F443814

General Info

Members Datasets Scaffolds Average Seq Length
437 224 874 309

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0083635|Ga0373937_0083635_105_1091
Length 328
Sequence VGVDGRPALSAGARVNIVLLFPGQGSQKPGMGKDLAEKFPAARAVFDAADAALGVPLSKLCFEGPEEELTATQNAQPALFAHGAAAWAVVREWLAPKVRAAAGHSLGEFTAHHAAGTFGLPEGLRLVRKRGELMADCGKRVPGAMAAILGLAEDLVESACDEAAAATKGVVVPANYNTAEQLVISGDVAAVEKAMEFAKAKGAKRALRLNVSGAFHSPLMESAVDGLKAALDAAGAKPAAFPVWTNVWAAPADDAAAATRTLREQLTSPVRWREEVERLAAAVPGALFVELGPGNVLANLVKRIVPGAETAGCGTAAEVDLLRARVAA

Samples

Sample ID Description Type Environment
1 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
152 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
153 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
176 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
185 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 2913912277 Desmonostoc muscorum LEGE 12446 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.23
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.37
Rhizosphere 97.71
Stem 0
Stem Tuber 0
Unclassified 2.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373937_0083635 3300036401 Bacteria 2953
2 Ga0070658_10005572 3300005327 Bacteria 10215
3 Ga0070658_10020195 3300005327 Bacteria 5337
4 Ga0070658_10028232 3300005327 Bacteria 4504
5 Ga0070683_100052365 3300005329 Bacteria 3781
6 Ga0070683_100055900 3300005329 Bacteria 3664
7 Ga0070683_100079525 3300005329 Bacteria 3068
8 Ga0070683_100212991 3300005329 Bacteria 1836
9 Ga0070670_100072843 3300005331 Bacteria 2951
10 Ga0070670_100106236 3300005331 Bacteria 2419
11 Ga0070680_100002771 3300005336 Bacteria 13014
12 Ga0070680_100025741 3300005336 Bacteria 4703
13 Ga0070680_100101464 3300005336 Bacteria 2389
14 Ga0070680_100145398 3300005336 Bacteria 1989
15 Ga0070682_100136933 3300005337 Bacteria 1664
16 Ga0068868_100057586 3300005338 Bacteria 3071
17 Ga0070660_100006398 3300005339 Bacteria 8164
18 Ga0070660_100009573 3300005339 Bacteria 6823
19 Ga0070660_100010396 3300005339 Bacteria 6579
20 Ga0070660_100098351 3300005339 Bacteria 2316
21 Ga0070660_100216210 3300005339 Bacteria 1557
22 Ga0070660_100323728 3300005339 Unclassified 1267
23 Ga0070689_100000820 3300005340 Bacteria 19223
24 Ga0070689_100114824 3300005340 Bacteria 2145
25 Ga0070661_100001847 3300005344 Bacteria 14669
26 Ga0070661_100008626 3300005344 Bacteria 7049
27 Ga0070661_100017038 3300005344 Bacteria 5148
28 Ga0070661_100050987 3300005344 Bacteria 3028
29 Ga0070661_100223489 3300005344 Bacteria 1445
30 Ga0070692_10006283 3300005345 Bacteria 5148
31 Ga0070668_100046138 3300005347 Bacteria 3345
32 Ga0070669_100014069 3300005353 Bacteria 5690
33 Ga0070669_100112006 3300005353 Bacteria 2072
34 Ga0070669_100360338 3300005353 Bacteria 1182
35 Ga0070675_100004283 3300005354 Bacteria 10868
36 Ga0070675_100238681 3300005354 Bacteria 1588
37 Ga0070675_100444117 3300005354 Unclassified 1162
38 Ga0070671_100141130 3300005355 Bacteria 2033
39 Ga0070671_100205159 3300005355 Bacteria 1672
40 Ga0070674_100129268 3300005356 Bacteria 1881
41 Ga0070673_100039973 3300005364 Bacteria 3595
42 Ga0070673_100173353 3300005364 Bacteria 1842
43 Ga0070659_100029004 3300005366 Bacteria 4275
44 Ga0070659_100036453 3300005366 Bacteria 3835
45 Ga0070667_100010859 3300005367 Bacteria 7530
46 Ga0070667_100117081 3300005367 Bacteria 2314
47 Ga0070714_100008673 3300005435 Bacteria 7948
48 Ga0070714_100014743 3300005435 Bacteria 6282
49 Ga0070714_100079770 3300005435 Bacteria 2846
50 Ga0070701_10005561 3300005438 Bacteria 5216
51 Ga0070711_100480403 3300005439 Bacteria 1021
52 Ga0070663_100080814 3300005455 Bacteria 2388
53 Ga0070678_100303209 3300005456 Bacteria 1358
54 Ga0070662_100000861 3300005457 Bacteria 18589
55 Ga0070662_100005047 3300005457 Bacteria 8402
56 Ga0070662_100126838 3300005457 Bacteria 1962
57 Ga0070681_10000380 3300005458 Bacteria 35836
58 Ga0070681_10000726 3300005458 Bacteria 27264
59 Ga0070681_10010812 3300005458 Bacteria 9022
60 Ga0070681_10169623 3300005458 Bacteria 2104
61 Ga0070681_10169624 3300005458 Bacteria 2104
