F443880

General Info

Members Datasets Scaffolds Average Seq Length
437 354 271 164

Family's Representative Sequence

Representative Sequence 3300049574|Ga0501038_0188267|Ga0501038_0188267_1099_1605
Length 168
Sequence MTPVLALLSFVTMQRLAELIHARCNTKRLLAEGAVEIGADHYPLLVLLHASWLGALWAVAASGHASLWWPAVIGYALVEAARIWVMASLGRYWTTRILVPRAAPLVRRGPYRFLRHPNYWIVVAEIALLPLAVGSWTLAAVFSALNAAVLFRRIRVEESSLAARRNTA

Samples

Sample ID Description Type Environment
1 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
4 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
5 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
6 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
7 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
8 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
9 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
10 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
11 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
12 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
13 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
14 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
15 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
16 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
17 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
18 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
19 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
20 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
21 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
22 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
23 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
24 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
25 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
26 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
27 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
28 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
29 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
30 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
31 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
32 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
33 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
34 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
35 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
36 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
37 2718217882 Rhizobium sp. N741 Isolate Nodule
38 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
39 2718218009 Rhizobium sp. N561 Isolate Nodule
40 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
41 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
42 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
43 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
44 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
45 2718218363 Rhizobium sp. N113 Isolate Nodule
46 2718218365 Rhizobium sp. N731 Isolate Nodule
47 2718218366 Rhizobium sp. N621 Isolate Nodule
48 2721755514 Rhizobium sp. N6212 Isolate Nodule
49 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
50 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
51 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
52 2721755810 Rhizobium sp. N871 Isolate Nodule
53 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
54 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
55 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
56 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
57 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
58 2728369365 Rhizobium sp. N1341 Isolate Nodule
59 2728369397 Rhizobium sp. N1314 Isolate Nodule
60 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
61 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
62 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
63 2791355256 Rhizobium sp. M10 Isolate Nodule
64 2791355260 Rhizobium sp. L9 Isolate Nodule
65 2791355261 Rhizobium sp. J15 Isolate Nodule
66 2791355262 Rhizobium sp. M1 Isolate Nodule
67 2791355264 Rhizobium sp. S9 Isolate Nodule
68 2791355265 Rhizobium sp. H4 Isolate Nodule
69 2791355266 Rhizobium sp. L43 Isolate Nodule
70 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
71 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
72 2802429633 Rhizobium anhuiense J3 Isolate Nodule
73 2802429634 Rhizobium anhuiense S10 Isolate Nodule
74 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
75 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
76 2802429637 Rhizobium anhuiense C15 Isolate Nodule
77 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
78 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
79 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
80 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
81 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
82 2838048938 Rhizobium pisi 27/80 Isolate Nodule
83 2838061910 Rhizobium phaseoli L15 Isolate Nodule
84 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
85 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
86 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
87 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
88 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
89 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
90 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
91 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
92 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
93 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
94 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
95 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
96 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
97 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
98 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
99 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
100 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
101 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
102 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
103 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
104 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
105 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
106 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
107 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
108 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
109 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
110 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
111 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
112 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
113 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
114 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
115 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
116 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
117 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
118 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
119 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
120 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
121 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
122 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
123 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
124 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
125 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
126 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
127 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
128 2933599457 Rhizobium phaseoli M3 Isolate Nodule
129 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
130 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
131 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
132 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
133 2996893221 Rhizobium sp. R635 Isolate Nodule
134 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
