F443948

General Info

Members Datasets Scaffolds Average Seq Length
438 269 876 107

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_101845838|Ga0070686_1018458381
Length 115
Sequence MQRICFRLQLKLDRLAEYEARHAAVWPEMLDALRDTGWTNYSLFVDRRDGTLIGYFETDDLEAARAGMAAREVNARWQAEMAGFFQDIDGRPPDQGFLRLDEIFRLQPSSATAPA

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
170 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
171 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
172 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
173 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
174 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
176 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
184 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
192 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
193 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
201 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
217 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
218 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
219 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
230 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
238 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
239 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
265 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 2867369537 Streptomyces sp. Z26 Isolate Unclassified
269 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 0.91
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.08
Rhizosphere 90.41
Stem 0
Stem Tuber 0
Unclassified 1.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_101845838 3300005544 Bacteria 515
2 ARcpr5oldR_c026485 3300000041 Bacteria 535
3 JGI24739J22299_10071903 3300001989 Bacteria 1075
4 JGI24737J22298_10009841 3300001990 Bacteria 3167
5 JGI24743J22301_10163618 3300001991 Bacteria 503
6 JGI24748J21848_1034830 3300002074 Bacteria 630
7 JGI24738J21930_10054193 3300002075 Bacteria 819
8 JGI25406J46586_10011110 3300003203 Bacteria 3961
9 Ga0070658_10287750 3300005327 Bacteria 1400
10 Ga0070658_10869598 3300005327 Bacteria 784
11 Ga0070676_10900267 3300005328 Bacteria 659
12 Ga0070683_100048938 3300005329 Bacteria 3908
13 Ga0070683_100501300 3300005329 Bacteria 1160
14 Ga0070690_100203791 3300005330 Bacteria 1378
15 Ga0070670_100503628 3300005331 Bacteria 1077
16 Ga0070670_101194756 3300005331 Bacteria 695
17 Ga0068869_100391827 3300005334 Bacteria 1141
18 Ga0070680_100086618 3300005336 Bacteria 2589
19 Ga0070682_100090524 3300005337 Bacteria 2001
20 Ga0070682_100174228 3300005337 Bacteria 1497
21 Ga0068868_100040144 3300005338 Bacteria 3641
22 Ga0068868_100632461 3300005338 Bacteria 951
23 Ga0068868_100712396 3300005338 Bacteria 899
24 Ga0068868_101803761 3300005338 Bacteria 578
25 Ga0070660_100098928 3300005339 Bacteria 2309
26 Ga0070660_100250763 3300005339 Bacteria 1443
27 Ga0070689_100060215 3300005340 Bacteria 2951
28 Ga0070689_102002076 3300005340 Bacteria 530
29 Ga0070691_10113971 3300005341 Bacteria 1355
30 Ga0070691_10268889 3300005341 Bacteria 921
31 Ga0070687_100163164 3300005343 Bacteria 1319
32 Ga0070661_100287510 3300005344 Bacteria 1277
33 Ga0070692_10019737 3300005345 Bacteria 3258
34 Ga0070692_11373181 3300005345 Bacteria 509
35 Ga0070668_100272471 3300005347 Bacteria 1411
36 Ga0070668_102190900 3300005347 Bacteria 511
37 Ga0070669_101838725 3300005353 Bacteria 529
38 Ga0070674_100465985 3300005356 Bacteria 1046
39 Ga0070674_101228669 3300005356 Bacteria 666
40 Ga0070673_100085092 3300005364 Bacteria 2573
41 Ga0070659_100123193 3300005366 Bacteria 2102
42 Ga0070659_100625966 3300005366 Bacteria 926
43 Ga0070667_100517464 3300005367 Bacteria 1095
44 Ga0070703_10132798 3300005406 Bacteria 916
45 Ga0070714_100002451 3300005435 Bacteria 13696
46 Ga0070714_100588695 3300005435 Bacteria 1067
47 Ga0070713_100992809 3300005436 Bacteria 810
48 Ga0070701_10076129 3300005438 Bacteria 1806
49 Ga0070711_100271252 3300005439 Bacteria 1339
50 Ga0070705_100141522 3300005440 Bacteria 1584
51 Ga0070705_100924548 3300005440 Bacteria 703
52 Ga0070700_100027312 3300005441 Bacteria 3383
53 Ga0070700_100276220 3300005441 Bacteria 1216
54 Ga0070694_100565611 3300005444 Bacteria 912
55 Ga0070694_101067145 3300005444 Bacteria 673
