1000754104 274
106 3300025949 Ga0207667_10141216 Ga0207667_101412163 274
107 3300010375 Ga0105239_10003401 Ga0105239_1000340112 276
108 3300046462 Ga0495651_0002911 Ga0495651_0002911_10615_11499 276
109 3300046543 Ga0495645_0080854 Ga0495645_0080854_1311_2195 276
110 3300046809 Ga0495600_0120975 Ga0495600_0120975_329_1213 276
111 3300047322 Ga0495680_0000563 Ga0495680_0000563_30384_31268 276
112 3300013308 Ga0157375_10420891 Ga0157375_104208912 277
113 3300013105 Ga0157369_10165090 Ga0157369_101650902 278
114 3300025949 Ga0207667_10054717 Ga0207667_100547174 278
115 3300026067 Ga0207678_10018079 Ga0207678_100180794 278
116 3300046472 Ga0495580_0062715 Ga0495580_0062715_995_1840 278
117 3300046694 Ga0495649_0098440 Ga0495649_0098440_88_942 278
118 3300048903 Ga0496100_0187715 Ga0496100_0187715_127_972 278
119 3300026078 Ga0207702_10118183 Ga0207702_101181831 279
120 3300045049 Ga0466959_0061214 Ga0466959_0061214_1799_2659 279
121 3300045976 Ga0466967_0062860 Ga0466967_0062860_1067_1927 279
122 3300049574 Ga0501038_0204932 Ga0501038_0204932_453_1310 279
123 3300049823 Ga0501044_0018099 Ga0501044_0018099_983_1840 279
124 3300049568 Ga0501031_0044450 Ga0501031_0044450_1465_2325 280
125 3300049569 Ga0501032_0022516 Ga0501032_0022516_3449_4309 280
126 3300049570 Ga0501033_0108738 Ga0501033_0108738_843_1703 280
127 3300049571 Ga0501034_0035278 Ga0501034_0035278_4148_5008 280
128 3300049572 Ga0501036_0028098 Ga0501036_0028098_72_932 280
129 3300049573 Ga0501037_0021275 Ga0501037_0021275_3784_4644 280
130 3300049575 Ga0501039_0042132 Ga0501039_0042132_649_1509 280
131 3300049579 Ga0501043_0009547 Ga0501043_0009547_3553_4413 280
132 3300049580 Ga0501046_0000448 Ga0501046_0000448_34646_35506 280
133 3300049581 Ga0501047_0000517 Ga0501047_0000517_8382_9242 280
134 3300049742 Ga0501080_0046116 Ga0501080_0046116_2672_3532 280
135 3300049823 Ga0501044_0024458 Ga0501044_0024458_4550_5410 280
136 3300005539 Ga0068853_100008997 Ga0068853_10000899710 281
137 3300005578 Ga0068854_100000691 Ga0068854_1000006911 281
138 3300009093 Ga0105240_10010492 Ga0105240_1001049215 281
139 3300013104 Ga0157370_10464553 Ga0157370_104645531 281
140 3300025932 Ga0207690_10001150 Ga0207690_1000115010 281
141 3300025981 Ga0207640_10000475 Ga0207640_100004751 281
142 3300026041 Ga0207639_10000310 Ga0207639_1000031020 281
143 3300048929 Ga0496126_0000042 Ga0496126_0000042_6489_7346 282
144 3300053119 Ga0500595_030389 Ga0500595_030389_809_1675 282
145 3300005329 Ga0070683_100106475 Ga0070683_1001064752 283
146 3300005339 Ga0070660_100038722 Ga0070660_1000387222 283
147 3300005366 Ga0070659_100077667 Ga0070659_1000776672 283
148 3300005455 Ga0070663_100216075 Ga0070663_1002160752 283
149 3300005458 Ga0070681_10020502 Ga0070681_100205023 283
150 3300005535 Ga0070684_100299272 Ga0070684_1002992721 283
151 3300005539 Ga0068853_100133502 Ga0068853_1001335023 283
152 3300039447 Ga0436361_0285929 Ga0436361_0285929_1703_2563 283
153 3300005327 Ga0070658_10000010 Ga0070658_10000010199 284
154 3300005327 Ga0070658_10209609 Ga0070658_102096092 284
155 3300005455 Ga0070663_100080998 Ga0070663_1000809983 284