135 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
136 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
137 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
138 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
139 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
140 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
141 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
142 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
143 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
144 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
145 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
146 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
147 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
148 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
149 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
150 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
151 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
152 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
153 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
154 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
155 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
156 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
157 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
158 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
159 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
160 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
161 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
162 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
163 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
164 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
165 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
166 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
167 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
168 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
169 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
170 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
171 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
172 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
173 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
174 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
175 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
176 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
177 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
178 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
179 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
180 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
181 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
182 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
183 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
186 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
187 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
188 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
190 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
191 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
192 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
193 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
194 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
196 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
206 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
207 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
210 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
211 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
212 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
213 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
214 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
215 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
218 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
219 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
220 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
221 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
222 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
223 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
224 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
225 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
226 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
227 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
230 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
231 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
232 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
233 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
236 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
237 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
238 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
241 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
242 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
243 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
244 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
245 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
246 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
247 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
251 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
252 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
253 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
254 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
255 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
256 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
257 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
261 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
262 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
263 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
264 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
265 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
266 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
267 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
268 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
271 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
275 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
276 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
277 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
278 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
281 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
285 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
297 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
298 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
299 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
300 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
301 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
302 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
303 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
304 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
305 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
306 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
307 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
308 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
309 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
310 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
311 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
312 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
313 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
314 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
315 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
316 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
317 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
318 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
321 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