62 Ga0068867_100012620 3300005459 Bacteria 5975
63 Ga0068867_100185664 3300005459 Bacteria 1656
64 Ga0070685_10003724 3300005466 Bacteria 7720
65 Ga0070685_10035984 3300005466 Bacteria 2797
66 Ga0070706_100012566 3300005467 Bacteria 7842
67 Ga0070698_100004513 3300005471 Bacteria 15298
68 Ga0070699_100041015 3300005518 Bacteria 4006
69 Ga0070699_100242801 3300005518 Bacteria 1608
70 Ga0070679_100002501 3300005530 Bacteria 16651
71 Ga0070679_100024121 3300005530 Bacteria 5960
72 Ga0070679_100060897 3300005530 Bacteria 3762
73 Ga0070679_100113365 3300005530 Bacteria 2697
74 Ga0070679_100136927 3300005530 Bacteria 2430
75 Ga0070679_100436854 3300005530 Bacteria 1254
76 Ga0070684_100021003 3300005535 Bacteria 5423
77 Ga0070684_100024070 3300005535 Bacteria 5104
78 Ga0070684_100047047 3300005535 Bacteria 3738
79 Ga0070684_100088270 3300005535 Bacteria 2755
80 Ga0068853_100016750 3300005539 Bacteria 6037
81 Ga0070672_100000541 3300005543 Bacteria 22176
82 Ga0070672_100062605 3300005543 Bacteria 2936
83 Ga0070672_100112681 3300005543 Bacteria 2219
84 Ga0070686_100000021 3300005544 Bacteria 131944
85 Ga0070686_100154124 3300005544 Bacteria 1612
86 Ga0070695_100125169 3300005545 Bacteria 1764
87 Ga0070696_100000915 3300005546 Bacteria 19198
88 Ga0070696_100167314 3300005546 Bacteria 1623
89 Ga0070696_100340560 3300005546 Bacteria 1159
90 Ga0070693_100001903 3300005547 Bacteria 9541
91 Ga0070665_100111913 3300005548 Bacteria 2733
92 Ga0070704_100206179 3300005549 Unclassified 1590
93 Ga0068855_100007112 3300005563 Bacteria 13576
94 Ga0068855_100047768 3300005563 Bacteria 5055
95 Ga0070664_100004074 3300005564 Bacteria 11745
96 Ga0070664_100014715 3300005564 Bacteria 6389
97 Ga0070664_100052998 3300005564 Bacteria 3437
98 Ga0068857_100005696 3300005577 Bacteria 10650
99 Ga0068857_100040156 3300005577 Bacteria 4149
100 Ga0068854_100025694 3300005578 Bacteria 4041
101 Ga0068854_100035622 3300005578 Bacteria 3484
102 Ga0068856_100178765 3300005614 Bacteria 2134
103 Ga0068856_100271325 3300005614 Bacteria 1712
104 Ga0068856_100445227 3300005614 Unclassified 1316
105 Ga0068852_100003057 3300005616 Bacteria 11641
106 Ga0068852_100006202 3300005616 Bacteria 8620
107 Ga0068852_100113921 3300005616 Bacteria 2463
108 Ga0068852_100232721 3300005616 Bacteria 1757
109 Ga0068852_100375322 3300005616 Bacteria 1394
110 Ga0068859_100057645 3300005617 Bacteria 3912
111 Ga0068859_100283431 3300005617 Bacteria 1750
112 Ga0068861_100001496 3300005719 Bacteria 14827
113 Ga0068851_10016265 3300005834 Bacteria 3558
114 Ga0068851_10103928 3300005834 Bacteria 1510
115 Ga0068863_100005973 3300005841 Bacteria 11943
116 Ga0068858_100001944 3300005842 Bacteria 21074
117 Ga0068860_100007228 3300005843 Bacteria 11103
118 Ga0068862_100001875 3300005844 Bacteria 19050
119 Ga0081455_10002698 3300005937 Bacteria 20954
120 Ga0081455_10013226 3300005937 Bacteria 8174
121 Ga0081455_10095539 3300005937 Bacteria 2399
122 Ga0081540_1000568 3300005983 Bacteria 35821
123 Ga0070712_100004579 3300006175 Bacteria 8537
124 Ga0097621_100474791 3300006237 Bacteria 1130
125 Ga0075428_100003463 3300006844 Bacteria 17271
126 Ga0075428_100009469 3300006844 Bacteria 10812
127 Ga0075430_100001593 3300006846 Bacteria 18540
128 Ga0075430_100016444 3300006846 Bacteria 6299
129 Ga0075431_100014491 3300006847 Bacteria 7975
130 Ga0075431_100050745 3300006847 Bacteria 4277
131 Ga0075431_100206399 3300006847 Bacteria 2009
132 Ga0075431_100226528 3300006847 Bacteria 1906
133 Ga0075433_10195400 3300006852 Bacteria 1800
134 Ga0075434_100046580 3300006871 Bacteria 4303
135 Ga0075434_100290489 3300006871 Bacteria 1655
136 Ga0075434_100344522 3300006871 Unclassified 1511
137 Ga0075429_100002085 3300006880 Bacteria 16680
138 Ga0075429_100015173 3300006880 Bacteria 6678
139 Ga0075429_100024186 3300006880 Bacteria 5268
140 Ga0075429_100054544 3300006880 Bacteria 3477
141 Ga0068865_100000859 3300006881 Bacteria 17240
142 Ga0068865_100274380 3300006881 Bacteria 1340
143 Ga0075436_100027527 3300006914 Bacteria 3911
144 Ga0075436_100189924 3300006914 Bacteria 1453