156 3300005563 Ga0068855_100042079 Ga0068855_1000420794 284
157 3300005563 Ga0068855_100092126 Ga0068855_1000921262 284
158 3300009093 Ga0105240_10072193 Ga0105240_100721933 284
159 3300013104 Ga0157370_10046670 Ga0157370_100466703 284
160 3300013104 Ga0157370_10095253 Ga0157370_100952533 284
161 3300025909 Ga0207705_10000016 Ga0207705_10000016265 284
162 3300025913 Ga0207695_10093249 Ga0207695_100932492 284
163 3300025949 Ga0207667_10002461 Ga0207667_1000246119 284
164 3300026067 Ga0207678_10048900 Ga0207678_100489003 284
165 3300048929 Ga0496126_0000004 Ga0496126_0000004_89309_90181 284
166 3300049573 Ga0501037_0087981 Ga0501037_0087981_186_1064 284
167 3300049589 Ga0501073_0017179 Ga0501073_0017179_4340_5218 284
168 3300005327 Ga0070658_10050708 Ga0070658_100507084 285
169 3300005367 Ga0070667_100156462 Ga0070667_1001564622 285
170 3300005548 Ga0070665_100081388 Ga0070665_1000813884 285
171 3300005548 Ga0070665_100192455 Ga0070665_1001924552 285
172 3300005618 Ga0068864_100123954 Ga0068864_1001239543 285
173 3300005841 Ga0068863_100030082 Ga0068863_1000300823 285
174 3300009177 Ga0105248_10340294 Ga0105248_103402942 285
175 3300013105 Ga0157369_10120379 Ga0157369_101203793 285
176 3300013296 Ga0157374_10001002 Ga0157374_100010024 285
177 3300013296 Ga0157374_10019906 Ga0157374_100199063 285
178 3300013307 Ga0157372_10033258 Ga0157372_100332583 285
179 3300013308 Ga0157375_10732295 Ga0157375_107322952 285
180 3300014325 Ga0163163_10051723 Ga0163163_100517234 285
181 3300025903 Ga0207680_10050765 Ga0207680_100507653 285
182 3300025931 Ga0207644_10004213 Ga0207644_100042134 285
183 3300026088 Ga0207641_10045463 Ga0207641_100454634 285
184 3300028379 Ga0268266_10035380 Ga0268266_100353802 285
185 3300028379 Ga0268266_10043903 Ga0268266_100439033 285
186 3300028379 Ga0268266_10118908 Ga0268266_101189084 285
187 3300028379 Ga0268266_10281151 Ga0268266_102811512 285
188 3300046471 Ga0495650_0000010 Ga0495650_0000010_575582_576493 285
189 3300046524 Ga0495648_0083927 Ga0495648_0083927_554_1501 285
190 3300046660 Ga0495625_0000276 Ga0495625_0000276_22634_23536 285
191 3300047320 Ga0495672_0002914 Ga0495672_0002914_1185_2072 285
192 3300048918 Ga0496115_0172220 Ga0496115_0172220_195_1082 285
193 3300049574 Ga0501038_0002278 Ga0501038_0002278_13027_13932 285
194 3300053093 Ga0500651_0000008 Ga0500651_0000008_158286_159179 285
195 3300055283 Ga0500661_001396 Ga0500661_001396_1120_2031 285
196 3300005339 Ga0070660_100212349 Ga0070660_1002123492 286
197 3300025913 Ga0207695_10069887 Ga0207695_100698874 286
198 3300046506 Ga0495583_0024207 Ga0495583_0024207_421_1341 286
199 3300046660 Ga0495625_0130678 Ga0495625_0130678_76_996 286
200 3300048929 Ga0496126_0013691 Ga0496126_0013691_3750_4616 286
201 3300053119 Ga0500595_000112 Ga0500595_000112_16929_17855 286
202 3300003323 rootH1_10352155 rootH1_103521552 287
203 3300009177 Ga0105248_10013722 Ga0105248_100137222 287
204 3300047472 Ga0495686_0000018 Ga0495686_0000018_169574_170452 287
205 3300047472 Ga0495686_0019632 Ga0495686_0019632_3257_4135 287
206 3300048908 Ga0496105_0124556 Ga0496105_0124556_155_1075 287