322 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
323 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
324 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
325 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
326 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
327 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
328 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
329 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
330 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
331 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
332 8005382845 Rhizobium sp. R634 Isolate Nodule
333 8005395548 Rhizobium sp. R339 Isolate Nodule
334 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
335 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
336 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
337 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
338 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
339 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
340 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
341 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
342 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
343 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
344 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
345 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
346 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
347 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
348 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
349 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
350 8024501048 Rhizobium sp. H4 Isolate Nodule
351 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
352 8056382006 Rhizobium croatiense 13T Isolate Nodule
353 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
354 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.01
Metatranscriptomes 0
Isolates 37.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.08
Nodule 29.98
Rhizoplane 1.37
Rhizosphere 36.16
Stem 0
Stem Tuber 0
Unclassified 14.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000204 3300001979 Bacteria 24594
2 JGI25155J39150_1000023 3300002704 Bacteria 136961
3 JGI25156J39149_1000029 3300002705 Bacteria 126505
4 JGI25156J39149_1000094 3300002705 Bacteria 65145
5 JGI25162J39368_1000587 3300002737 Bacteria 26590
6 JGI25162J39368_1001199 3300002737 Bacteria 15163
7 JGI25154J39366_1000067 3300002738 Bacteria 100452
8 JGI25157J39369_1000043 3300002741 Bacteria 122537
9 JGI25159J45721_1002774 3300002987 Bacteria 6478
10 JGI25151J46595_10001788 3300003187 Bacteria 13904
11 JGI25165J46597_1000341 3300003214 Bacteria 53973
12 JGI25165J46597_1000736 3300003214 Bacteria 25593
13 JGI25153J46596_10005272 3300003215 Bacteria 6796
14 rootH2_10025371 3300003320 Bacteria 4336
15 rootL2_10009180 3300003322 Bacteria 7592
16 rootL2_10009181 3300003322 Bacteria 2561
17 rootH1_10166487 3300003323 Bacteria 1621
18 JGI25160J50197_1000046 3300003354 Bacteria 141352
19 JGI25160J50197_1005018 3300003354 Bacteria 5599
20 JGI25161J50226_1000031 3300003374 Bacteria 141352
21 JGI25161J50226_1005898 3300003374 Bacteria 2293
22 Ga0055539_1009376 3300003752 Bacteria 1215
23 Ga0055526_1009675 3300003771 Bacteria 4597
24 Ga0055526_1025417 3300003771 Bacteria 1901
25 Ga0055524_1034094 3300003775 Bacteria 1414
26 Ga0055528_1000322 3300003790 Bacteria 40297
27 Ga0055528_1010944 3300003790 Bacteria 3642
28 Ga0055528_1046112 3300003790 Bacteria 922
29 Ga0055528_1046142 3300003790 Bacteria 922
30 Ga0055540_1030590 3300003792 Bacteria 1247
31 Ga0055543_1000008 3300004625 Bacteria 202062
32 Ga0055543_1002094 3300004625 Bacteria 6947
33 Ga0065165_1000336 3300005262 Bacteria 76934
34 Ga0070670_100000173 3300005331 Bacteria 58127
35 Ga0070667_100382513 3300005367 Bacteria 1278
36 Ga0070663_100567399 3300005455 Bacteria 951
37 Ga0070665_100081110 3300005548 Bacteria 3250
38 Ga0068854_100062598 3300005578 Bacteria 2698
39 Ga0068856_100014228 3300005614 Bacteria 7693
40 Ga0068851_10039073 3300005834 Bacteria 2383
41 Ga0075370_10021605 3300006353 Bacteria 3526
42 Ga0075370_10024409 3300006353 Bacteria 3339
43 Ga0105240_10000278 3300009093 Bacteria 101540
44 Ga0105243_10406540 3300009148 Bacteria 1266
45 Ga0105248_10136075 3300009177 Bacteria 2771
46 Ga0105248_10371542 3300009177 Bacteria 1610
47 Ga0105237_10000434 3300009545 Bacteria 59528
48 Ga0157370_10008214 3300013104 Bacteria 11277
49 Ga0157369_10736726 3300013105 Bacteria 1014
50 Ga0182008_10086485 3300014497 Bacteria 1544
51 Ga0182007_10002185 3300015262 Bacteria 9925
52 Ga0182005_1003511 3300015265 Bacteria 5299
53 Ga0163161_10617350 3300017792 Bacteria 895
54 Ga0209435_100011 3300025206 Bacteria 413027
55 Ga0209760_101901 3300025207 Bacteria 2058
56 Ga0209437_100036 3300025233 Bacteria 469153
57 Ga0209437_100086 3300025233 Bacteria 254578
58 Ga0209437_103250 3300025233 Bacteria 2971
59 Ga0207425_1005318 3300025245 Bacteria 3686
60 Ga0209646_1000024 3300025246 Bacteria 413027
61 Ga0209026_1000030 3300025250 Bacteria 329811
62 Ga0209677_100324 3300025253 Bacteria 30829
63 Ga0209148_1005278 3300025254 Bacteria 2997
64 Ga0209759_1000011 3300025256 Bacteria 413027
65 Ga0209129_1000261 3300025258 Bacteria 53485
66 Ga0209233_1000110 3300025261 Bacteria 260825
67 Ga0209233_1000166 3300025261 Bacteria 152270
68 Ga0209233_1000465 3300025261 Bacteria 25645
69 Ga0209455_1010089 3300025272 Bacteria 2427
70 Ga0209673_1000728 3300025273 Bacteria 45616
71 Ga0209673_1001082 3300025273 Bacteria 30702
72 Ga0209673_1004752 3300025273 Bacteria 7142
73 Ga0209673_1038026 3300025273 Bacteria 1406
74 Ga0209130_1000088 3300025284 Bacteria 152927
75 Ga0209130_1034374 3300025284 Bacteria 1021
76 Ga0209025_1000407 3300025294 Bacteria 87041
77 Ga0209564_1001105 3300025295 Bacteria 31907
78 Ga0209564_1004453 3300025295 Bacteria 8562
79 Ga0209564_1004762 3300025295 Bacteria 8110
80 Ga0209564_1011537 3300025295 Bacteria 3948
81 Ga0209564_1052197 3300025295 Bacteria 985
82 Ga0209758_1000336 3300025297 Bacteria 87439
83 Ga0209758_1007377 3300025297 Bacteria 7517
84 Ga0209256_1000800 3300025299 Bacteria 40330
85 Ga0209256_1007738 3300025299 Bacteria 5202
86 Ga0209256_1009190 3300025299 Bacteria 4387
87 Ga0209256_1046418 3300025299 Bacteria 1074
88 Ga0207426_1000012 3300025302 Bacteria 730942
89 Ga0207426_1000063 3300025302 Bacteria 358920
90 Ga0209051_1032140 3300025303 Bacteria 2007
91 Ga0207695_10000376 3300025913 Bacteria 101548
92 Ga0207671_10000732 3300025914 Bacteria 41620
93 Ga0207668_10117688 3300025972 Bacteria 2006
94 Ga0207640_10046737 3300025981 Bacteria 2788
95 Ga0207702_10107893 3300026078 Bacteria 2470
96 Ga0209371_1000853 3300027312 Bacteria 24684
97 Ga0209983_1055857 3300027665 Bacteria 868
98 Ga0268266_10057923 3300028379 Bacteria 3335
99 Ga0307515_10004227 3300028794 Bacteria 29832
100 Ga0268256_1001802 3300030500 Bacteria 12062
101 Ga0307513_10066571 3300031456 Bacteria 3784
102 Ga0307408_100080696 3300031548 Bacteria 2430
103 Ga0307405_10119249 3300031731 Bacteria 1802
104 Ga0307405_10363439 3300031731 Bacteria 1121
105 Ga0307413_10027242 3300031824 Bacteria 3163
106 Ga0307413_10108287 3300031824 Bacteria 1854
107 Ga0307413_10147222 3300031824 Bacteria 1636
108 Ga0307413_11089140 3300031824 Bacteria 689
109 Ga0307410_10102845 3300031852 Bacteria 2050
110 Ga0307406_10130169 3300031901 Bacteria 1765
111 Ga0307407_10080283 3300031903 Bacteria 1970
112 Ga0307407_10214830 3300031903 Bacteria 1297
113 Ga0307412_10071698 3300031911 Bacteria 2365
114 Ga0307412_10619008 3300031911 Bacteria 919
115 Ga0307409_100064956 3300031995 Bacteria 2869
116 Ga0307409_100086194 3300031995 Bacteria 2555
117 Ga0307409_100344447 3300031995 Bacteria 1404
118 Ga0307409_100676624 3300031995 Bacteria 1029
119 Ga0307409_101560146 3300031995 Bacteria 688
120 Ga0307416_100169398 3300032002 Bacteria 2030
121 Ga0307416_100512159 3300032002 Bacteria 1266