145 Ga0097620_100057643 3300006931 Bacteria 3912
146 Ga0097620_100283408 3300006931 Bacteria 1750
147 Ga0105240_10003063 3300009093 Bacteria 26282
148 Ga0105240_10044419 3300009093 Bacteria 5645
149 Ga0105240_10109154 3300009093 Bacteria 3351
150 Ga0111539_10033303 3300009094 Bacteria 6256
151 Ga0105245_10112571 3300009098 Bacteria 2533
152 Ga0114129_10000811 3300009147 Bacteria 40214
153 Ga0114129_10040096 3300009147 Bacteria 6603
154 Ga0114129_10178148 3300009147 Bacteria 2894
155 Ga0105241_10198839 3300009174 Bacteria 1673
156 Ga0105242_10095302 3300009176 Bacteria 2512
157 Ga0105248_10030773 3300009177 Bacteria 5996
158 Ga0105237_10308688 3300009545 Bacteria 1585
159 Ga0105238_10000003 3300009551 Bacteria 422077
160 Ga0105238_10050897 3300009551 Bacteria 4169
161 Ga0105249_10000078 3300009553 Bacteria 140030
162 Ga0105249_10001914 3300009553 Bacteria 18048
163 Ga0105239_10047599 3300010375 Bacteria 4700
164 Ga0157373_10018406 3300013100 Bacteria 5086
165 Ga0157373_10040750 3300013100 Bacteria 3323
166 Ga0157373_10056653 3300013100 Bacteria 2782
167 Ga0157371_10005782 3300013102 Bacteria 10359
168 Ga0157371_10070824 3300013102 Bacteria 2468
169 Ga0157370_10039641 3300013104 Bacteria 4552
170 Ga0157370_10051447 3300013104 Bacteria 3935
171 Ga0157370_10083708 3300013104 Bacteria 2999
172 Ga0157370_10091187 3300013104 Bacteria 2861
173 Ga0157370_10233009 3300013104 Bacteria 1704
174 Ga0157369_10002779 3300013105 Bacteria 20901
175 Ga0157369_10009006 3300013105 Bacteria 11431
176 Ga0157369_10057898 3300013105 Bacteria 4180
177 Ga0157369_10118500 3300013105 Bacteria 2810
178 Ga0157378_10107829 3300013297 Bacteria 2549
179 Ga0163162_10002945 3300013306 Bacteria 16244
180 Ga0163162_10550190 3300013306 Bacteria 1282
181 Ga0157372_10004069 3300013307 Bacteria 15676
182 Ga0157372_10012052 3300013307 Bacteria 9208
183 Ga0157372_10041455 3300013307 Bacteria 5091
184 Ga0157372_10051804 3300013307 Bacteria 4569
185 Ga0157372_10057335 3300013307 Bacteria 4354
186 Ga0157372_10143210 3300013307 Bacteria 2756
187 Ga0157372_10416886 3300013307 Bacteria 1565
188 Ga0157372_10541448 3300013307 Bacteria 1357
189 Ga0157375_10006537 3300013308 Bacteria 10148
190 Ga0157375_10055002 3300013308 Bacteria 3922
191 Ga0157375_10219374 3300013308 Bacteria 2060
192 Ga0163163_10102363 3300014325 Bacteria 2887
193 Ga0157380_10006265 3300014326 Bacteria 8354
194 Ga0182008_10024856 3300014497 Bacteria 3046
195 Ga0157379_10001165 3300014968 Bacteria 21400
196 Ga0206356_10612032 3300020070 Bacteria 2565
197 Ga0207656_10041982 3300025321 Bacteria 1945
198 Ga0207642_10052954 3300025899 Bacteria 1844
199 Ga0207688_10002308 3300025901 Bacteria 10262
200 Ga0207680_10057917 3300025903 Bacteria 2346
201 Ga0207647_10044024 3300025904 Bacteria 2791
202 Ga0207645_10000052 3300025907 Bacteria 83428
203 Ga0207643_10002623 3300025908 Bacteria 9729
204 Ga0207705_10002455 3300025909 Bacteria 14287
205 Ga0207705_10012810 3300025909 Bacteria 6055
206 Ga0207684_10014953 3300025910 Bacteria 6680
207 Ga0207707_10000368 3300025912 Bacteria 47267
208 Ga0207707_10000450 3300025912 Bacteria 42820
209 Ga0207707_10001930 3300025912 Bacteria 18855
210 Ga0207707_10005475 3300025912 Bacteria 11098
211 Ga0207707_10005859 3300025912 Bacteria 10743
212 Ga0207707_10089199 3300025912 Bacteria 2695
213 Ga0207707_10099753 3300025912 Bacteria 2538
214 Ga0207707_10177411 3300025912 Bacteria 1861
215 Ga0207707_10198206 3300025912 Bacteria 1751
216 Ga0207695_10002777 3300025913 Bacteria 25479
217 Ga0207695_10008659 3300025913 Bacteria 12697
218 Ga0207695_10055930 3300025913 Bacteria 4109
219 Ga0207695_10214435 3300025913 Bacteria 1835
220 Ga0207693_10008844 3300025915 Bacteria 8226
221 Ga0207663_10410372 3300025916 Bacteria 1038
222 Ga0207660_10005048 3300025917 Bacteria 8595
223 Ga0207660_10016477 3300025917 Bacteria 4893
224 Ga0207660_10023341 3300025917 Bacteria 4176
225 Ga0207660_10095606 3300025917 Bacteria 2211
226 Ga0207660_10106300 3300025917 Bacteria 2104
227 Ga0207662_10000243 3300025918 Bacteria 25152