207 3300048911 Ga0496108_0046495 Ga0496108_0046495_1972_2892 287
208 3300003316 rootH1_10152381 rootH1_101523812 288
209 3300003320 rootH2_10309358 rootH2_103093581 288
210 3300003322 rootL2_10222464 rootL2_102224643 288
211 3300005329 Ga0070683_100001264 Ga0070683_1000012649 288
212 3300005329 Ga0070683_100011583 Ga0070683_1000115836 288
213 3300005329 Ga0070683_100034144 Ga0070683_1000341444 288
214 3300005331 Ga0070670_100001274 Ga0070670_10000127412 288
215 3300005334 Ga0068869_100001599 Ga0068869_1000015999 288
216 3300005334 Ga0068869_100131161 Ga0068869_1001311611 288
217 3300005335 Ga0070666_10061935 Ga0070666_100619352 288
218 3300005338 Ga0068868_100000384 Ga0068868_10000038413 288
219 3300005338 Ga0068868_100152215 Ga0068868_1001522153 288
220 3300005344 Ga0070661_100005501 Ga0070661_1000055012 288
221 3300005344 Ga0070661_100097755 Ga0070661_1000977552 288
222 3300005347 Ga0070668_100047969 Ga0070668_1000479692 288
223 3300005353 Ga0070669_100508596 Ga0070669_1005085961 288
224 3300005355 Ga0070671_100002611 Ga0070671_1000026116 288
225 3300005367 Ga0070667_100002702 Ga0070667_1000027025 288
226 3300005435 Ga0070714_100115294 Ga0070714_1001152943 288
227 3300005436 Ga0070713_100011389 Ga0070713_1000113892 288
228 3300005456 Ga0070678_100206555 Ga0070678_1002065552 288
229 3300005535 Ga0070684_100000393 Ga0070684_10000039313 288
230 3300005535 Ga0070684_100000769 Ga0070684_10000076916 288
231 3300005535 Ga0070684_100265675 Ga0070684_1002656752 288
232 3300005543 Ga0070672_100229157 Ga0070672_1002291571 288
233 3300005548 Ga0070665_100002508 Ga0070665_1000025088 288
234 3300005548 Ga0070665_100207493 Ga0070665_1002074932 288
235 3300005563 Ga0068855_100000966 Ga0068855_10000096623 288
236 3300005563 Ga0068855_100001596 Ga0068855_10000159615 288
237 3300005563 Ga0068855_100051395 Ga0068855_1000513953 288
238 3300005563 Ga0068855_100186546 Ga0068855_1001865462 288
239 3300005563 Ga0068855_100442403 Ga0068855_1004424032 288
240 3300005577 Ga0068857_100009010 Ga0068857_1000090103 288
241 3300005577 Ga0068857_100034840 Ga0068857_1000348404 288
242 3300005577 Ga0068857_100245871 Ga0068857_1002458712 288
243 3300005578 Ga0068854_100054568 Ga0068854_1000545684 288
244 3300005578 Ga0068854_100147218 Ga0068854_1001472182 288
245 3300005614 Ga0068856_100001047 Ga0068856_10000104714 288
246 3300005614 Ga0068856_100002586 Ga0068856_1000025864 288
247 3300005614 Ga0068856_100016682 Ga0068856_1000166822 288
248 3300005614 Ga0068856_100094952 Ga0068856_1000949523 288
249 3300005616 Ga0068852_100000247 Ga0068852_10000024723 288
250 3300005616 Ga0068852_100009574 Ga0068852_1000095747 288
251 3300005616 Ga0068852_100063954 Ga0068852_1000639542 288
252 3300005617 Ga0068859_100018763 Ga0068859_1000187632 288
253 3300005618 Ga0068864_100001344 Ga0068864_1000013446 288
254 3300005834 Ga0068851_10006997 Ga0068851_100069972 288
255 3300005834 Ga0068851_10010762 Ga0068851_100107622 288
256 3300005841 Ga0068863_100000464 Ga0068863_10000046428 288
257 3300005841 Ga0068863_100077963 Ga0068863_1000779633 288
258 3300005842 Ga0068858_100002355 Ga0068858_10000235510 288