56 Ga0070663_100078442 3300005455 Bacteria 2421
57 Ga0070663_100323418 3300005455 Bacteria 1241
58 Ga0070663_101149819 3300005455 Bacteria 680
59 Ga0070663_101747391 3300005455 Bacteria 557
60 Ga0070678_100303888 3300005456 Bacteria 1357
61 Ga0070681_10015466 3300005458 Bacteria 7598
62 Ga0068867_100303252 3300005459 Bacteria 1317
63 Ga0070685_10058428 3300005466 Bacteria 2248
64 Ga0070685_10653244 3300005466 Bacteria 762
65 Ga0070679_100027772 3300005530 Bacteria 5573
66 Ga0070684_100383656 3300005535 Bacteria 1294
67 Ga0068853_100770891 3300005539 Bacteria 920
68 Ga0070686_100113131 3300005544 Bacteria 1852
69 Ga0070695_100244608 3300005545 Bacteria 1303
70 Ga0070696_100151241 3300005546 Bacteria 1704
71 Ga0070696_100975759 3300005546 Bacteria 707
72 Ga0070665_100301698 3300005548 Bacteria 1605
73 Ga0070665_100319618 3300005548 Bacteria 1556
74 Ga0070704_100053417 3300005549 Bacteria 2855
75 Ga0068855_100040246 3300005563 Bacteria 5548
76 Ga0068855_100898065 3300005563 Bacteria 936
77 Ga0070664_100492790 3300005564 Bacteria 1129
78 Ga0068857_100336147 3300005577 Bacteria 1397
79 Ga0068857_100385834 3300005577 Bacteria 1301
80 Ga0068857_101068112 3300005577 Bacteria 779
81 Ga0068854_100053480 3300005578 Bacteria 2900
82 Ga0068854_100180613 3300005578 Unclassified 1648
83 Ga0068854_100410346 3300005578 Bacteria 1123
84 Ga0068856_100703567 3300005614 Bacteria 1031
85 Ga0068856_101196013 3300005614 Bacteria 776
86 Ga0070702_100046191 3300005615 Bacteria 2467
87 Ga0070702_100445865 3300005615 Bacteria 938
88 Ga0070702_101767290 3300005615 Bacteria 516
89 Ga0068852_100047304 3300005616 Bacteria 3670
90 Ga0068852_101019408 3300005616 Bacteria 847
91 Ga0068852_102407899 3300005616 Bacteria 547
92 Ga0068864_100148641 3300005618 Bacteria 2120
93 Ga0068864_100972768 3300005618 Bacteria 841
94 Ga0068864_101721939 3300005618 Bacteria 632
95 Ga0068866_10196745 3300005718 Bacteria 1202
96 Ga0068861_100033772 3300005719 Bacteria 3777
97 Ga0068861_100051844 3300005719 Bacteria 3117
98 Ga0068861_101766121 3300005719 Bacteria 613
99 Ga0068851_10247253 3300005834 Bacteria 1011
100 Ga0068851_10933207 3300005834 Bacteria 545
101 Ga0068870_10105627 3300005840 Bacteria 1599
102 Ga0068858_100163126 3300005842 Bacteria 2099
103 Ga0068858_100314048 3300005842 Bacteria 1497
104 Ga0068858_101213196 3300005842 Bacteria 742
105 Ga0068860_100152360 3300005843 Bacteria 2227
106 Ga0068862_100079446 3300005844 Bacteria 2843
107 Ga0081455_10282559 3300005937 Bacteria 1198
108 Ga0081540_1018523 3300005983 Bacteria 4266
109 Ga0081539_10004773 3300005985 Bacteria 14621
110 Ga0070717_10425748 3300006028 Bacteria 1194
111 Ga0075432_10549088 3300006058 Bacteria 522
112 Ga0070712_100039257 3300006175 Bacteria 3239
113 Ga0097621_100710828 3300006237 Bacteria 926
114 Ga0068871_100582942 3300006358 Bacteria 1016
115 Ga0075428_101645424 3300006844 Bacteria 671
116 Ga0075428_102083640 3300006844 Bacteria 587
117 Ga0075428_102277473 3300006844 Bacteria 558
118 Ga0075431_100047797 3300006847 Bacteria 4412
119 Ga0075433_11367435 3300006852 Bacteria 613
120 Ga0068865_100069070 3300006881 Bacteria 2499
121 Ga0068865_100409951 3300006881 Bacteria 1112
122 Ga0075435_100288864 3300007076 Bacteria 1401
123 Ga0075435_101433861 3300007076 Bacteria 605
124 Ga0105251_10021118 3300009011 Bacteria 3406
125 Ga0105251_10363582 3300009011 Bacteria 661
126 Ga0105244_10191018 3300009036 Bacteria 968
127 Ga0105250_10013245 3300009092 Bacteria 3395
128 Ga0105250_10548467 3300009092 Bacteria 530
129 Ga0105240_10658529 3300009093 Bacteria 1147
130 Ga0105240_10756310 3300009093 Bacteria 1056
131 Ga0111539_10552462 3300009094 Bacteria 1341
132 Ga0105245_10002486 3300009098 Bacteria 16658
133 Ga0105245_10143754 3300009098 Bacteria 2249
134 Ga0105245_10158446 3300009098 Bacteria 2146
135 Ga0105245_10683653 3300009098 Bacteria 1058
136 Ga0105247_10196946 3300009101 Bacteria 1352
137 Ga0105247_10900905 3300009101 Bacteria 683
138 Ga0105247_11237402 3300009101 Bacteria 596
139 Ga0105243_10061845 3300009148 Bacteria 2996
140 Ga0105243_10138546 3300009148 Bacteria 2073
141 Ga0105241_10938785 3300009174 Unclassified 806
142 Ga0105242_10199938 3300009176 Bacteria 1775
143 Ga0105242_10710064 3300009176 Bacteria 985
144 Ga0105242_11462864 3300009176 Bacteria 713