228 Ga0207657_10010606 3300025919 Bacteria 9183
229 Ga0207657_10014880 3300025919 Bacteria 7569
230 Ga0207657_10029377 3300025919 Bacteria 5005
231 Ga0207657_10037358 3300025919 Bacteria 4337
232 Ga0207649_10009222 3300025920 Bacteria 5396
233 Ga0207649_10016090 3300025920 Bacteria 4212
234 Ga0207652_10001054 3300025921 Bacteria 25084
235 Ga0207652_10001788 3300025921 Bacteria 18701
236 Ga0207652_10007376 3300025921 Bacteria 8865
237 Ga0207652_10019468 3300025921 Bacteria 5583
238 Ga0207652_10038388 3300025921 Bacteria 4060
239 Ga0207652_10151395 3300025921 Bacteria 2077
240 Ga0207652_10163538 3300025921 Bacteria 1995
241 Ga0207681_10002709 3300025923 Bacteria 11224
242 Ga0207681_10035565 3300025923 Bacteria 3283
243 Ga0207694_10000020 3300025924 Bacteria 310240
244 Ga0207694_10042277 3300025924 Bacteria 3515
245 Ga0207650_10006123 3300025925 Bacteria 8198
246 Ga0207650_10046271 3300025925 Bacteria 3204
247 Ga0207650_10081619 3300025925 Bacteria 2453
248 Ga0207659_10003659 3300025926 Bacteria 9260
249 Ga0207659_10017678 3300025926 Bacteria 4660
250 Ga0207664_10015852 3300025929 Bacteria 5486
251 Ga0207664_10036273 3300025929 Bacteria 3810
252 Ga0207664_10043369 3300025929 Bacteria 3517
253 Ga0207664_10080258 3300025929 Bacteria 2651
254 Ga0207644_10145857 3300025931 Bacteria 1827
255 Ga0207690_10016425 3300025932 Bacteria 4502
256 Ga0207706_10000157 3300025933 Bacteria 75435
257 Ga0207706_10002118 3300025933 Bacteria 19435
258 Ga0207706_10147468 3300025933 Bacteria 2070
259 Ga0207670_10092189 3300025936 Bacteria 2144
260 Ga0207669_10065211 3300025937 Bacteria 2258
261 Ga0207669_10124119 3300025937 Bacteria 1760
262 Ga0207691_10001361 3300025940 Bacteria 24383
263 Ga0207691_10004269 3300025940 Bacteria 13882
264 Ga0207691_10009280 3300025940 Bacteria 9437
265 Ga0207691_10027222 3300025940 Bacteria 5363
266 Ga0207711_10009277 3300025941 Bacteria 8215
267 Ga0207689_10006051 3300025942 Bacteria 10700
268 Ga0207689_10281091 3300025942 Bacteria 1378
269 Ga0207661_10034732 3300025944 Bacteria 3924
270 Ga0207661_10168999 3300025944 Unclassified 1902
271 Ga0207661_10277720 3300025944 Bacteria 1496
272 Ga0207679_10004709 3300025945 Bacteria 8492
273 Ga0207679_10009341 3300025945 Bacteria 6280
274 Ga0207679_10017121 3300025945 Bacteria 4826
275 Ga0207679_10072434 3300025945 Bacteria 2602
276 Ga0207667_10018189 3300025949 Bacteria 7888
277 Ga0207667_10028677 3300025949 Bacteria 6043
278 Ga0207712_10000079 3300025961 Bacteria 115164
279 Ga0207712_10001471 3300025961 Bacteria 16070
280 Ga0207668_10033334 3300025972 Bacteria 3411
281 Ga0207668_10295555 3300025972 Bacteria 1334
282 Ga0207640_10002437 3300025981 Bacteria 9947
283 Ga0207640_10033880 3300025981 Bacteria 3182
284 Ga0207658_10109884 3300025986 Bacteria 2177
285 Ga0207658_10156256 3300025986 Bacteria 1864
286 Ga0207677_10040913 3300026023 Bacteria 3060
287 Ga0207639_10035239 3300026041 Bacteria 3703
288 Ga0207639_10083061 3300026041 Bacteria 2541
289 Ga0207639_10385710 3300026041 Bacteria 1259
290 Ga0207678_10022722 3300026067 Bacteria 5492
291 Ga0207678_10214507 3300026067 Bacteria 1647
292 Ga0207702_10450411 3300026078 Bacteria 1249
293 Ga0207641_10054648 3300026088 Bacteria 3389
294 Ga0207648_10021884 3300026089 Bacteria 5745
295 Ga0207648_10041799 3300026089 Bacteria 4026
296 Ga0207674_10001353 3300026116 Bacteria 31708
297 Ga0207674_10001558 3300026116 Bacteria 29526
298 Ga0207675_100003540 3300026118 Bacteria 15236
299 Ga0207675_100189151 3300026118 Bacteria 1974
300 Ga0207675_100293548 3300026118 Bacteria 1582
301 Ga0207698_10007594 3300026142 Bacteria 6799
302 Ga0207698_10008533 3300026142 Bacteria 6490
303 Ga0207698_10036798 3300026142 Bacteria 3597
304 Ga0207698_10041207 3300026142 Bacteria 3439
305 Ga0207698_10325572 3300026142 Bacteria 1441
306 Ga0207698_10393124 3300026142 Bacteria 1323
307 Ga0268266_10409502 3300028379 Bacteria 1283
308 Ga0268264_10281879 3300028381 Bacteria 1557
309 Ga0307515_10000901 3300028794 Bacteria 68376
310 Ga0307515_10132658 3300028794 Bacteria 2731
311 Ga0265338_10000509 3300028800 Bacteria 68816