259 3300005842 Ga0068858_100272880 Ga0068858_1002728802 288
260 3300005843 Ga0068860_100000665 Ga0068860_10000066524 288
261 3300006028 Ga0070717_10001551 Ga0070717_100015519 288
262 3300006237 Ga0097621_100000983 Ga0097621_10000098310 288
263 3300006358 Ga0068871_100000648 Ga0068871_1000006489 288
264 3300006931 Ga0097620_100018763 Ga0097620_1000187632 288
265 3300009093 Ga0105240_10000187 Ga0105240_1000018758 288
266 3300009093 Ga0105240_10001148 Ga0105240_1000114814 288
267 3300009093 Ga0105240_10002927 Ga0105240_100029274 288
268 3300009098 Ga0105245_10001333 Ga0105245_100013338 288
269 3300009101 Ga0105247_10003250 Ga0105247_100032505 288
270 3300009101 Ga0105247_10159777 Ga0105247_101597772 288
271 3300009148 Ga0105243_10068597 Ga0105243_100685972 288
272 3300009174 Ga0105241_10000313 Ga0105241_100003134 288
273 3300009174 Ga0105241_10000472 Ga0105241_1000047210 288
274 3300009174 Ga0105241_10088645 Ga0105241_100886453 288
275 3300009174 Ga0105241_10189247 Ga0105241_101892471 288
276 3300009177 Ga0105248_10000011 Ga0105248_10000011117 288
277 3300009177 Ga0105248_10002466 Ga0105248_1000246613 288
278 3300009177 Ga0105248_10050299 Ga0105248_100502996 288
279 3300009545 Ga0105237_10325299 Ga0105237_103252992 288
280 3300009545 Ga0105237_10420181 Ga0105237_104201812 288
281 3300009551 Ga0105238_10000395 Ga0105238_1000039514 288
282 3300009551 Ga0105238_10002128 Ga0105238_1000212810 288
283 3300009553 Ga0105249_10042856 Ga0105249_100428562 288
284 3300010375 Ga0105239_10003500 Ga0105239_100035002 288
285 3300010375 Ga0105239_10004456 Ga0105239_100044566 288
286 3300011119 Ga0105246_10000383 Ga0105246_100003839 288
287 3300011119 Ga0105246_10117939 Ga0105246_101179391 288
288 3300013104 Ga0157370_10000066 Ga0157370_1000006657 288
289 3300013105 Ga0157369_10000188 Ga0157369_1000018833 288
290 3300013105 Ga0157369_10002371 Ga0157369_100023712 288
291 3300013105 Ga0157369_10006629 Ga0157369_1000662910 288
292 3300013105 Ga0157369_10008084 Ga0157369_100080843 288
293 3300013105 Ga0157369_10019768 Ga0157369_100197689 288
294 3300013105 Ga0157369_10026507 Ga0157369_100265076 288
295 3300013296 Ga0157374_10002414 Ga0157374_100024143 288
296 3300013296 Ga0157374_10004017 Ga0157374_100040178 288
297 3300013296 Ga0157374_10167391 Ga0157374_101673912 288
298 3300013296 Ga0157374_10217108 Ga0157374_102171082 288
299 3300013297 Ga0157378_10001685 Ga0157378_100016855 288
300 3300013297 Ga0157378_10086840 Ga0157378_100868403 288
301 3300013297 Ga0157378_10345138 Ga0157378_103451382 288
302 3300013306 Ga0163162_10002694 Ga0163162_100026942 288
303 3300013307 Ga0157372_10000114 Ga0157372_100001147 288
304 3300013307 Ga0157372_10002853 Ga0157372_100028534 288
305 3300013307 Ga0157372_10011455 Ga0157372_100114556 288
306 3300013307 Ga0157372_10091771 Ga0157372_100917713 288
307 3300013307 Ga0157372_10098253 Ga0157372_100982533 288
308 3300013307 Ga0157372_10118127 Ga0157372_101181274 288
309 3300013307 Ga0157372_10450490 Ga0157372_104504902 288
310 3300013308 Ga0157375_10000856 Ga0157375_1000085612 288
311 3300014325 Ga0163163_10000740 Ga0163163_1000074014 288
312 3300014325 Ga0163163_10281010 Ga0163163_102810102 288