122 Ga0307414_10003863 3300032004 Bacteria 8064
123 Ga0307414_10018839 3300032004 Bacteria 4262
124 Ga0307414_10321045 3300032004 Bacteria 1318
125 Ga0307414_10501062 3300032004 Bacteria 1074
126 Ga0307414_10962752 3300032004 Unclassified 785
127 Ga0307411_10014796 3300032005 Bacteria 4356
128 Ga0307411_10035718 3300032005 Bacteria 3107
129 Ga0307411_10089450 3300032005 Bacteria 2144
130 Ga0307411_10143808 3300032005 Bacteria 1762
131 Ga0307411_10477067 3300032005 Bacteria 1049
132 Ga0307415_100036643 3300032126 Bacteria 3216
133 Ga0307415_100047260 3300032126 Bacteria 2896
134 Ga0451837_0205861 3300041494 Bacteria 1139
135 Ga0451841_0151923 3300041498 Bacteria 2098
136 Ga0451845_0971224 3300041501 Bacteria 1098
137 Ga0451847_0590084 3300041503 Bacteria 1416
138 Ga0451851_0435352 3300041507 Bacteria 2544
139 Ga0451843_0333844 3300041509 Bacteria 1839
140 Ga0451855_0093752 3300041511 Bacteria 1009
141 Ga0451855_0753743 3300041511 Bacteria 737
142 Ga0439464_0155251 3300042439 Bacteria 717
143 Ga0466966_0137944 3300044684 Bacteria 1491
144 Ga0466963_0017322 3300044694 Bacteria 4490
145 Ga0466964_0120076 3300044706 Bacteria 1184
146 Ga0466971_0146252 3300044719 Bacteria 1102
147 Ga0466970_0002337 3300044765 Bacteria 9169
148 Ga0466960_0104109 3300044901 Bacteria 1466
149 Ga0466958_0040153 3300045836 Bacteria 2812
150 Ga0466967_0101585 3300045976 Bacteria 2629
151 Ga0466967_0972658 3300045976 Bacteria 845
152 Ga0495617_193618 3300046452 Bacteria 637
153 Ga0495638_0000299 3300046460 Bacteria 63971
154 Ga0495650_0024257 3300046471 Bacteria 2867
155 Ga0495605_0008058 3300046474 Bacteria 5965
156 Ga0495584_0112150 3300046491 Bacteria 1380
157 Ga0495585_0002346 3300046492 Bacteria 13606
158 Ga0495596_0043843 3300046500 Bacteria 1763
159 Ga0495607_0104420 3300046501 Bacteria 1512
160 Ga0495607_0144883 3300046501 Bacteria 1221
161 Ga0495583_0012296 3300046506 Bacteria 4856
162 Ga0495606_0229447 3300046507 Bacteria 1041
163 Ga0495606_0542298 3300046507 Bacteria 580
164 Ga0495616_0013826 3300046513 Bacteria 4538
165 Ga0495620_0049039 3300046515 Bacteria 1809
166 Ga0495631_0001476 3300046518 Bacteria 14271
167 Ga0495631_0064449 3300046518 Bacteria 1586
168 Ga0495632_0010194 3300046519 Bacteria 5584
169 Ga0495643_0017635 3300046522 Bacteria 4169
170 Ga0495643_0214621 3300046522 Bacteria 916
171 Ga0495648_0019794 3300046524 Bacteria 4716
172 Ga0495609_0010714 3300046538 Bacteria 4387
173 Ga0495609_0092666 3300046538 Bacteria 1313
174 Ga0495609_0116463 3300046538 Bacteria 1151
175 Ga0495633_0115736 3300046558 Bacteria 1242
176 Ga0495668_0003147 3300046616 Bacteria 12731
177 Ga0495668_0104516 3300046616 Bacteria 1549
178 Ga0495668_0129565 3300046616 Bacteria 1381
179 Ga0495611_0021415 3300046648 Bacteria 2792
180 Ga0495625_0003388 3300046660 Bacteria 15968
181 Ga0495625_0018281 3300046660 Bacteria 5475
182 Ga0495625_0064599 3300046660 Bacteria 2581
183 Ga0495625_0285337 3300046660 Bacteria 1061
184 Ga0495661_0134180 3300046665 Bacteria 1353
185 Ga0495670_0031943 3300046691 Bacteria 2617
186 Ga0495649_0035162 3300046694 Bacteria 2756
187 Ga0495649_0194841 3300046694 Bacteria 1054
188 Ga0495660_0019124 3300046810 Bacteria 3932
189 Ga0495636_0007470 3300047318 Bacteria 4302
190 Ga0495672_0010167 3300047320 Bacteria 6725
191 Ga0495683_0099119 3300047323 Bacteria 1403
192 Ga0495687_035724 3300047443 Bacteria 2231
193 Ga0495687_082934 3300047443 Bacteria 1250
194 Ga0495673_0176033 3300047469 Bacteria 813
195 Ga0495686_0042587 3300047472 Bacteria 2885
196 Ga0495686_0239108 3300047472 Bacteria 1025
197 Ga0495615_0058977 3300048090 Bacteria 1008
198 Ga0495626_0092554 3300048091 Bacteria 1328
199 Ga0496100_0029515 3300048903 Bacteria 3393
200 Ga0496102_0012829 3300048905 Bacteria 7254
201 Ga0496103_0045491 3300048906 Bacteria 2708
202 Ga0496113_0081609 3300048916 Bacteria 2479
203 Ga0496115_0888098 3300048918 Unclassified 688
204 Ga0496116_0039156 3300048919 Bacteria 3280
205 Ga0496117_0005420 3300048920 Bacteria 13417
206 Ga0496117_0121640 3300048920 Bacteria 1602
207 Ga0496118_0007122 3300048921 Bacteria 11995
208 Ga0496118_0008856 3300048921 Bacteria 10297
209 Ga0496119_0010893 3300048922 Bacteria 7597
210 Ga0496119_0022821 3300048922 Bacteria 4461
211 Ga0496119_0126873 3300048922 Bacteria 1395
212 Ga0496119_0252518 3300048922 Bacteria 888
213 Ga0496120_0044222 3300048923 Bacteria 2589
214 Ga0496120_0061666 3300048923 Bacteria 2091
215 Ga0496120_0152366 3300048923 Bacteria 1160
216 Ga0496120_0193320 3300048923 Bacteria 990
217 Ga0496121_0020291 3300048924 Bacteria 6587
218 Ga0496121_0029629 3300048924 Bacteria 5053
219 Ga0496121_0445747 3300048924 Bacteria 835
220 Ga0496122_0017437 3300048925 Bacteria 6713
221 Ga0496122_0031363 3300048925 Bacteria 4425
222 Ga0496123_0026366 3300048926 Bacteria 4354
223 Ga0496124_0063633 3300048927 Bacteria 3081
224 Ga0496124_0144246 3300048927 Bacteria 1875
225 Ga0496125_0017738 3300048928 Bacteria 6775
226 Ga0496125_0106664 3300048928 Bacteria 2044
227 Ga0496125_0190703 3300048928 Bacteria 1353
228 Ga0495678_003970 3300049459 Bacteria 8846
229 Ga0495682_0102685 3300049460 Bacteria 1025
230 Ga0501032_0129011 3300049569 Bacteria 1669
231 Ga0501033_0366289 3300049570 Bacteria 1008
232 Ga0501036_0262992 3300049572 Bacteria 1445
233 Ga0501037_0099258 3300049573 Bacteria 2103
234 Ga0501038_0072024 3300049574 Bacteria 2929
235 Ga0501038_0188267 3300049574 Bacteria 1662
236 Ga0501039_0024921 3300049575 Bacteria 4595
237 Ga0501047_0411351 3300049581 Bacteria 1185
238 Ga0501048_0298809 3300049582 Bacteria 1145
239 Ga0501070_0611419 3300049586 Bacteria 868
240 Ga0501073_0109627 3300049589 Bacteria 1915
241 Ga0501209_046829 3300049656 Bacteria 1166
242 Ga0501217_179596 3300049661 Bacteria 649
243 Ga0501235_007851 3300049669 Bacteria 2326
244 Ga0501249_005197 3300049679 Bacteria 2659
245 Ga0501252_041006 3300049682 Bacteria 672
246 Ga0501221_004736 3300049704 Bacteria 2259
247 Ga0501234_014395 3300049707 Bacteria 1243
248 Ga0501044_0575398 3300049823 Bacteria 1021
249 Ga0501044_1054252 3300049823 Unclassified 683
250 nmdc:mga0k408_293432_c1 3300050493 Bacteria 970
251 nmdc:mga06z11_903036_c1 3300050494 Bacteria 538
252 nmdc:mga04h51_8130_c1 3300050495 Bacteria 2798
253 nmdc:mga07m45_92756_c1 3300050496 Bacteria 1731
254 nmdc:mga0sz30_2873_c1 3300050516 Bacteria 6158
255 Ga0500610_0012323 3300053079 Bacteria 3935
256 Ga0500578_0166055 3300053086 Bacteria 1367
257 Ga0500557_000214 3300053105 Bacteria 9248
258 Ga0500569_005004 3300053109 Bacteria 2824
259 Ga0500593_001554 3300053117 Bacteria 8252
260 Ga0500594_0001760 3300053118 Bacteria 4717
261 Ga0500594_0004248 3300053118 Bacteria 3159
262 Ga0500618_006581 3300053125 Bacteria 3394
263 Ga0500658_0038252 3300053134 Bacteria 1911
264 Ga0500568_0001239 3300053139 Bacteria 16933
265 Ga0500577_0054652 3300053142 Bacteria 1514
266 Ga0500616_0002540 3300053153 Bacteria 15067
267 Ga0500627_0049679 3300053158 Bacteria 1825
268 Ga0500633_0138081 3300053160 Bacteria 912
269 Ga0500634_0011866 3300053161 Bacteria 4515
270 Ga0500645_026640 3300053730 Bacteria 1758
271 Ga0501082_0154741 3300060353 Bacteria 1992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053117 Ga0500593_001554 Ga0500593_001554_265_771 151
2 iso_pu_bacteria 2791355256 2793295189 158
3 iso_pu_bacteria 2791355262 2793337703 158
4 iso_pu_bacteria 3002141150 3002146051 159
5 iso_pu_bacteria 2515075009 2515110396 160
6 iso_pu_bacteria 2517093000 2517093281 160
7 iso_pu_bacteria 2724679232 2725949014 160
8 iso_pu_bacteria 2791355260 2793321708 160
9 iso_pu_bacteria 2791355261 2793326149 160
10 3300003752 Ga0055539_1009376 Ga0055539_10093761 161
11 3300009177 Ga0105248_10136075 Ga0105248_101360753 161
12 3300025233 Ga0209437_103250 Ga0209437_1032502 161
13 3300025253 Ga0209677_100324 Ga0209677_1003248 161
14 3300025261 Ga0209233_1000110 Ga0209233_100011050 161