312 Ga0307408_100001535 3300031548 Bacteria 17137
313 Ga0307408_100210983 3300031548 Bacteria 1578
314 Ga0307408_100314010 3300031548 Unclassified 1318
315 Ga0307405_10011595 3300031731 Bacteria 4631
316 Ga0307413_10212169 3300031824 Bacteria 1407
317 Ga0307413_10212945 3300031824 Bacteria 1405
318 Ga0307413_10258402 3300031824 Bacteria 1297
319 Ga0307410_10116283 3300031852 Bacteria 1943
320 Ga0307410_10130327 3300031852 Bacteria 1847
321 Ga0307406_10020600 3300031901 Bacteria 3887
322 Ga0307406_10028126 3300031901 Bacteria 3394
323 Ga0307409_100028447 3300031995 Bacteria 3982
324 Ga0307416_100043942 3300032002 Bacteria 3504
325 Ga0307416_100397973 3300032002 Bacteria 1414
326 Ga0307411_10047395 3300032005 Bacteria 2778
327 Ga0316580_10066563 3300032139 Bacteria 1105
328 Ga0373959_0000338 3300034820 Bacteria 9563
329 Ga0373944_0061907 3300035089 Bacteria 1202
330 Ga0373945_0024185 3300035116 Bacteria 2103
331 Ga0373943_0007692 3300035170 Bacteria 4840
332 Ga0373946_0069814 3300035171 Unclassified 1514
333 Ga0373947_0004333 3300035725 Bacteria 8334
334 Ga0373937_0027057 3300036401 Bacteria 5184
335 Ga0373925_0072569 3300037068 Bacteria 2604
336 Ga0395900_0342019 3300037418 Bacteria 1471
337 Ga0395905_0001463 3300037471 Bacteria 28334
338 Ga0395905_0012530 3300037471 Bacteria 8158
339 Ga0395901_0059843 3300038443 Bacteria 3963
340 Ga0395901_0512706 3300038443 Bacteria 1219
341 Ga0436365_0599963 3300039437 Bacteria 1745
342 Ga0451791_0008689 3300041451 Bacteria 1730
343 Ga0451577_0000016 3300042876 Bacteria 531002
344 Ga0451577_0047148 3300042876 Bacteria 3853
345 Ga0453683_0018967 3300044673 Bacteria 4411
346 Ga0453683_0363244 3300044673 Unclassified 931
347 Ga0466961_0002533 3300044693 Bacteria 11328
348 Ga0466964_0009738 3300044706 Bacteria 3620
349 Ga0453684_0028428 3300044712 Bacteria 7978
350 Ga0451576_0090324 3300045051 Bacteria 3186
351 Ga0451576_0110135 3300045051 Bacteria 2866
352 Ga0495603_0006059 3300046455 Bacteria 7231
353 Ga0495603_0031799 3300046455 Bacteria 3177
354 Ga0495629_0028452 3300046459 Bacteria 3968
355 Ga0495651_0104613 3300046462 Bacteria 2101
356 Ga0495580_0012371 3300046472 Bacteria 6545
357 Ga0495580_0154584 3300046472 Bacteria 1589
358 Ga0495582_0012119 3300046473 Bacteria 4750
359 Ga0495662_0048422 3300046476 Bacteria 2052
360 Ga0495662_0174503 3300046476 Bacteria 1059
361 Ga0495594_0017024 3300046499 Bacteria 3837
362 Ga0495608_0176670 3300046511 Bacteria 1352
363 Ga0495618_0105512 3300046514 Bacteria 1804
364 Ga0495630_0006626 3300046517 Bacteria 8251
365 Ga0495630_0019414 3300046517 Bacteria 4997
366 Ga0495630_0066915 3300046517 Bacteria 2701
367 Ga0495630_0067248 3300046517 Bacteria 2693
368 Ga0495630_0081201 3300046517 Unclassified 2447
369 Ga0495663_0013206 3300046525 Bacteria 2309
370 Ga0495652_0024681 3300046529 Bacteria 5320
371 Ga0495652_0027247 3300046529 Bacteria 5037
372 Ga0495652_0072050 3300046529 Bacteria 2881
373 Ga0495665_0009865 3300046531 Bacteria 5169
374 Ga0495665_0195328 3300046531 Bacteria 1050
375 Ga0495640_0009895 3300046533 Bacteria 7397
376 Ga0495586_0043223 3300046535 Bacteria 2427
377 Ga0495586_0058928 3300046535 Bacteria 2086
378 Ga0495586_0122647 3300046535 Bacteria 1452
379 Ga0495587_0133535 3300046536 Bacteria 1418
380 Ga0495598_0002682 3300046537 Bacteria 3686
381 Ga0495621_0028662 3300046539 Bacteria 1894
382 Ga0495645_0141620 3300046543 Bacteria 1677
383 Ga0495645_0221467 3300046543 Unclassified 1272
384 Ga0495667_0080197 3300046559 Bacteria 2122
385 Ga0495635_0189856 3300046663 Bacteria 1395
386 Ga0495588_0005185 3300046674 Bacteria 5790
387 Ga0495657_0011380 3300046675 Bacteria 6655
388 Ga0495599_0015232 3300046678 Bacteria 4769
389 Ga0495658_0002938 3300046683 Bacteria 8548
390 Ga0495658_0128828 3300046683 Bacteria 1538
391 Ga0495613_0001135 3300046689 Bacteria 20258
392 Ga0495613_0015781 3300046689 Bacteria 5622
393 Ga0495613_0025142 3300046689 Bacteria 4438
394 Ga0495613_0226617 3300046689 Bacteria 1310
395 Ga0495624_0215341 3300046690 Bacteria 1165
396 Ga0495600_0161163 3300046809 Bacteria 1450