145 Ga0105248_10011727 3300009177 Bacteria 9665
146 Ga0105248_10245451 3300009177 Bacteria 2016
147 Ga0105248_11283572 3300009177 Bacteria 828
148 Ga0105238_11926279 3300009551 Bacteria 624
149 Ga0105249_10047319 3300009553 Bacteria 3919
150 Ga0105249_10514436 3300009553 Bacteria 1244
151 Ga0105249_10711142 3300009553 Bacteria 1065
152 Ga0105239_10283702 3300010375 Bacteria 1864
153 Ga0105239_10496074 3300010375 Bacteria 1388
154 Ga0105239_10571391 3300010375 Bacteria 1288
155 Ga0105239_11939201 3300010375 Bacteria 683
156 Ga0105246_10028833 3300011119 Bacteria 3649
157 Ga0105246_10058716 3300011119 Bacteria 2666
158 Ga0105246_10562239 3300011119 Bacteria 979
159 Ga0105246_10838978 3300011119 Bacteria 819
160 Ga0157373_10425915 3300013100 Bacteria 953
161 Ga0157371_11104530 3300013102 Bacteria 608
162 Ga0157370_10028880 3300013104 Bacteria 5452
163 Ga0157369_10086778 3300013105 Bacteria 3342
164 Ga0157369_10495840 3300013105 Bacteria 1264
165 Ga0157369_10704860 3300013105 Bacteria 1039
166 Ga0157369_11015643 3300013105 Bacteria 849
167 Ga0157374_11467945 3300013296 Bacteria 705
168 Ga0157378_11430500 3300013297 Bacteria 735
169 Ga0157378_12878771 3300013297 Bacteria 533
170 Ga0157378_13072617 3300013297 Bacteria 518
171 Ga0163162_10153062 3300013306 Bacteria 2425
172 Ga0163162_10205555 3300013306 Bacteria 2098
173 Ga0163162_10305509 3300013306 Bacteria 1723
174 Ga0163162_10836748 3300013306 Bacteria 1036
175 Ga0163162_12205853 3300013306 Bacteria 632
176 Ga0163162_12844136 3300013306 Bacteria 557
177 Ga0157372_10621512 3300013307 Bacteria 1259
178 Ga0157372_11208097 3300013307 Bacteria 874
179 Ga0157372_11800468 3300013307 Bacteria 704
180 Ga0157372_11866644 3300013307 Bacteria 691
181 Ga0157375_10287229 3300013308 Bacteria 1808
182 Ga0157375_10976589 3300013308 Bacteria 988
183 Ga0157375_11017483 3300013308 Bacteria 968
184 Ga0163163_11491490 3300014325 Bacteria 738
185 Ga0163163_11592777 3300014325 Bacteria 714
186 Ga0163163_11716499 3300014325 Bacteria 688
187 Ga0157380_10257423 3300014326 Bacteria 1583
188 Ga0157380_10990536 3300014326 Bacteria 873
189 Ga0157380_13359372 3300014326 Bacteria 512
190 Ga0182008_10136474 3300014497 Bacteria 1225
191 Ga0157377_10067403 3300014745 Bacteria 2061
192 Ga0157377_10082753 3300014745 Bacteria 1879
193 Ga0157377_10346985 3300014745 Bacteria 995
194 Ga0157377_10591528 3300014745 Bacteria 790
195 Ga0157379_10128094 3300014968 Bacteria 2284
196 Ga0157379_11689100 3300014968 Unclassified 620
197 Ga0157376_10238932 3300014969 Bacteria 1692
198 Ga0157376_10774174 3300014969 Bacteria 970
199 Ga0163161_11192372 3300017792 Bacteria 658
200 Ga0206356_10648542 3300020070 Bacteria 1036
201 Ga0206353_10460900 3300020082 Bacteria 2336
202 Ga0207656_10032955 3300025321 Bacteria 2155
203 Ga0207642_10463625 3300025899 Bacteria 770
204 Ga0207710_10103100 3300025900 Bacteria 1348
205 Ga0207710_10259367 3300025900 Bacteria 871
206 Ga0207688_10173536 3300025901 Bacteria 1283
207 Ga0207647_10018160 3300025904 Bacteria 4765
208 Ga0207647_10033644 3300025904 Bacteria 3281
209 Ga0207645_10147789 3300025907 Bacteria 1533
210 Ga0207643_10059726 3300025908 Bacteria 2175
211 Ga0207705_10062326 3300025909 Bacteria 2693
212 Ga0207705_10288553 3300025909 Bacteria 1257
213 Ga0207654_10729736 3300025911 Bacteria 713
214 Ga0207707_10289101 3300025912 Bacteria 1418
215 Ga0207695_10476734 3300025913 Bacteria 1130
216 Ga0207695_11195425 3300025913 Bacteria 640
217 Ga0207693_10039264 3300025915 Bacteria 3727
218 Ga0207663_10204304 3300025916 Bacteria 1427
219 Ga0207660_10081439 3300025917 Bacteria 2379
220 Ga0207660_10363919 3300025917 Bacteria 1160
221 Ga0207662_10030143 3300025918 Bacteria 3147
222 Ga0207662_11338193 3300025918 Bacteria 509
223 Ga0207657_10013529 3300025919 Bacteria 8003
224 Ga0207649_10224021 3300025920 Bacteria 1341
225 Ga0207649_10717269 3300025920 Bacteria 776
226 Ga0207652_10079992 3300025921 Bacteria 2856
227 Ga0207681_10136361 3300025923 Bacteria 1822
228 Ga0207694_10593874 3300025924 Bacteria 931
229 Ga0207650_10094321 3300025925 Bacteria 2292
230 Ga0207650_11241853 3300025925 Bacteria 634
231 Ga0207659_10307876 3300025926 Bacteria 1303
232 Ga0207687_10002252 3300025927 Bacteria 13147
233 Ga0207687_10074683 3300025927 Bacteria 2431