313 3300014968 Ga0157379_10000286 Ga0157379_1000028623 288
314 3300014969 Ga0157376_10001538 Ga0157376_100015389 288
315 3300014969 Ga0157376_10027534 Ga0157376_100275342 288
316 3300014969 Ga0157376_10171032 Ga0157376_101710323 288
317 3300017792 Ga0163161_10006873 Ga0163161_100068731 288
318 3300021361 Ga0213872_10000931 Ga0213872_1000093118 288
319 3300021361 Ga0213872_10015269 Ga0213872_100152693 288
320 3300025321 Ga0207656_10004327 Ga0207656_100043272 288
321 3300025900 Ga0207710_10000299 Ga0207710_1000029921 288
322 3300025904 Ga0207647_10006183 Ga0207647_1000618311 288
323 3300025909 Ga0207705_10109631 Ga0207705_101096312 288
324 3300025911 Ga0207654_10000487 Ga0207654_1000048716 288
325 3300025911 Ga0207654_10145055 Ga0207654_101450552 288
326 3300025913 Ga0207695_10000052 Ga0207695_10000052256 288
327 3300025913 Ga0207695_10000108 Ga0207695_1000010874 288
328 3300025913 Ga0207695_10000253 Ga0207695_1000025372 288
329 3300025913 Ga0207695_10001120 Ga0207695_1000112025 288
330 3300025913 Ga0207695_10010544 Ga0207695_100105449 288
331 3300025913 Ga0207695_10010731 Ga0207695_100107315 288
332 3300025913 Ga0207695_10304036 Ga0207695_103040362 288
333 3300025914 Ga0207671_10000081 Ga0207671_1000008141 288
334 3300025919 Ga0207657_10030564 Ga0207657_100305643 288
335 3300025920 Ga0207649_10028029 Ga0207649_100280293 288
336 3300025924 Ga0207694_10000029 Ga0207694_10000029181 288
337 3300025924 Ga0207694_10000313 Ga0207694_1000031325 288
338 3300025924 Ga0207694_10003163 Ga0207694_100031638 288
339 3300025924 Ga0207694_10003655 Ga0207694_100036554 288
340 3300025925 Ga0207650_10037223 Ga0207650_100372234 288
341 3300025927 Ga0207687_10006866 Ga0207687_100068665 288
342 3300025928 Ga0207700_10006281 Ga0207700_100062814 288
343 3300025928 Ga0207700_10292877 Ga0207700_102928771 288
344 3300025929 Ga0207664_10090438 Ga0207664_100904383 288
345 3300025931 Ga0207644_10003761 Ga0207644_100037612 288
346 3300025940 Ga0207691_10138485 Ga0207691_101384852 288
347 3300025941 Ga0207711_10000028 Ga0207711_1000002854 288
348 3300025941 Ga0207711_10002491 Ga0207711_100024912 288
349 3300025941 Ga0207711_10022828 Ga0207711_100228284 288
350 3300025942 Ga0207689_10003619 Ga0207689_100036195 288
351 3300025942 Ga0207689_10026241 Ga0207689_100262412 288
352 3300025944 Ga0207661_10000229 Ga0207661_100002295 288
353 3300025944 Ga0207661_10036017 Ga0207661_100360172 288
354 3300025944 Ga0207661_10083651 Ga0207661_100836512 288
355 3300025949 Ga0207667_10003631 Ga0207667_100036315 288
356 3300025949 Ga0207667_10021791 Ga0207667_100217913 288
357 3300025949 Ga0207667_10088316 Ga0207667_100883163 288
358 3300025981 Ga0207640_10087044 Ga0207640_100870442 288
359 3300025981 Ga0207640_10127637 Ga0207640_101276372 288
360 3300025986 Ga0207658_10001177 Ga0207658_100011772 288
361 3300026023 Ga0207677_10000025 Ga0207677_1000002577 288
362 3300026023 Ga0207677_10000049 Ga0207677_1000004965 288
363 3300026023 Ga0207677_10204147 Ga0207677_102041472 288
364 3300026035 Ga0207703_10000516 Ga0207703_100005165 288
365 3300026041 Ga0207639_10000055 Ga0207639_1000005512 288