15 3300027665 Ga0209983_1055857 Ga0209983_10558571 161
16 3300031548 Ga0307408_100080696 Ga0307408_1000806961 161
17 3300031731 Ga0307405_10119249 Ga0307405_101192492 161
18 3300031731 Ga0307405_10363439 Ga0307405_103634392 161
19 3300031824 Ga0307413_10027242 Ga0307413_100272423 161
20 3300031852 Ga0307410_10102845 Ga0307410_101028453 161
21 3300031901 Ga0307406_10130169 Ga0307406_101301692 161
22 3300031903 Ga0307407_10080283 Ga0307407_100802833 161
23 3300031911 Ga0307412_10071698 Ga0307412_100716982 161
24 3300031911 Ga0307412_10619008 Ga0307412_106190082 161
25 3300031995 Ga0307409_100086194 Ga0307409_1000861942 161
26 3300032002 Ga0307416_100169398 Ga0307416_1001693983 161
27 3300032004 Ga0307414_10321045 Ga0307414_103210452 161
28 3300032004 Ga0307414_10962752 Ga0307414_109627521 161
29 3300032005 Ga0307411_10089450 Ga0307411_100894502 161
30 3300032005 Ga0307411_10143808 Ga0307411_101438083 161
31 3300032126 Ga0307415_100047260 Ga0307415_1000472603 161
32 3300049656 Ga0501209_046829 Ga0501209_046829_203_688 161
33 3300049661 Ga0501217_179596 Ga0501217_179596_95_580 161
34 3300049669 Ga0501235_007851 Ga0501235_007851_895_1380 161
35 3300049679 Ga0501249_005197 Ga0501249_005197_2144_2629 161
36 3300049682 Ga0501252_041006 Ga0501252_041006_150_635 161
37 3300049704 Ga0501221_004736 Ga0501221_004736_615_1100 161
38 3300049707 Ga0501234_014395 Ga0501234_014395_180_665 161
39 iso_pu_bacteria 2510065019 2510131433 161
40 iso_pu_bacteria 2510461076 2510897788 161
41 iso_pu_bacteria 2510917022 2511136256 161
42 iso_pu_bacteria 2513237084 2513570655 161
43 iso_pu_bacteria 2513237093 2513634282 161
44 iso_pu_bacteria 2513237103 2513713166 161
45 iso_pu_bacteria 2513237144 2513910377 161
46 iso_pu_bacteria 2513237162 2514021045 161
47 iso_pu_bacteria 2515154113 2515638277 161
48 iso_pu_bacteria 2515154114 2515642847 161
49 iso_pu_bacteria 2515154116 2515659625 161
50 iso_pu_bacteria 2515154134 2515743282 161
51 iso_pu_bacteria 2516653077 2517039083 161
52 iso_pu_bacteria 2517287029 2517409546 161
53 iso_pu_bacteria 2524023209 2524457541 161
54 iso_pu_bacteria 2582581307 2585275419 161
55 iso_pu_bacteria 2585427526 2585530245 161
56 iso_pu_bacteria 2585427528 2585539703 161
57 iso_pu_bacteria 2585427531 2585560138 161
58 iso_pu_bacteria 2585427593 2585837661 161
59 iso_pu_bacteria 2585427608 2585901590 161
60 iso_pu_bacteria 2585427609 2585905681 161
61 iso_pu_bacteria 2585428125 2587979203 161
62 iso_pu_bacteria 2615840624 2616298150 161
63 iso_pu_bacteria 2615840698 2616553435 161
64 iso_pu_bacteria 2643221643 2644241518 161
65 iso_pu_bacteria 2667528174 2671112393 161
66 iso_pu_bacteria 2718217882 2719179590 161
67 iso_pu_bacteria 2718217997 2719663937 161
68 iso_pu_bacteria 2718218009 2719730260 161
69 iso_pu_bacteria 2718218199 2720490356 161
70 iso_pu_bacteria 2718218232 2720611730 161
71 iso_pu_bacteria 2718218233 2720618586 161
72 iso_pu_bacteria 2718218235 2720629987 161
73 iso_pu_bacteria 2718218269 2720773682 161
74 iso_pu_bacteria 2718218363 2721145683 161
75 iso_pu_bacteria 2718218365 2721157199 161
76 iso_pu_bacteria 2718218366 2721162562 161
77 iso_pu_bacteria 2721755514 2722838732 161
78 iso_pu_bacteria 2721755556 2723025355 161
79 iso_pu_bacteria 2721755684 2723558938 161
80 iso_pu_bacteria 2721755685 2723565508 161
81 iso_pu_bacteria 2721755810 2724043016 161
82 iso_pu_bacteria 2721755819 2724088289 161
83 iso_pu_bacteria 2721755822 2724102773 161
84 iso_pu_bacteria 2721755823 2724108673 161
85 iso_pu_bacteria 2728369352 2730106291 161
86 iso_pu_bacteria 2728369365 2730162827 161
87 iso_pu_bacteria 2728369397 2730296831 161
88 iso_pu_bacteria 2738541333 2739037093 161
89 iso_pu_bacteria 2765235942 2766066545 161
90 iso_pu_bacteria 2791355264 2793350763 161
91 iso_pu_bacteria 2791355265 2793357570 161
92 iso_pu_bacteria 2791355266 2793361493 161
93 iso_pu_bacteria 2802429605 2805931529 161
94 iso_pu_bacteria 2802429606 2805932350 161
95 iso_pu_bacteria 2802429633 2806049652 161
96 iso_pu_bacteria 2802429634 2806056419 161
97 iso_pu_bacteria 2802429635 2806063480 161
98 iso_pu_bacteria 2802429636 2806067120 161
99 iso_pu_bacteria 2802429637 2806075383 161
100 iso_pu_bacteria 2818991448 2819608384 161
101 iso_pu_bacteria 2838016132 2838020304 161
102 iso_pu_bacteria 2838022645 2838024832 161
103 iso_pu_bacteria 2838029111 2838029268 161
104 iso_pu_bacteria 2838048938 2838051480 161
105 iso_pu_bacteria 2838061910 2838068582 161
106 iso_pu_bacteria 2838068647 2838073652 161
107 iso_pu_bacteria 2838668709 2838672371 161
108 iso_pu_bacteria 2838680041 2838680601 161
109 iso_pu_bacteria 2838694306 2838695366 161
110 iso_pu_bacteria 2838701080 2838703887 161
111 iso_pu_bacteria 2838707686 2838708742 161
112 iso_pu_bacteria 2842077413 2842080023 161
113 iso_pu_bacteria 2842110456 2842112223 161
114 iso_pu_bacteria 2842118031 2842120642 161
115 iso_pu_bacteria 2842146304 2842148321 161
116 iso_pu_bacteria 2842163707 2842169709 161
117 iso_pu_bacteria 2842198810 2842200063 161
118 iso_pu_bacteria 2842205361 2842206931 161
119 iso_pu_bacteria 2842217011 2842218776 161
120 iso_pu_bacteria 2842237096 2842238154 161
121 iso_pu_bacteria 2842250916 2842253387 161
122 iso_pu_bacteria 2842264693 2842270747 161
123 iso_pu_bacteria 2842278818 2842280376 161
124 iso_pu_bacteria 2842291075 2842293683 161
125 iso_pu_bacteria 2842298080 2842300845 161
126 iso_pu_bacteria 2842304105 2842306483 161
127 iso_pu_bacteria 2842311132 2842312600 161
128 iso_pu_bacteria 2842357229 2842358035 161
129 iso_pu_bacteria 2842370503 2842371064 161
130 iso_pu_bacteria 2842377471 2842380080 161
131 iso_pu_bacteria 2842384541 2842387151 161
132 iso_pu_bacteria 2842422224 2842427100 161
133 iso_pu_bacteria 2842428310 2842434631 161
134 iso_pu_bacteria 2842434925 2842441002 161
135 iso_pu_bacteria 2842441272 2842447609 161
136 iso_pu_bacteria 2842447887 2842450208 161
137 iso_pu_bacteria 2842462802 2842468992 161
138 iso_pu_bacteria 2842469257 2842475537 161
139 iso_pu_bacteria 2842475841 2842476302 161
140 iso_pu_bacteria 2842489311 2842492440 161
141 iso_pu_bacteria 2842495871 2842501996 161
142 iso_pu_bacteria 2842502639 2842502796 161
143 iso_pu_bacteria 2842509118 2842509231 161
144 iso_pu_bacteria 2852387548 2852388507 161
145 iso_pu_bacteria 2857516855 2857523419 161
146 iso_pu_bacteria 2919408235 2919408827 161
147 iso_pu_bacteria 2933570622 2933573552 161
148 iso_pu_bacteria 2933586486 2933587552 161
149 iso_pu_bacteria 2933599457 2933604080 161
150 iso_pu_bacteria 2935894831 2935895889 161
151 iso_pu_bacteria 2935901341 2935907148 161
152 iso_pu_bacteria 2936367885 2936368910 161
153 iso_pu_bacteria 2936375103 2936378473 161
154 iso_pu_bacteria 2996893221 2996893450 161
155 iso_pu_bacteria 3005409236 3005411251 161
156 iso_pu_bacteria 3005416602 3005422784 161
157 iso_pu_bacteria 639633055 639646664 161
158 iso_pu_bacteria 8005282627 8005283600 161
159 iso_pu_bacteria 8005289223 8005291065 161
160 iso_pu_bacteria 8005301065 8005303860 161
161 iso_pu_bacteria 8005307578 8005309178 161
162 iso_pu_bacteria 8005314921 8005321680 161
163 iso_pu_bacteria 8005376324 8005377418 161
164 iso_pu_bacteria 8005382845 8005387280 161
165 iso_pu_bacteria 8005395548 8005400143 161
166 iso_pu_bacteria 8005430974 8005432951 161
167 iso_pu_bacteria 8005460587 8005461035 161
168 iso_pu_bacteria 8005484373 8005486114 161
169 iso_pu_bacteria 8005497431 8005498679 161
170 iso_pu_bacteria 8005556819 8005560650 161
171 iso_pu_bacteria 8005563573 8005563891 161
172 iso_pu_bacteria 8005570704 8005576938 161
173 iso_pu_bacteria 8005619151 8005619873 161
174 iso_pu_bacteria 8005626139 8005628444 161
175 iso_pu_bacteria 8005645114 8005650169 161
176 iso_pu_bacteria 8005668836 8005670090 161
177 iso_pu_bacteria 8005682033 8005685093 161
178 iso_pu_bacteria 8005688590 8005690288 161
179 iso_pu_bacteria 8018127388 8018133142 161