234 Ga0207687_10375877 3300025927 Bacteria 1163
235 Ga0207687_10782559 3300025927 Bacteria 813
236 Ga0207700_11088877 3300025928 Bacteria 714
237 Ga0207664_10413738 3300025929 Bacteria 1200
238 Ga0207644_10011504 3300025931 Bacteria 5857
239 Ga0207690_10096642 3300025932 Bacteria 2101
240 Ga0207690_10571738 3300025932 Bacteria 920
241 Ga0207690_10685650 3300025932 Bacteria 842
242 Ga0207690_10993127 3300025932 Bacteria 698
243 Ga0207706_10516037 3300025933 Bacteria 1031
244 Ga0207686_10158652 3300025934 Bacteria 1583
245 Ga0207686_10222017 3300025934 Bacteria 1365
246 Ga0207686_10330719 3300025934 Bacteria 1141
247 Ga0207709_10041927 3300025935 Bacteria 2750
248 Ga0207709_10856314 3300025935 Bacteria 737
249 Ga0207669_10101207 3300025937 Bacteria 1906
250 Ga0207704_10448627 3300025938 Bacteria 1029
251 Ga0207704_10696238 3300025938 Bacteria 841
252 Ga0207704_11751931 3300025938 Bacteria 534
253 Ga0207691_10272129 3300025940 Bacteria 1458
254 Ga0207711_10007588 3300025941 Bacteria 9075
255 Ga0207711_10377363 3300025941 Bacteria 1315
256 Ga0207711_10845195 3300025941 Bacteria 852
257 Ga0207689_10058363 3300025942 Bacteria 3174
258 Ga0207661_10022120 3300025944 Bacteria 4781
259 Ga0207661_11262871 3300025944 Bacteria 679
260 Ga0207661_11303405 3300025944 Bacteria 667
261 Ga0207667_10041362 3300025949 Bacteria 4902
262 Ga0207667_10287349 3300025949 Unclassified 1680
263 Ga0207667_10812806 3300025949 Bacteria 931
264 Ga0207651_10863793 3300025960 Bacteria 804
265 Ga0207712_10466813 3300025961 Bacteria 1073
266 Ga0207712_11031442 3300025961 Bacteria 731
267 Ga0207712_11451196 3300025961 Bacteria 614
268 Ga0207668_10256660 3300025972 Bacteria 1422
269 Ga0207640_10281214 3300025981 Bacteria 1307
270 Ga0207640_10625846 3300025981 Bacteria 914
271 Ga0207658_10454775 3300025986 Bacteria 1134
272 Ga0207677_10141066 3300026023 Bacteria 1845
273 Ga0207677_10443700 3300026023 Bacteria 1110
274 Ga0207703_10298432 3300026035 Bacteria 1469
275 Ga0207639_10974695 3300026041 Bacteria 794
276 Ga0207678_10099440 3300026067 Bacteria 2485
277 Ga0207678_10277047 3300026067 Bacteria 1439
278 Ga0207678_10645057 3300026067 Bacteria 930
279 Ga0207678_10732866 3300026067 Bacteria 871
280 Ga0207678_10963164 3300026067 Bacteria 755
281 Ga0207708_10010112 3300026075 Bacteria 7006
282 Ga0207708_10222878 3300026075 Bacteria 1511
283 Ga0207702_10716580 3300026078 Bacteria 986
284 Ga0207641_10789506 3300026088 Bacteria 939
285 Ga0207648_10057536 3300026089 Bacteria 3392
286 Ga0207676_10043222 3300026095 Bacteria 3468
287 Ga0207676_10689322 3300026095 Bacteria 989
288 Ga0207676_12117771 3300026095 Bacteria 561
289 Ga0207674_10058620 3300026116 Bacteria 3899
290 Ga0207674_10081491 3300026116 Bacteria 3238
291 Ga0207674_10118486 3300026116 Bacteria 2617
292 Ga0207675_100040408 3300026118 Bacteria 4356
293 Ga0207675_102542412 3300026118 Bacteria 522
294 Ga0207675_102672898 3300026118 Bacteria 508
295 Ga0207683_10212272 3300026121 Bacteria 1762
296 Ga0207683_11189578 3300026121 Bacteria 707
297 Ga0207683_11517401 3300026121 Bacteria 619
298 Ga0207698_10082503 3300026142 Bacteria 2599
299 Ga0207698_10911696 3300026142 Bacteria 886
300 Ga0207428_10455110 3300027907 Bacteria 933
301 Ga0268266_10104868 3300028379 Bacteria 2497
302 Ga0268264_10138997 3300028381 Bacteria 2163
303 Ga0265319_1025377 3300028563 Bacteria 2121
304 Ga0265319_1145182 3300028563 Bacteria 735
305 Ga0265318_10071955 3300028577 Bacteria 1281
306 Ga0265318_10091499 3300028577 Bacteria 1120
307 Ga0265322_10045858 3300028654 Bacteria 1243
308 Ga0265338_10151878 3300028800 Bacteria 1798
309 Ga0265338_10547230 3300028800 Bacteria 811
310 Ga0265338_10910755 3300028800 Bacteria 598
311 Ga0307512_10304492 3300030522 Bacteria 739
312 Ga0265760_10240619 3300031090 Unclassified 623
313 Ga0265332_10313485 3300031238 Bacteria 648
314 Ga0265332_10403218 3300031238 Bacteria 565
315 Ga0265320_10053530 3300031240 Bacteria 1950
316 Ga0265320_10086827 3300031240 Bacteria 1454
317 Ga0265325_10013038 3300031241 Bacteria 4739
318 Ga0265339_10022444 3300031249 Bacteria 3659
319 Ga0265316_10779257 3300031344 Bacteria 671
320 Ga0265316_10927611 3300031344 Bacteria 608
321 Ga0307513_10727418 3300031456 Bacteria 698