366 3300026067 Ga0207678_10153644 Ga0207678_101536441 288
367 3300026078 Ga0207702_10000341 Ga0207702_1000034127 288
368 3300026078 Ga0207702_10002856 Ga0207702_1000285611 288
369 3300026078 Ga0207702_10011207 Ga0207702_100112073 288
370 3300026078 Ga0207702_10099301 Ga0207702_100993012 288
371 3300026078 Ga0207702_10103574 Ga0207702_101035742 288
372 3300026078 Ga0207702_10393755 Ga0207702_103937552 288
373 3300026088 Ga0207641_10002209 Ga0207641_100022095 288
374 3300026088 Ga0207641_10188147 Ga0207641_101881472 288
375 3300026095 Ga0207676_10005540 Ga0207676_100055406 288
376 3300026116 Ga0207674_10013987 Ga0207674_100139873 288
377 3300026116 Ga0207674_10315300 Ga0207674_103153002 288
378 3300026121 Ga0207683_10000884 Ga0207683_1000088418 288
379 3300026142 Ga0207698_10000034 Ga0207698_1000003480 288
380 3300026142 Ga0207698_10000215 Ga0207698_1000021525 288
381 3300026142 Ga0207698_10056519 Ga0207698_100565193 288
382 3300028379 Ga0268266_10196579 Ga0268266_101965792 288
383 3300028381 Ga0268264_10000086 Ga0268264_1000008613 288
384 3300028381 Ga0268264_10109020 Ga0268264_101090203 288
385 3300028666 Ga0265336_10001257 Ga0265336_100012579 288
386 3300028800 Ga0265338_10112824 Ga0265338_101128243 288
387 3300029957 Ga0265324_10029440 Ga0265324_100294402 288
388 3300031239 Ga0265328_10012341 Ga0265328_100123414 288
389 3300031239 Ga0265328_10015519 Ga0265328_100155193 288
390 3300031241 Ga0265325_10004552 Ga0265325_100045526 288
391 3300031249 Ga0265339_10000028 Ga0265339_1000002889 288
392 3300031249 Ga0265339_10012509 Ga0265339_100125093 288
393 3300031344 Ga0265316_10022110 Ga0265316_100221106 288
394 3300031344 Ga0265316_10027782 Ga0265316_100277826 288
395 3300031344 Ga0265316_10075669 Ga0265316_100756693 288
396 3300031344 Ga0265316_10284836 Ga0265316_102848362 288
397 3300031595 Ga0265313_10030917 Ga0265313_100309172 288
398 3300031711 Ga0265314_10019349 Ga0265314_100193494 288
399 3300031711 Ga0265314_10091875 Ga0265314_100918752 288
400 3300031711 Ga0265314_10094363 Ga0265314_100943633 288
401 3300031712 Ga0265342_10003417 Ga0265342_100034178 288
402 3300035724 Ga0373933_0093101 Ga0373933_0093101_230_1117 288
403 3300036401 Ga0373937_0045037 Ga0373937_0045037_903_1787 288
404 3300037068 Ga0373925_0226193 Ga0373925_0226193_479_1363 288
405 3300037466 Ga0395898_0547928 Ga0395898_0547928_170_1066 288
406 3300039447 Ga0436361_0502386 Ga0436361_0502386_50_934 288
407 3300039447 Ga0436361_0947034 Ga0436361_0947034_4275_5162 288
408 3300044694 Ga0466963_0021416 Ga0466963_0021416_2284_3168 288
409 3300044842 Ga0466957_0135777 Ga0466957_0135777_447_1331 288
410 3300045976 Ga0466967_0001765 Ga0466967_0001765_7542_8426 288
411 3300046454 Ga0495592_0194793 Ga0495592_0194793_96_1031 288
412 3300046459 Ga0495629_0120306 Ga0495629_0120306_778_1662 288
413 3300046472 Ga0495580_0029869 Ga0495580_0029869_28_912 288
414 3300046520 Ga0495637_0121918 Ga0495637_0121918_101_982 288
415 3300046529 Ga0495652_0061333 Ga0495652_0061333_885_1769 288
416 3300046531 Ga0495665_0052505 Ga0495665_0052505_850_1734 288
417 3300046536 Ga0495587_0032591 Ga0495587_0032591_623_1507 288