180 iso_pu_bacteria 8018163183 8018169044 161
181 iso_pu_bacteria 8024479707 8024480292 161
182 iso_pu_bacteria 8024501048 8024501584 161
183 iso_pu_bacteria 8056382006 8056385966 161
184 iso_pu_bacteria 8057575449 8057579917 161
185 iso_pu_bacteria 8057874678 8057876066 161
186 3300017792 Ga0163161_10617350 Ga0163161_106173502 162
187 3300025972 Ga0207668_10117688 Ga0207668_101176882 162
188 3300031824 Ga0307413_10108287 Ga0307413_101082872 162
189 3300031824 Ga0307413_10147222 Ga0307413_101472222 162
190 3300031824 Ga0307413_11089140 Ga0307413_110891401 162
191 3300031995 Ga0307409_100064956 Ga0307409_1000649561 162
192 3300031995 Ga0307409_101560146 Ga0307409_1015601462 162
193 3300032002 Ga0307416_100512159 Ga0307416_1005121592 162
194 3300032004 Ga0307414_10018839 Ga0307414_100188393 162
195 3300032004 Ga0307414_10501062 Ga0307414_105010622 162
196 3300032005 Ga0307411_10035718 Ga0307411_100357183 162
197 3300032005 Ga0307411_10477067 Ga0307411_104770672 162
198 3300032126 Ga0307415_100036643 Ga0307415_1000366431 162
199 3300042439 Ga0439464_0155251 Ga0439464_0155251_145_633 162
200 iso_pu_bacteria 2582581308 2585282276 162
201 iso_pu_bacteria 2582581315 2585325955 162
202 iso_pu_bacteria 2582581316 2585330124 162
203 iso_pu_bacteria 2585427527 2585536526 162
204 iso_pu_bacteria 2585427530 2585557004 162
205 iso_pu_bacteria 2615840626 2616306300 162
206 iso_pu_bacteria 2617270742 2617383712 162
207 iso_pu_bacteria 2775507266 2778174194 162
208 iso_pu_bacteria 2818991453 2819643538 162
209 iso_pu_bacteria 2842482326 2842482377 162
210 iso_pu_bacteria 8046767195 8046769895 162
211 3300044901 Ga0466960_0104109 Ga0466960_0104109_38_529 163
212 3300003322 rootL2_10009181 rootL2_100091812 164
213 3300005331 Ga0070670_100000173 Ga0070670_10000017340 164
214 3300031995 Ga0307409_100344447 Ga0307409_1003444471 164
215 3300031995 Ga0307409_100676624 Ga0307409_1006766242 164
216 3300041501 Ga0451845_0971224 Ga0451845_0971224_236_736 164
217 3300041507 Ga0451851_0435352 Ga0451851_0435352_1481_1981 164
218 3300041509 Ga0451843_0333844 Ga0451843_0333844_235_735 164
219 3300046452 Ga0495617_193618 Ga0495617_193618_105_605 164
220 3300046474 Ga0495605_0008058 Ga0495605_0008058_1988_2488 164
221 3300046491 Ga0495584_0112150 Ga0495584_0112150_398_898 164
222 3300046492 Ga0495585_0002346 Ga0495585_0002346_5195_5695 164
223 3300046506 Ga0495583_0012296 Ga0495583_0012296_974_1474 164
224 3300046513 Ga0495616_0013826 Ga0495616_0013826_4007_4507 164
225 3300046518 Ga0495631_0001476 Ga0495631_0001476_7987_8487 164
226 3300046519 Ga0495632_0010194 Ga0495632_0010194_3550_4050 164
227 3300046538 Ga0495609_0010714 Ga0495609_0010714_348_848 164
228 3300046616 Ga0495668_0003147 Ga0495668_0003147_2156_2656 164
229 3300046660 Ga0495625_0003388 Ga0495625_0003388_11903_12403 164
230 3300046691 Ga0495670_0031943 Ga0495670_0031943_434_934 164
231 3300046810 Ga0495660_0019124 Ga0495660_0019124_549_1049 164
232 3300048918 Ga0496115_0888098 Ga0496115_0888098_70_579 164
233 3300049459 Ga0495678_003970 Ga0495678_003970_7549_8049 164
234 3300049460 Ga0495682_0102685 Ga0495682_0102685_114_614 164
235 3300049569 Ga0501032_0129011 Ga0501032_0129011_1135_1635 164
236 3300049570 Ga0501033_0366289 Ga0501033_0366289_400_900 164
237 3300049572 Ga0501036_0262992 Ga0501036_0262992_92_592 164
238 3300049573 Ga0501037_0099258 Ga0501037_0099258_1391_1891 164
239 3300049574 Ga0501038_0072024 Ga0501038_0072024_1224_1724 164
240 3300049574 Ga0501038_0188267 Ga0501038_0188267_1099_1605 164
241 3300049575 Ga0501039_0024921 Ga0501039_0024921_977_1477 164
242 3300049581 Ga0501047_0411351 Ga0501047_0411351_436_936 164
243 3300049582 Ga0501048_0298809 Ga0501048_0298809_194_694 164
244 3300049586 Ga0501070_0611419 Ga0501070_0611419_298_804 164
245 3300049589 Ga0501073_0109627 Ga0501073_0109627_11_511 164
246 3300049823 Ga0501044_0575398 Ga0501044_0575398_410_910 164
247 3300049823 Ga0501044_1054252 Ga0501044_1054252_67_573 164
248 3300053079 Ga0500610_0012323 Ga0500610_0012323_3213_3713 164
249 3300053086 Ga0500578_0166055 Ga0500578_0166055_648_1148 164
250 3300053105 Ga0500557_000214 Ga0500557_000214_5392_5892 164
251 3300053109 Ga0500569_005004 Ga0500569_005004_1821_2321 164
252 3300053118 Ga0500594_0001760 Ga0500594_0001760_3005_3505 164
253 3300053158 Ga0500627_0049679 Ga0500627_0049679_68_568 164
254 3300060353 Ga0501082_0154741 Ga0501082_0154741_58_558 164
255 3300001979 JGI24740J21852_10000204 JGI24740J21852_1000020418 165
256 3300002704 JGI25155J39150_1000023 JGI25155J39150_100002376 165
257 3300002705 JGI25156J39149_1000029 JGI25156J39149_1000029111 165
258 3300002705 JGI25156J39149_1000094 JGI25156J39149_100009419 165
259 3300002737 JGI25162J39368_1000587 JGI25162J39368_100058717 165
260 3300002737 JGI25162J39368_1001199 JGI25162J39368_10011995 165
261 3300002738 JGI25154J39366_1000067 JGI25154J39366_100006777 165
262 3300002741 JGI25157J39369_1000043 JGI25157J39369_100004351 165
263 3300002987 JGI25159J45721_1002774 JGI25159J45721_10027746 165
264 3300003187 JGI25151J46595_10001788 JGI25151J46595_1000178811 165
265 3300003214 JGI25165J46597_1000341 JGI25165J46597_100034113 165
266 3300003214 JGI25165J46597_1000736 JGI25165J46597_100073618 165
267 3300003215 JGI25153J46596_10005272 JGI25153J46596_100052728 165
268 3300003320 rootH2_10025371 rootH2_100253715 165
269 3300003322 rootL2_10009180 rootL2_100091804 165
270 3300003323 rootH1_10166487 rootH1_101664872 165
271 3300003354 JGI25160J50197_1000046 JGI25160J50197_100004685 165
272 3300003354 JGI25160J50197_1005018 JGI25160J50197_10050182 165
273 3300003374 JGI25161J50226_1000031 JGI25161J50226_100003185 165
274 3300003374 JGI25161J50226_1005898 JGI25161J50226_10058982 165
275 3300003771 Ga0055526_1009675 Ga0055526_10096752 165
276 3300003771 Ga0055526_1025417 Ga0055526_10254172 165
277 3300003775 Ga0055524_1034094 Ga0055524_10340941 165
278 3300003790 Ga0055528_1000322 Ga0055528_100032210 165
279 3300003790 Ga0055528_1010944 Ga0055528_10109445 165
280 3300003790 Ga0055528_1046112 Ga0055528_10461122 165
281 3300003790 Ga0055528_1046142 Ga0055528_10461422 165
282 3300003792 Ga0055540_1030590 Ga0055540_10305902 165
283 3300004625 Ga0055543_1000008 Ga0055543_1000008164 165
284 3300004625 Ga0055543_1002094 Ga0055543_10020945 165
285 3300005262 Ga0065165_1000336 Ga0065165_100033637 165
286 3300005367 Ga0070667_100382513 Ga0070667_1003825131 165
287 3300005455 Ga0070663_100567399 Ga0070663_1005673993 165
288 3300005548 Ga0070665_100081110 Ga0070665_1000811102 165
289 3300005578 Ga0068854_100062598 Ga0068854_1000625982 165
290 3300005614 Ga0068856_100014228 Ga0068856_1000142284 165
291 3300005834 Ga0068851_10039073 Ga0068851_100390732 165
292 3300006353 Ga0075370_10021605 Ga0075370_100216052 165
293 3300006353 Ga0075370_10024409 Ga0075370_100244092 165
294 3300009093 Ga0105240_10000278 Ga0105240_1000027850 165
295 3300009148 Ga0105243_10406540 Ga0105243_104065402 165
296 3300009177 Ga0105248_10371542 Ga0105248_103715422 165
297 3300009545 Ga0105237_10000434 Ga0105237_1000043437 165
298 3300013104 Ga0157370_10008214 Ga0157370_100082145 165
299 3300013105 Ga0157369_10736726 Ga0157369_107367262 165
300 3300014497 Ga0182008_10086485 Ga0182008_100864852 165
301 3300015262 Ga0182007_10002185 Ga0182007_100021858 165
302 3300015265 Ga0182005_1003511 Ga0182005_10035116 165
303 3300025206 Ga0209435_100011 Ga0209435_100011299 165
304 3300025207 Ga0209760_101901 Ga0209760_1019012 165
305 3300025233 Ga0209437_100036 Ga0209437_10003653 165
306 3300025233 Ga0209437_100086 Ga0209437_100086195 165
307 3300025245 Ga0207425_1005318 Ga0207425_10053184 165
308 3300025246 Ga0209646_1000024 Ga0209646_1000024112 165
309 3300025250 Ga0209026_1000030 Ga0209026_1000030112 165
310 3300025254 Ga0209148_1005278 Ga0209148_10052783 165
311 3300025256 Ga0209759_1000011 Ga0209759_1000011299 165