322 Ga0307516_10281395 3300031730 Bacteria 1345
323 Ga0307413_10255005 3300031824 Bacteria 1304
324 Ga0307518_10544002 3300031838 Bacteria 578
325 Ga0307410_11626331 3300031852 Bacteria 571
326 Ga0307406_10096725 3300031901 Bacteria 2001
327 Ga0307412_11492617 3300031911 Bacteria 614
328 Ga0307409_100074579 3300031995 Bacteria 2712
329 Ga0307409_100917952 3300031995 Bacteria 890
330 Ga0307416_100355306 3300032002 Bacteria 1485
331 Ga0307416_100434267 3300032002 Bacteria 1361
332 Ga0307416_101899495 3300032002 Bacteria 699
333 Ga0307416_101983242 3300032002 Bacteria 685
334 Ga0307416_102623150 3300032002 Bacteria 601
335 Ga0307414_10469091 3300032004 Bacteria 1108
336 Ga0307411_10108034 3300032005 Bacteria 1984
337 Ga0307415_100863582 3300032126 Bacteria 831
338 Ga0307415_101278123 3300032126 Bacteria 694
339 Ga0307507_10008257 3300033179 Bacteria 14528
340 Ga0373959_0041292 3300034820 Bacteria 969
341 Ga0373931_0263345 3300035691 Bacteria 1053
342 Ga0373925_1169847 3300037068 Bacteria 632
343 Ga0395898_1274023 3300037466 Bacteria 665
344 Ga0395898_1853542 3300037466 Bacteria 524
345 Ga0395901_0685100 3300038443 Bacteria 1024
346 Ga0436365_0472288 3300039437 Bacteria 1608
347 Ga0436365_1519608 3300039437 Bacteria 682
348 Ga0436363_0401352 3300039450 Unclassified 604
349 Ga0451791_0002390 3300041451 Bacteria 3795
350 Ga0451853_3650971 3300041512 Bacteria 594
351 Ga0466963_0943415 3300044694 Bacteria 608
352 Ga0466970_0277165 3300044765 Bacteria 943
353 Ga0466960_0513136 3300044901 Bacteria 703
354 Ga0466960_0838905 3300044901 Bacteria 558
355 Ga0466967_0038355 3300045976 Bacteria 4108
356 Ga0466967_0152001 3300045976 Bacteria 2165
357 Ga0466967_0460615 3300045976 Bacteria 1244
358 Ga0466967_0720213 3300045976 Unclassified 989
359 Ga0495592_0003592 3300046454 Bacteria 11151
360 Ga0495590_0131985 3300046457 Bacteria 899
361 Ga0495651_0006233 3300046462 Bacteria 9119
362 Ga0495653_0183528 3300046463 Bacteria 1433
363 Ga0495580_0610304 3300046472 Bacteria 720
364 Ga0495662_0003531 3300046476 Bacteria 7898
365 Ga0495664_0375102 3300046477 Bacteria 855
366 Ga0495606_0000991 3300046507 Bacteria 41385
367 Ga0495608_0012341 3300046511 Bacteria 5934
368 Ga0495628_0042989 3300046516 Bacteria 3601
369 Ga0495630_0123707 3300046517 Bacteria 1962
370 Ga0495666_0013107 3300046526 Bacteria 4130
371 Ga0495652_0090724 3300046529 Bacteria 2499
372 Ga0495665_0008516 3300046531 Bacteria 5567
373 Ga0495640_0021977 3300046533 Bacteria 4671
374 Ga0495587_0022264 3300046536 Bacteria 3902
375 Ga0495645_0205849 3300046543 Bacteria 1331
376 Ga0495667_0020898 3300046559 Bacteria 4417
377 Ga0495668_0000569 3300046616 Bacteria 45332
378 Ga0495625_0000630 3300046660 Bacteria 50920
379 Ga0495635_0054787 3300046663 Bacteria 2746
380 Ga0495657_0035729 3300046675 Bacteria 3441
381 Ga0495599_0097337 3300046678 Bacteria 1834
382 Ga0495646_0001195 3300046680 Bacteria 15189
383 Ga0495658_0519252 3300046683 Bacteria 762
384 Ga0495613_0019054 3300046689 Bacteria 5114
385 Ga0495600_0032996 3300046809 Bacteria 3360
386 Ga0495581_0223099 3300047315 Bacteria 1102
387 Ga0495604_0001837 3300047317 Bacteria 17283
388 Ga0495674_0197390 3300047319 Bacteria 1670
389 Ga0495672_0531570 3300047320 Bacteria 518
390 Ga0495687_002377 3300047443 Bacteria 15202
391 Ga0495677_0384775 3300047445 Bacteria 555
392 Ga0495684_0163113 3300047471 Bacteria 1661
393 Ga0495602_0022017 3300048088 Bacteria 6250
394 Ga0495626_0000380 3300048091 Bacteria 46101
395 Ga0496100_0320051 3300048903 Bacteria 1165
396 Ga0496100_0715270 3300048903 Bacteria 782
397 Ga0496101_0669907 3300048904 Bacteria 819
398 Ga0496102_0056518 3300048905 Bacteria 3580
399 Ga0496102_0242824 3300048905 Bacteria 1698
400 Ga0496102_1338806 3300048905 Bacteria 635
401 Ga0496103_0145785 3300048906 Bacteria 1515
402 Ga0496103_0296688 3300048906 Bacteria 1040
403 Ga0496104_0917789 3300048907 Bacteria 780
404 Ga0496105_0231002 3300048908 Bacteria 1503
405 Ga0496106_0011590 3300048909 Bacteria 6515
406 Ga0496106_0102049 3300048909 Bacteria 2225
407 Ga0496106_0371295 3300048909 Bacteria 1149
408 Ga0496107_0633910 3300048910 Bacteria 788
409 Ga0496107_0809752 3300048910 Bacteria 686
410 Ga0496108_0141615 3300048911 Bacteria 2072
411 Ga0496108_0210458 3300048911 Bacteria 1688