418 3300046536 Ga0495587_0034499 Ga0495587_0034499_1049_1933 288
419 3300046543 Ga0495645_0028592 Ga0495645_0028592_680_1564 288
420 3300046679 Ga0495623_0123529 Ga0495623_0123529_183_1070 288
421 3300046680 Ga0495646_0087405 Ga0495646_0087405_372_1256 288
422 3300046689 Ga0495613_0012524 Ga0495613_0012524_3181_4065 288
423 3300046689 Ga0495613_0075314 Ga0495613_0075314_486_1370 288
424 3300046689 Ga0495613_0145453 Ga0495613_0145453_477_1361 288
425 3300047319 Ga0495674_0024866 Ga0495674_0024866_3885_4820 288
426 3300047319 Ga0495674_0375929 Ga0495674_0375929_159_1043 288
427 3300047471 Ga0495684_0176082 Ga0495684_0176082_235_1119 288
428 3300048903 Ga0496100_0305442 Ga0496100_0305442_184_1068 288
429 3300048907 Ga0496104_0021972 Ga0496104_0021972_3989_4873 288
430 3300048909 Ga0496106_0118883 Ga0496106_0118883_621_1505 288
431 3300048910 Ga0496107_0204368 Ga0496107_0204368_375_1259 288
432 3300048929 Ga0496126_0068841 Ga0496126_0068841_450_1355 288
433 3300053119 Ga0500595_019353 Ga0500595_019353_1270_2148 288
434 3300009093 Ga0105240_10360236 Ga0105240_103602362 290
435 2162886011 MRS1b_contig_7351479 MRS1b_0477.00001500 294
436 3300005290 Ga0065712_10097801 Ga0065712_100978012 294
437 3300050509 nmdc:mga0qj67_251128_c1 nmdc:mga0qj67_251128_c1_313_1197 294
438 3300050510 nmdc:mga06r32_291789_c1 nmdc:mga06r32_291789_c1_581_1465 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04069

OpuAC

Substrate binding domain of ABC-type glycine betaine transport system

68

350

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o66-assembly2.cif.gz_B crystal structure of glycine betaine/carnitine/choline abc transporter 0.9638 22 287
6efr-assembly1.cif.gz_A crystal structure of inicsnfr 1.0 0.952 19 287
3o66-assembly1.cif.gz_A crystal structure of glycine betaine/carnitine/choline abc transporter 0.9517 21 287
7s7w-assembly1.cif.gz_A crystal structure of inicsnfr3a nicotine sensor precursor binding protein 0.9466 21 287
4z7e-assembly2.cif.gz_B soluble binding domain of lmo1422 abc-transporter 0.9412 21 287
ID Description Score Start End Superfamily
af_Q2FVH0_34_306_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9656 22 287 3.40.190.10
af_Q2FVH0_34_306_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.938 22 287 3.40.190.10
5nxyC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9369 21 287 3.40.190.10
3ppnA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Osmoprotection protein (prox); domain 2 0.9346 123 227 3.40.190.120
4z7eB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9328 21 287 3.40.190.10
ID Description Score Start End GO Terms
AF-J9HQ39-F1-model_v4 deleted 0.9799 37 287
AF-A0A4Z0RAK3-F1-model_v4 Glycine/betaine ABC transporter substrate-binding protein 0.9765 62 287 GO:0022857
GO:0043190
AF-A0A4Q2WGU3-F1-model_v4 deleted 0.9763 85 287
AF-A0A2V7YWI5-F1-model_v4 ABC transporter permease 0.9758 86 285 GO:0022857
GO:0031460
GO:0043190
AF-A0A285BD77-F1-model_v4 Osmoprotectant transport system substrate-binding protein 0.9755 37 287 GO:0022857
GO:0043190

Feature Viewer

pLDDT pTM Quality
92.16 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map