312 3300025258 Ga0209129_1000261 Ga0209129_10002617 165
313 3300025261 Ga0209233_1000166 Ga0209233_100016653 165
314 3300025261 Ga0209233_1000465 Ga0209233_100046518 165
315 3300025272 Ga0209455_1010089 Ga0209455_10100894 165
316 3300025273 Ga0209673_1000728 Ga0209673_100072818 165
317 3300025273 Ga0209673_1001082 Ga0209673_10010827 165
318 3300025273 Ga0209673_1004752 Ga0209673_10047522 165
319 3300025273 Ga0209673_1038026 Ga0209673_10380262 165
320 3300025284 Ga0209130_1000088 Ga0209130_100008831 165
321 3300025284 Ga0209130_1034374 Ga0209130_10343742 165
322 3300025294 Ga0209025_1000407 Ga0209025_100040786 165
323 3300025295 Ga0209564_1001105 Ga0209564_10011052 165
324 3300025295 Ga0209564_1004453 Ga0209564_10044537 165
325 3300025295 Ga0209564_1004762 Ga0209564_10047627 165
326 3300025295 Ga0209564_1011537 Ga0209564_10115374 165
327 3300025295 Ga0209564_1052197 Ga0209564_10521972 165
328 3300025297 Ga0209758_1000336 Ga0209758_10003362 165
329 3300025297 Ga0209758_1007377 Ga0209758_10073772 165
330 3300025299 Ga0209256_1000800 Ga0209256_100080030 165
331 3300025299 Ga0209256_1007738 Ga0209256_10077384 165
332 3300025299 Ga0209256_1009190 Ga0209256_10091905 165
333 3300025299 Ga0209256_1046418 Ga0209256_10464182 165
334 3300025302 Ga0207426_1000012 Ga0207426_100001286 165
335 3300025302 Ga0207426_1000063 Ga0207426_1000063205 165
336 3300025303 Ga0209051_1032140 Ga0209051_10321402 165
337 3300025913 Ga0207695_10000376 Ga0207695_1000037650 165
338 3300025914 Ga0207671_10000732 Ga0207671_1000073237 165
339 3300025981 Ga0207640_10046737 Ga0207640_100467373 165
340 3300026078 Ga0207702_10107893 Ga0207702_101078932 165
341 3300027312 Ga0209371_1000853 Ga0209371_100085313 165
342 3300028379 Ga0268266_10057923 Ga0268266_100579232 165
343 3300028794 Ga0307515_10004227 Ga0307515_100042273 165
344 3300030500 Ga0268256_1001802 Ga0268256_100180212 165
345 3300031456 Ga0307513_10066571 Ga0307513_100665714 165
346 3300031903 Ga0307407_10214830 Ga0307407_102148302 165
347 3300032004 Ga0307414_10003863 Ga0307414_100038633 165
348 3300032005 Ga0307411_10014796 Ga0307411_100147965 165
349 3300041494 Ga0451837_0205861 Ga0451837_0205861_487_990 165
350 3300041498 Ga0451841_0151923 Ga0451841_0151923_143_646 165
351 3300041503 Ga0451847_0590084 Ga0451847_0590084_73_576 165
352 3300041511 Ga0451855_0093752 Ga0451855_0093752_434_937 165
353 3300041511 Ga0451855_0753743 Ga0451855_0753743_162_665 165
354 3300044684 Ga0466966_0137944 Ga0466966_0137944_467_964 165
355 3300044694 Ga0466963_0017322 Ga0466963_0017322_2611_3108 165
356 3300044706 Ga0466964_0120076 Ga0466964_0120076_500_997 165
357 3300044719 Ga0466971_0146252 Ga0466971_0146252_582_1079 165
358 3300044765 Ga0466970_0002337 Ga0466970_0002337_2540_3037 165
359 3300045836 Ga0466958_0040153 Ga0466958_0040153_870_1367 165
360 3300045976 Ga0466967_0101585 Ga0466967_0101585_1971_2468 165
361 3300045976 Ga0466967_0972658 Ga0466967_0972658_88_585 165
362 3300046460 Ga0495638_0000299 Ga0495638_0000299_9169_9672 165
363 3300046471 Ga0495650_0024257 Ga0495650_0024257_1097_1600 165
364 3300046500 Ga0495596_0043843 Ga0495596_0043843_363_866 165
365 3300046501 Ga0495607_0104420 Ga0495607_0104420_850_1353 165
366 3300046501 Ga0495607_0144883 Ga0495607_0144883_602_1105 165
367 3300046507 Ga0495606_0229447 Ga0495606_0229447_203_700 165
368 3300046507 Ga0495606_0542298 Ga0495606_0542298_49_552 165
369 3300046515 Ga0495620_0049039 Ga0495620_0049039_1272_1775 165
370 3300046518 Ga0495631_0064449 Ga0495631_0064449_193_696 165
371 3300046522 Ga0495643_0017635 Ga0495643_0017635_2114_2617 165
372 3300046522 Ga0495643_0214621 Ga0495643_0214621_248_745 165
373 3300046524 Ga0495648_0019794 Ga0495648_0019794_1952_2455 165
374 3300046538 Ga0495609_0092666 Ga0495609_0092666_121_624 165
375 3300046538 Ga0495609_0116463 Ga0495609_0116463_242_745 165
376 3300046558 Ga0495633_0115736 Ga0495633_0115736_715_1218 165
377 3300046616 Ga0495668_0104516 Ga0495668_0104516_179_682 165
378 3300046616 Ga0495668_0129565 Ga0495668_0129565_255_758 165
379 3300046648 Ga0495611_0021415 Ga0495611_0021415_2246_2749 165
380 3300046660 Ga0495625_0018281 Ga0495625_0018281_4850_5353 165
381 3300046660 Ga0495625_0064599 Ga0495625_0064599_1881_2384 165
382 3300046660 Ga0495625_0285337 Ga0495625_0285337_254_751 165
383 3300046665 Ga0495661_0134180 Ga0495661_0134180_570_1073 165
384 3300046694 Ga0495649_0035162 Ga0495649_0035162_196_699 165
385 3300046694 Ga0495649_0194841 Ga0495649_0194841_141_638 165
386 3300047318 Ga0495636_0007470 Ga0495636_0007470_691_1194 165
387 3300047320 Ga0495672_0010167 Ga0495672_0010167_4404_4907 165
388 3300047323 Ga0495683_0099119 Ga0495683_0099119_415_918 165
389 3300047443 Ga0495687_035724 Ga0495687_035724_1488_1991 165
390 3300047443 Ga0495687_082934 Ga0495687_082934_417_920 165
391 3300047469 Ga0495673_0176033 Ga0495673_0176033_55_579 165
392 3300047472 Ga0495686_0042587 Ga0495686_0042587_647_1150 165
393 3300047472 Ga0495686_0239108 Ga0495686_0239108_290_787 165
394 3300048090 Ga0495615_0058977 Ga0495615_0058977_385_888 165
395 3300048091 Ga0495626_0092554 Ga0495626_0092554_245_748 165
396 3300048903 Ga0496100_0029515 Ga0496100_0029515_1267_1767 165
397 3300048905 Ga0496102_0012829 Ga0496102_0012829_4305_4805 165
398 3300048906 Ga0496103_0045491 Ga0496103_0045491_1485_1985 165
399 3300048916 Ga0496113_0081609 Ga0496113_0081609_779_1279 165
400 3300048919 Ga0496116_0039156 Ga0496116_0039156_2726_3226 165
401 3300048920 Ga0496117_0005420 Ga0496117_0005420_6698_7198 165
402 3300048920 Ga0496117_0121640 Ga0496117_0121640_952_1449 165
403 3300048921 Ga0496118_0007122 Ga0496118_0007122_4795_5295 165
404 3300048921 Ga0496118_0008856 Ga0496118_0008856_6246_6749 165
405 3300048922 Ga0496119_0010893 Ga0496119_0010893_2246_2743 165
406 3300048922 Ga0496119_0022821 Ga0496119_0022821_3627_4127 165
407 3300048922 Ga0496119_0126873 Ga0496119_0126873_463_960 165
408 3300048922 Ga0496119_0252518 Ga0496119_0252518_335_835 165
409 3300048923 Ga0496120_0044222 Ga0496120_0044222_641_1138 165
410 3300048923 Ga0496120_0061666 Ga0496120_0061666_1034_1534 165
411 3300048923 Ga0496120_0152366 Ga0496120_0152366_470_970 165
412 3300048923 Ga0496120_0193320 Ga0496120_0193320_282_779 165
413 3300048924 Ga0496121_0020291 Ga0496121_0020291_6033_6533 165
414 3300048924 Ga0496121_0029629 Ga0496121_0029629_3214_3711 165
415 3300048924 Ga0496121_0445747 Ga0496121_0445747_55_555 165
416 3300048925 Ga0496122_0017437 Ga0496122_0017437_3361_3861 165
417 3300048925 Ga0496122_0031363 Ga0496122_0031363_249_746 165
418 3300048926 Ga0496123_0026366 Ga0496123_0026366_3619_4119 165
419 3300048927 Ga0496124_0063633 Ga0496124_0063633_2319_2816 165
420 3300048927 Ga0496124_0144246 Ga0496124_0144246_852_1352 165
421 3300048928 Ga0496125_0017738 Ga0496125_0017738_2337_2837 165
422 3300048928 Ga0496125_0106664 Ga0496125_0106664_1083_1580 165
423 3300048928 Ga0496125_0190703 Ga0496125_0190703_641_1138 165
424 3300050493 nmdc:mga0k408_293432_c1 nmdc:mga0k408_293432_c1_186_689 165
425 3300050494 nmdc:mga06z11_903036_c1 nmdc:mga06z11_903036_c1_19_522 165
426 3300050495 nmdc:mga04h51_8130_c1 nmdc:mga04h51_8130_c1_1911_2414 165
427 3300050496 nmdc:mga07m45_92756_c1 nmdc:mga07m45_92756_c1_338_841 165
428 3300050516 nmdc:mga0sz30_2873_c1 nmdc:mga0sz30_2873_c1_1301_1804 165
429 3300053118 Ga0500594_0004248 Ga0500594_0004248_1587_2090 165
430 3300053125 Ga0500618_006581 Ga0500618_006581_1325_1825 165
431 3300053134 Ga0500658_0038252 Ga0500658_0038252_314_817 165
432 3300053139 Ga0500568_0001239 Ga0500568_0001239_11124_11627 165
433 3300053142 Ga0500577_0054652 Ga0500577_0054652_166_669 165
434 3300053153 Ga0500616_0002540 Ga0500616_0002540_1414_1917 165
435 3300053160 Ga0500633_0138081 Ga0500633_0138081_187_690 165
436 3300053161 Ga0500634_0011866 Ga0500634_0011866_538_1038 165
437 3300053730 Ga0500645_026640 Ga0500645_026640_105_608 165