412 Ga0496109_0136591 3300048912 Bacteria 2291
413 Ga0496109_0163080 3300048912 Bacteria 2088
414 Ga0496110_0314299 3300048913 Bacteria 1426
415 Ga0496110_0395346 3300048913 Bacteria 1260
416 Ga0496110_0735723 3300048913 Bacteria 889
417 Ga0496110_1463165 3300048913 Bacteria 593
418 Ga0496111_0290846 3300048914 Bacteria 1211
419 Ga0496112_0915711 3300048915 Bacteria 798
420 Ga0496112_1441524 3300048915 Bacteria 603
421 Ga0496113_0601533 3300048916 Bacteria 880
422 Ga0496114_0171262 3300048917 Bacteria 1892
423 Ga0496115_0087569 3300048918 Bacteria 2541
424 Ga0496115_0132225 3300048918 Bacteria 2057
425 Ga0496126_0039716 3300048929 Bacteria 4365
426 Ga0501067_0307854 3300049583 Bacteria 882
427 Ga0501083_0087968 3300049744 Bacteria 2054
428 nmdc:mga06r32_56667_c1 3300050510 Bacteria 3762
429 nmdc:mga08y16_748382_c1 3300050511 Bacteria 974
430 nmdc:mga08y16_939850_c1 3300050511 Bacteria 848
431 nmdc:mga0rr50_277702_c1 3300050513 Bacteria 1397
432 nmdc:mga0rr50_771630_c1 3300050513 Bacteria 820
433 Ga0495601_0003101 3300053077 Bacteria 9490
434 Ga0495612_0322931 3300053078 Bacteria 694
435 Ga0495619_0453840 3300053085 Bacteria 883
436 Ga0587082_157735 3300059504 Bacteria 542
437 2867373272 2867369537 Bacteria 6501581
438 2905929597 2905926851 Bacteria 4423176
439 Ga0070686_101845838
440 ARcpr5oldR_c026485
441 JGI24739J22299_10071903
442 JGI24737J22298_10009841
443 JGI24743J22301_10163618
444 JGI24748J21848_1034830
445 JGI24738J21930_10054193
446 JGI25406J46586_10011110
447 Ga0070658_10287750
448 Ga0070658_10869598
449 Ga0070676_10900267
450 Ga0070683_100048938
451 Ga0070683_100501300
452 Ga0070690_100203791
453 Ga0070670_100503628
454 Ga0070670_101194756
455 Ga0068869_100391827
456 Ga0070680_100086618
457 Ga0070682_100090524
458 Ga0070682_100174228
459 Ga0068868_100040144
460 Ga0068868_100632461
461 Ga0068868_100712396
462 Ga0068868_101803761
463 Ga0070660_100098928
464 Ga0070660_100250763
465 Ga0070689_100060215
466 Ga0070689_102002076
467 Ga0070691_10113971
468 Ga0070691_10268889
469 Ga0070687_100163164
470 Ga0070661_100287510
471 Ga0070692_10019737
472 Ga0070692_11373181
473 Ga0070668_100272471
474 Ga0070668_102190900
475 Ga0070669_101838725
476 Ga0070674_100465985
477 Ga0070674_101228669
478 Ga0070673_100085092
479 Ga0070659_100123193
480 Ga0070659_100625966
481 Ga0070667_100517464
482 Ga0070703_10132798
483 Ga0070714_100002451
484 Ga0070714_100588695
485 Ga0070713_100992809
486 Ga0070701_10076129
487 Ga0070711_100271252
488 Ga0070705_100141522
489 Ga0070705_100924548
490 Ga0070700_100027312
491 Ga0070700_100276220
492 Ga0070694_100565611
493 Ga0070694_101067145
494 Ga0070663_100078442
495 Ga0070663_100323418
496 Ga0070663_101149819
497 Ga0070663_101747391
498 Ga0070678_100303888
499 Ga0070681_10015466
500 Ga0068867_100303252
501 Ga0070685_10058428
502 Ga0070685_10653244
503 Ga0070679_100027772
504 Ga0070684_100383656
505 Ga0068853_100770891
506 Ga0070686_100113131
507 Ga0070695_100244608
508 Ga0070696_100151241
509 Ga0070696_100975759
510 Ga0070665_100301698
511 Ga0070665_100319618
512 Ga0070704_100053417
513 Ga0068855_100040246
514 Ga0068855_100898065
515 Ga0070664_100492790
516 Ga0068857_100336147
517 Ga0068857_100385834
518 Ga0068857_101068112
519 Ga0068854_100053480
520 Ga0068854_100180613
521 Ga0068854_100410346
522 Ga0068856_100703567
523 Ga0068856_101196013
524 Ga0070702_100046191
525 Ga0070702_100445865
526 Ga0070702_101767290
527 Ga0068852_100047304
528 Ga0068852_101019408
529 Ga0068852_102407899
530 Ga0068864_100148641
531 Ga0068864_100972768
532 Ga0068864_101721939
533 Ga0068866_10196745
534 Ga0068861_100033772
535 Ga0068861_100051844
536 Ga0068861_101766121
537 Ga0068851_10247253
538 Ga0068851_10933207
539 Ga0068870_10105627
540 Ga0068858_100163126
541 Ga0068858_100314048
542 Ga0068858_101213196
543 Ga0068860_100152360
544 Ga0068862_100079446
545 Ga0081455_10282559
546 Ga0081540_1018523
547 Ga0081539_10004773
548 Ga0070717_10425748
549 Ga0075432_10549088
550 Ga0070712_100039257
551 Ga0097621_100710828
552 Ga0068871_100582942
553 Ga0075428_101645424
554 Ga0075428_102083640
555 Ga0075428_102277473
556 Ga0075431_100047797
557 Ga0075433_11367435
558 Ga0068865_100069070
559 Ga0068865_100409951
560 Ga0075435_100288864
561 Ga0075435_101433861
562 Ga0105251_10021118