397 Ga0495581_0017542 3300047315 Bacteria 4157
398 Ga0495581_0045190 3300047315 Bacteria 2546
399 Ga0495674_0091102 3300047319 Bacteria 2605
400 Ga0495674_0182103 3300047319 Bacteria 1749
401 Ga0495680_0034773 3300047322 Bacteria 4065
402 Ga0495680_0062149 3300047322 Bacteria 2872
403 Ga0495675_0009763 3300047444 Bacteria 5985
404 Ga0495675_0022599 3300047444 Bacteria 4010
405 Ga0495675_0024751 3300047444 Bacteria 3829
406 Ga0495684_0015339 3300047471 Bacteria 5897
407 Ga0495684_0032178 3300047471 Bacteria 4025
408 Ga0495602_0020469 3300048088 Bacteria 6539
409 Ga0495614_0001483 3300048089 Bacteria 10159
410 Ga0495614_0004134 3300048089 Bacteria 6535
411 Ga0496101_0037269 3300048904 Bacteria 3449
412 Ga0496106_0146692 3300048909 Bacteria 1859
413 Ga0496109_0276467 3300048912 Bacteria 1582
414 Ga0496112_0173443 3300048915 Bacteria 2122
415 Ga0496114_0131571 3300048917 Bacteria 2161
416 Ga0501034_0198202 3300049571 Bacteria 1967
417 Ga0501038_0376245 3300049574 Unclassified 1102
418 Ga0501076_0081138 3300049592 Bacteria 2604
419 Ga0501079_0067663 3300049741 Bacteria 2757
420 Ga0501080_0101740 3300049742 Bacteria 2666
421 Ga0501035_0087729 3300049822 Bacteria 2742
422 nmdc:mga05p37_218_c1 3300050507 Bacteria 57675
423 nmdc:mga09592_14539_c1 3300050508 Bacteria 6424
424 nmdc:mga09592_20957_c1 3300050508 Bacteria 5382
425 nmdc:mga09592_4337_c1 3300050508 Bacteria 11468
426 nmdc:mga0qj67_12835_c1 3300050509 Bacteria 6320
427 nmdc:mga0qj67_25274_c1 3300050509 Bacteria 4588
428 nmdc:mga0qj67_7084_c1 3300050509 Bacteria 8272
429 nmdc:mga06r32_16058_c1 3300050510 Bacteria 6816
430 nmdc:mga06r32_38918_c1 3300050510 Bacteria 4508
431 nmdc:mga06r32_494784_c1 3300050510 Bacteria 1200
432 nmdc:mga08y16_129046_c1 3300050511 Bacteria 2630
433 nmdc:mga0n895_299002_c1 3300050512 Bacteria 1632
434 nmdc:mga0n895_46090_c1 3300050512 Bacteria 4258
435 nmdc:mga08x19_5693_c1 3300050514 Bacteria 7364
436 nmdc:mga0a205_213168_c1 3300050515 Bacteria 1819
437 2913914299 2913912277 Bacteria 9037797
438 Ga0373937_0083635
439 Ga0070658_10005572
440 Ga0070658_10020195
441 Ga0070658_10028232
442 Ga0070683_100052365
443 Ga0070683_100055900
444 Ga0070683_100079525
445 Ga0070683_100212991
446 Ga0070670_100072843
447 Ga0070670_100106236
448 Ga0070680_100002771
449 Ga0070680_100025741
450 Ga0070680_100101464
451 Ga0070680_100145398
452 Ga0070682_100136933
453 Ga0068868_100057586
454 Ga0070660_100006398
455 Ga0070660_100009573
456 Ga0070660_100010396
457 Ga0070660_100098351
458 Ga0070660_100216210
459 Ga0070660_100323728
460 Ga0070689_100000820
461 Ga0070689_100114824
462 Ga0070661_100001847
463 Ga0070661_100008626
464 Ga0070661_100017038
465 Ga0070661_100050987
466 Ga0070661_100223489
467 Ga0070692_10006283
468 Ga0070668_100046138
469 Ga0070669_100014069
470 Ga0070669_100112006
471 Ga0070669_100360338
472 Ga0070675_100004283
473 Ga0070675_100238681
474 Ga0070675_100444117
475 Ga0070671_100141130
476 Ga0070671_100205159
477 Ga0070674_100129268
478 Ga0070673_100039973
479 Ga0070673_100173353
480 Ga0070659_100029004
481 Ga0070659_100036453
482 Ga0070667_100010859
483 Ga0070667_100117081
484 Ga0070714_100008673
485 Ga0070714_100014743
486 Ga0070714_100079770
487 Ga0070701_10005561
488 Ga0070711_100480403
489 Ga0070663_100080814
490 Ga0070678_100303209
491 Ga0070662_100000861
492 Ga0070662_100005047
493 Ga0070662_100126838
494 Ga0070681_10000380
495 Ga0070681_10000726
496 Ga0070681_10010812
497 Ga0070681_10169623
498 Ga0070681_10169624
499 Ga0068867_100012620
500 Ga0068867_100185664
501 Ga0070685_10003724
502 Ga0070685_10035984
503 Ga0070706_100012566
504 Ga0070698_100004513
505 Ga0070699_100041015
506 Ga0070699_100242801
507 Ga0070679_100002501
508 Ga0070679_100024121
509 Ga0070679_100060897
510 Ga0070679_100113365
511 Ga0070679_100136927
512 Ga0070679_100436854
513 Ga0070684_100021003
514 Ga0070684_100024070
515 Ga0070684_100047047
516 Ga0070684_100088270
517 Ga0068853_100016750
518 Ga0070672_100000541
519 Ga0070672_100062605
520 Ga0070672_100112681
521 Ga0070686_100000021
522 Ga0070686_100154124
523 Ga0070695_100125169