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

71

163

0.95

PF04191

PEMT

Phospholipid methyltransferase

68

164

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6x89-assembly1.cif.gz_4L vigna radiata mitochondrial complex i* 0.736 74 163
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.6688 8 162
6x89-assembly1.cif.gz_4L vigna radiata mitochondrial complex i* 0.6644 74 163
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.6357 8 162
5vg9-assembly1.cif.gz_A structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody 0.5689 36 160
ID Description Score Start End Superfamily
af_O06539_1_164_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8691 5 160 1.20.120.1630
af_Q2G1E3_21_189_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8513 5 158 1.20.120.1630
af_O06539_1_164_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.8244 5 160 1.20.120.1630
af_Q2G1E3_21_189_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.794 5 158 1.20.120.1630
af_Q8I555_347_506_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7121 68 164 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A2W2BWN4-F1-model_v4 Isoprenylcysteine carboxyl methyltransferase 0.9486 3 162 GO:0004671
GO:0016020
AF-A0A5P9K099-F1-model_v4 Isoprenylcysteine carboxyl methyltransferase 0.9413 4 165 GO:0004671
GO:0016020
AF-A0A5N3PA60-F1-model_v4 Isoprenylcysteine carboxyl methyltransferase 0.9401 7 163 GO:0004671
GO:0016020
AF-A0A559SRX6-F1-model_v4 Methyltransferase 0.9395 5 163 GO:0004671
GO:0016020
GO:0032259
AF-A0A2K9EN92-F1-model_v4 Chalcone/stilbene synthase N-terminal domain-containing protein 0.9382 3 162 GO:0004671
GO:0016020
GO:0016746

Feature Viewer

pLDDT pTM Quality
86.32 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map