563 Ga0105251_10363582
564 Ga0105244_10191018
565 Ga0105250_10013245
566 Ga0105250_10548467
567 Ga0105240_10658529
568 Ga0105240_10756310
569 Ga0111539_10552462
570 Ga0105245_10002486
571 Ga0105245_10143754
572 Ga0105245_10158446
573 Ga0105245_10683653
574 Ga0105247_10196946
575 Ga0105247_10900905
576 Ga0105247_11237402
577 Ga0105243_10061845
578 Ga0105243_10138546
579 Ga0105241_10938785
580 Ga0105242_10199938
581 Ga0105242_10710064
582 Ga0105242_11462864
583 Ga0105248_10011727
584 Ga0105248_10245451
585 Ga0105248_11283572
586 Ga0105238_11926279
587 Ga0105249_10047319
588 Ga0105249_10514436
589 Ga0105249_10711142
590 Ga0105239_10283702
591 Ga0105239_10496074
592 Ga0105239_10571391
593 Ga0105239_11939201
594 Ga0105246_10028833
595 Ga0105246_10058716
596 Ga0105246_10562239
597 Ga0105246_10838978
598 Ga0157373_10425915
599 Ga0157371_11104530
600 Ga0157370_10028880
601 Ga0157369_10086778
602 Ga0157369_10495840
603 Ga0157369_10704860
604 Ga0157369_11015643
605 Ga0157374_11467945
606 Ga0157378_11430500
607 Ga0157378_12878771
608 Ga0157378_13072617
609 Ga0163162_10153062
610 Ga0163162_10205555
611 Ga0163162_10305509
612 Ga0163162_10836748
613 Ga0163162_12205853
614 Ga0163162_12844136
615 Ga0157372_10621512
616 Ga0157372_11208097
617 Ga0157372_11800468
618 Ga0157372_11866644
619 Ga0157375_10287229
620 Ga0157375_10976589
621 Ga0157375_11017483
622 Ga0163163_11491490
623 Ga0163163_11592777
624 Ga0163163_11716499
625 Ga0157380_10257423
626 Ga0157380_10990536
627 Ga0157380_13359372
628 Ga0182008_10136474
629 Ga0157377_10067403
630 Ga0157377_10082753
631 Ga0157377_10346985
632 Ga0157377_10591528
633 Ga0157379_10128094
634 Ga0157379_11689100
635 Ga0157376_10238932
636 Ga0157376_10774174
637 Ga0163161_11192372
638 Ga0206356_10648542
639 Ga0206353_10460900
640 Ga0207656_10032955
641 Ga0207642_10463625
642 Ga0207710_10103100
643 Ga0207710_10259367
644 Ga0207688_10173536
645 Ga0207647_10018160
646 Ga0207647_10033644
647 Ga0207645_10147789
648 Ga0207643_10059726
649 Ga0207705_10062326
650 Ga0207705_10288553
651 Ga0207654_10729736
652 Ga0207707_10289101
653 Ga0207695_10476734
654 Ga0207695_11195425
655 Ga0207693_10039264
656 Ga0207663_10204304
657 Ga0207660_10081439
658 Ga0207660_10363919
659 Ga0207662_10030143
660 Ga0207662_11338193
661 Ga0207657_10013529
662 Ga0207649_10224021
663 Ga0207649_10717269
664 Ga0207652_10079992
665 Ga0207681_10136361
666 Ga0207694_10593874
667 Ga0207650_10094321
668 Ga0207650_11241853
669 Ga0207659_10307876
670 Ga0207687_10002252
671 Ga0207687_10074683
672 Ga0207687_10375877
673 Ga0207687_10782559
674 Ga0207700_11088877
675 Ga0207664_10413738
676 Ga0207644_10011504
677 Ga0207690_10096642
678 Ga0207690_10571738
679 Ga0207690_10685650
680 Ga0207690_10993127
681 Ga0207706_10516037
682 Ga0207686_10158652
683 Ga0207686_10222017
684 Ga0207686_10330719
685 Ga0207709_10041927
686 Ga0207709_10856314
687 Ga0207669_10101207
688 Ga0207704_10448627
689 Ga0207704_10696238
690 Ga0207704_11751931
691 Ga0207691_10272129
692 Ga0207711_10007588
693 Ga0207711_10377363
694 Ga0207711_10845195
695 Ga0207689_10058363
696 Ga0207661_10022120
697 Ga0207661_11262871
698 Ga0207661_11303405
699 Ga0207667_10041362
700 Ga0207667_10287349
701 Ga0207667_10812806
702 Ga0207651_10863793
703 Ga0207712_10466813
704 Ga0207712_11031442
705 Ga0207712_11451196
706 Ga0207668_10256660
707 Ga0207640_10281214
708 Ga0207640_10625846
709 Ga0207658_10454775
710 Ga0207677_10141066
711 Ga0207677_10443700
712 Ga0207703_10298432
713 Ga0207639_10974695
714 Ga0207678_10099440
715 Ga0207678_10277047
716 Ga0207678_10645057
717 Ga0207678_10732866
718 Ga0207678_10963164
719 Ga0207708_10010112
720 Ga0207708_10222878
721 Ga0207702_10716580
722 Ga0207641_10789506
723 Ga0207648_10057536
724 Ga0207676_10043222
725 Ga0207676_10689322
726 Ga0207676_12117771
727 Ga0207674_10058620
728 Ga0207674_10081491
729 Ga0207674_10118486
730 Ga0207675_100040408
731 Ga0207675_102542412
732 Ga0207675_102672898
733 Ga0207683_10212272
734 Ga0207683_11189578
735 Ga0207683_11517401
736 Ga0207698_10082503
737 Ga0207698_10911696
738 Ga0207428_10455110
739 Ga0268266_10104868
740 Ga0268264_10138997
741 Ga0265319_1025377
742 Ga0265319_1145182
743 Ga0265318_10071955
744 Ga0265318_10091499
745 Ga0265322_10045858
746 Ga0265338_10151878
747 Ga0265338_10547230