524 Ga0070696_100000915
525 Ga0070696_100167314
526 Ga0070696_100340560
527 Ga0070693_100001903
528 Ga0070665_100111913
529 Ga0070704_100206179
530 Ga0068855_100007112
531 Ga0068855_100047768
532 Ga0070664_100004074
533 Ga0070664_100014715
534 Ga0070664_100052998
535 Ga0068857_100005696
536 Ga0068857_100040156
537 Ga0068854_100025694
538 Ga0068854_100035622
539 Ga0068856_100178765
540 Ga0068856_100271325
541 Ga0068856_100445227
542 Ga0068852_100003057
543 Ga0068852_100006202
544 Ga0068852_100113921
545 Ga0068852_100232721
546 Ga0068852_100375322
547 Ga0068859_100057645
548 Ga0068859_100283431
549 Ga0068861_100001496
550 Ga0068851_10016265
551 Ga0068851_10103928
552 Ga0068863_100005973
553 Ga0068858_100001944
554 Ga0068860_100007228
555 Ga0068862_100001875
556 Ga0081455_10002698
557 Ga0081455_10013226
558 Ga0081455_10095539
559 Ga0081540_1000568
560 Ga0070712_100004579
561 Ga0097621_100474791
562 Ga0075428_100003463
563 Ga0075428_100009469
564 Ga0075430_100001593
565 Ga0075430_100016444
566 Ga0075431_100014491
567 Ga0075431_100050745
568 Ga0075431_100206399
569 Ga0075431_100226528
570 Ga0075433_10195400
571 Ga0075434_100046580
572 Ga0075434_100290489
573 Ga0075434_100344522
574 Ga0075429_100002085
575 Ga0075429_100015173
576 Ga0075429_100024186
577 Ga0075429_100054544
578 Ga0068865_100000859
579 Ga0068865_100274380
580 Ga0075436_100027527
581 Ga0075436_100189924
582 Ga0097620_100057643
583 Ga0097620_100283408
584 Ga0105240_10003063
585 Ga0105240_10044419
586 Ga0105240_10109154
587 Ga0111539_10033303
588 Ga0105245_10112571
589 Ga0114129_10000811
590 Ga0114129_10040096
591 Ga0114129_10178148
592 Ga0105241_10198839
593 Ga0105242_10095302
594 Ga0105248_10030773
595 Ga0105237_10308688
596 Ga0105238_10000003
597 Ga0105238_10050897
598 Ga0105249_10000078
599 Ga0105249_10001914
600 Ga0105239_10047599
601 Ga0157373_10018406
602 Ga0157373_10040750
603 Ga0157373_10056653
604 Ga0157371_10005782
605 Ga0157371_10070824
606 Ga0157370_10039641
607 Ga0157370_10051447
608 Ga0157370_10083708
609 Ga0157370_10091187
610 Ga0157370_10233009
611 Ga0157369_10002779
612 Ga0157369_10009006
613 Ga0157369_10057898
614 Ga0157369_10118500
615 Ga0157378_10107829
616 Ga0163162_10002945
617 Ga0163162_10550190
618 Ga0157372_10004069
619 Ga0157372_10012052
620 Ga0157372_10041455
621 Ga0157372_10051804
622 Ga0157372_10057335
623 Ga0157372_10143210
624 Ga0157372_10416886
625 Ga0157372_10541448
626 Ga0157375_10006537
627 Ga0157375_10055002
628 Ga0157375_10219374
629 Ga0163163_10102363
630 Ga0157380_10006265
631 Ga0182008_10024856
632 Ga0157379_10001165
633 Ga0206356_10612032
634 Ga0207656_10041982
635 Ga0207642_10052954
636 Ga0207688_10002308
637 Ga0207680_10057917
638 Ga0207647_10044024
639 Ga0207645_10000052
640 Ga0207643_10002623
641 Ga0207705_10002455
642 Ga0207705_10012810
643 Ga0207684_10014953
644 Ga0207707_10000368
645 Ga0207707_10000450
646 Ga0207707_10001930
647 Ga0207707_10005475
648 Ga0207707_10005859
649 Ga0207707_10089199
650 Ga0207707_10099753
651 Ga0207707_10177411
652 Ga0207707_10198206
653 Ga0207695_10002777
654 Ga0207695_10008659
655 Ga0207695_10055930
656 Ga0207695_10214435
657 Ga0207693_10008844
658 Ga0207663_10410372
659 Ga0207660_10005048
660 Ga0207660_10016477
661 Ga0207660_10023341
662 Ga0207660_10095606
663 Ga0207660_10106300
664 Ga0207662_10000243
665 Ga0207657_10010606
666 Ga0207657_10014880
667 Ga0207657_10029377
668 Ga0207657_10037358
669 Ga0207649_10009222
670 Ga0207649_10016090
671 Ga0207652_10001054
672 Ga0207652_10001788
673 Ga0207652_10007376
674 Ga0207652_10019468
675 Ga0207652_10038388
676 Ga0207652_10151395
677 Ga0207652_10163538
678 Ga0207681_10002709
679 Ga0207681_10035565
680 Ga0207694_10000020
681 Ga0207694_10042277
682 Ga0207650_10006123
683 Ga0207650_10046271
684 Ga0207650_10081619
685 Ga0207659_10003659
686 Ga0207659_10017678
687 Ga0207664_10015852
688 Ga0207664_10036273
689 Ga0207664_10043369
690 Ga0207664_10080258
691 Ga0207644_10145857
692 Ga0207690_10016425
693 Ga0207706_10000157
694 Ga0207706_10002118
695 Ga0207706_10147468
696 Ga0207670_10092189