748 Ga0265338_10910755
749 Ga0307512_10304492
750 Ga0265760_10240619
751 Ga0265332_10313485
752 Ga0265332_10403218
753 Ga0265320_10053530
754 Ga0265320_10086827
755 Ga0265325_10013038
756 Ga0265339_10022444
757 Ga0265316_10779257
758 Ga0265316_10927611
759 Ga0307513_10727418
760 Ga0307516_10281395
761 Ga0307413_10255005
762 Ga0307518_10544002
763 Ga0307410_11626331
764 Ga0307406_10096725
765 Ga0307412_11492617
766 Ga0307409_100074579
767 Ga0307409_100917952
768 Ga0307416_100355306
769 Ga0307416_100434267
770 Ga0307416_101899495
771 Ga0307416_101983242
772 Ga0307416_102623150
773 Ga0307414_10469091
774 Ga0307411_10108034
775 Ga0307415_100863582
776 Ga0307415_101278123
777 Ga0307507_10008257
778 Ga0373959_0041292
779 Ga0373931_0263345
780 Ga0373925_1169847
781 Ga0395898_1274023
782 Ga0395898_1853542
783 Ga0395901_0685100
784 Ga0436365_0472288
785 Ga0436365_1519608
786 Ga0436363_0401352
787 Ga0451791_0002390
788 Ga0451853_3650971
789 Ga0466963_0943415
790 Ga0466970_0277165
791 Ga0466960_0513136
792 Ga0466960_0838905
793 Ga0466967_0038355
794 Ga0466967_0152001
795 Ga0466967_0460615
796 Ga0466967_0720213
797 Ga0495592_0003592
798 Ga0495590_0131985
799 Ga0495651_0006233
800 Ga0495653_0183528
801 Ga0495580_0610304
802 Ga0495662_0003531
803 Ga0495664_0375102
804 Ga0495606_0000991
805 Ga0495608_0012341
806 Ga0495628_0042989
807 Ga0495630_0123707
808 Ga0495666_0013107
809 Ga0495652_0090724
810 Ga0495665_0008516
811 Ga0495640_0021977
812 Ga0495587_0022264
813 Ga0495645_0205849
814 Ga0495667_0020898
815 Ga0495668_0000569
816 Ga0495625_0000630
817 Ga0495635_0054787
818 Ga0495657_0035729
819 Ga0495599_0097337
820 Ga0495646_0001195
821 Ga0495658_0519252
822 Ga0495613_0019054
823 Ga0495600_0032996
824 Ga0495581_0223099
825 Ga0495604_0001837
826 Ga0495674_0197390
827 Ga0495672_0531570
828 Ga0495687_002377
829 Ga0495677_0384775
830 Ga0495684_0163113
831 Ga0495602_0022017
832 Ga0495626_0000380
833 Ga0496100_0320051
834 Ga0496100_0715270
835 Ga0496101_0669907
836 Ga0496102_0056518
837 Ga0496102_0242824
838 Ga0496102_1338806
839 Ga0496103_0145785
840 Ga0496103_0296688
841 Ga0496104_0917789
842 Ga0496105_0231002
843 Ga0496106_0011590
844 Ga0496106_0102049
845 Ga0496106_0371295
846 Ga0496107_0633910
847 Ga0496107_0809752
848 Ga0496108_0141615
849 Ga0496108_0210458
850 Ga0496109_0136591
851 Ga0496109_0163080
852 Ga0496110_0314299
853 Ga0496110_0395346
854 Ga0496110_0735723
855 Ga0496110_1463165
856 Ga0496111_0290846
857 Ga0496112_0915711
858 Ga0496112_1441524
859 Ga0496113_0601533
860 Ga0496114_0171262
861 Ga0496115_0087569
862 Ga0496115_0132225
863 Ga0496126_0039716
864 Ga0501067_0307854
865 Ga0501083_0087968
866 nmdc:mga06r32_56667_c1
867 nmdc:mga08y16_748382_c1
868 nmdc:mga08y16_939850_c1
869 nmdc:mga0rr50_277702_c1
870 nmdc:mga0rr50_771630_c1
871 Ga0495601_0003101
872 Ga0495612_0322931
873 Ga0495619_0453840
874 Ga0587082_157735
875 2867373272
876 2905929597

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05336

rhaM

L-rhamnose mutarotase

3

106

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.8502 2 106
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.824 1 106
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.8182 1 106
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.8165 1 106
1x8d-assembly2.cif.gz_D crystal structure of e. coli yiil protein containing l-rhamnose 0.8112 1 106
ID Description Score Start End Superfamily
af_Q556R9_3_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8329 2 85 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7905 1 99 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7695 1 99 3.30.70.100
af_Q9HDU7_108_202_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7371 1 100 3.30.70.100
af_Q9HDU7_108_202_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7307 1 100 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A4Y3L0D6-F1-model_v4 Beta-glucosidase 0.9807 1 105 GO:0004553
GO:0005975
GO:0016857
AF-A0A2N3SJ52-F1-model_v4 deleted 0.9613 1 105
AF-A0A2T0UGG7-F1-model_v4 L-rhamnose mutarotase 0.9593 2 105 GO:0016857
GO:0019301
AF-A0A841DY33-F1-model_v4 L-rhamnose mutarotase (EC 5.1.3.32) 0.9582 1 106 GO:0016857
GO:0019301
AF-A0A1G9FC30-F1-model_v4 L-rhamnose mutarotase 0.958 2 105 GO:0016857
GO:0019301

Map