697 Ga0207669_10065211
698 Ga0207669_10124119
699 Ga0207691_10001361
700 Ga0207691_10004269
701 Ga0207691_10009280
702 Ga0207691_10027222
703 Ga0207711_10009277
704 Ga0207689_10006051
705 Ga0207689_10281091
706 Ga0207661_10034732
707 Ga0207661_10168999
708 Ga0207661_10277720
709 Ga0207679_10004709
710 Ga0207679_10009341
711 Ga0207679_10017121
712 Ga0207679_10072434
713 Ga0207667_10018189
714 Ga0207667_10028677
715 Ga0207712_10000079
716 Ga0207712_10001471
717 Ga0207668_10033334
718 Ga0207668_10295555
719 Ga0207640_10002437
720 Ga0207640_10033880
721 Ga0207658_10109884
722 Ga0207658_10156256
723 Ga0207677_10040913
724 Ga0207639_10035239
725 Ga0207639_10083061
726 Ga0207639_10385710
727 Ga0207678_10022722
728 Ga0207678_10214507
729 Ga0207702_10450411
730 Ga0207641_10054648
731 Ga0207648_10021884
732 Ga0207648_10041799
733 Ga0207674_10001353
734 Ga0207674_10001558
735 Ga0207675_100003540
736 Ga0207675_100189151
737 Ga0207675_100293548
738 Ga0207698_10007594
739 Ga0207698_10008533
740 Ga0207698_10036798
741 Ga0207698_10041207
742 Ga0207698_10325572
743 Ga0207698_10393124
744 Ga0268266_10409502
745 Ga0268264_10281879
746 Ga0307515_10000901
747 Ga0307515_10132658
748 Ga0265338_10000509
749 Ga0307408_100001535
750 Ga0307408_100210983
751 Ga0307408_100314010
752 Ga0307405_10011595
753 Ga0307413_10212169
754 Ga0307413_10212945
755 Ga0307413_10258402
756 Ga0307410_10116283
757 Ga0307410_10130327
758 Ga0307406_10020600
759 Ga0307406_10028126
760 Ga0307409_100028447
761 Ga0307416_100043942
762 Ga0307416_100397973
763 Ga0307411_10047395
764 Ga0316580_10066563
765 Ga0373959_0000338
766 Ga0373944_0061907
767 Ga0373945_0024185
768 Ga0373943_0007692
769 Ga0373946_0069814
770 Ga0373947_0004333
771 Ga0373937_0027057
772 Ga0373925_0072569
773 Ga0395900_0342019
774 Ga0395905_0001463
775 Ga0395905_0012530
776 Ga0395901_0059843
777 Ga0395901_0512706
778 Ga0436365_0599963
779 Ga0451791_0008689
780 Ga0451577_0000016
781 Ga0451577_0047148
782 Ga0453683_0018967
783 Ga0453683_0363244
784 Ga0466961_0002533
785 Ga0466964_0009738
786 Ga0453684_0028428
787 Ga0451576_0090324
788 Ga0451576_0110135
789 Ga0495603_0006059
790 Ga0495603_0031799
791 Ga0495629_0028452
792 Ga0495651_0104613
793 Ga0495580_0012371
794 Ga0495580_0154584
795 Ga0495582_0012119
796 Ga0495662_0048422
797 Ga0495662_0174503
798 Ga0495594_0017024
799 Ga0495608_0176670
800 Ga0495618_0105512
801 Ga0495630_0006626
802 Ga0495630_0019414
803 Ga0495630_0066915
804 Ga0495630_0067248
805 Ga0495630_0081201
806 Ga0495663_0013206
807 Ga0495652_0024681
808 Ga0495652_0027247
809 Ga0495652_0072050
810 Ga0495665_0009865
811 Ga0495665_0195328
812 Ga0495640_0009895
813 Ga0495586_0043223
814 Ga0495586_0058928
815 Ga0495586_0122647
816 Ga0495587_0133535
817 Ga0495598_0002682
818 Ga0495621_0028662
819 Ga0495645_0141620
820 Ga0495645_0221467
821 Ga0495667_0080197
822 Ga0495635_0189856
823 Ga0495588_0005185
824 Ga0495657_0011380
825 Ga0495599_0015232
826 Ga0495658_0002938
827 Ga0495658_0128828
828 Ga0495613_0001135
829 Ga0495613_0015781
830 Ga0495613_0025142
831 Ga0495613_0226617
832 Ga0495624_0215341
833 Ga0495600_0161163
834 Ga0495581_0017542
835 Ga0495581_0045190
836 Ga0495674_0091102
837 Ga0495674_0182103
838 Ga0495680_0034773
839 Ga0495680_0062149
840 Ga0495675_0009763
841 Ga0495675_0022599
842 Ga0495675_0024751
843 Ga0495684_0015339
844 Ga0495684_0032178
845 Ga0495602_0020469
846 Ga0495614_0001483
847 Ga0495614_0004134
848 Ga0496101_0037269
849 Ga0496106_0146692
850 Ga0496109_0276467
851 Ga0496112_0173443
852 Ga0496114_0131571
853 Ga0501034_0198202
854 Ga0501038_0376245
855 Ga0501076_0081138
856 Ga0501079_0067663
857 Ga0501080_0101740
858 Ga0501035_0087729
859 nmdc:mga05p37_218_c1
860 nmdc:mga09592_14539_c1
861 nmdc:mga09592_20957_c1
862 nmdc:mga09592_4337_c1
863 nmdc:mga0qj67_12835_c1
864 nmdc:mga0qj67_25274_c1
865 nmdc:mga0qj67_7084_c1
866 nmdc:mga06r32_16058_c1
867 nmdc:mga06r32_38918_c1
868 nmdc:mga06r32_494784_c1
869 nmdc:mga08y16_129046_c1
870 nmdc:mga0n895_299002_c1
871 nmdc:mga0n895_46090_c1
872 nmdc:mga08x19_5693_c1
873 nmdc:mga0a205_213168_c1
874 2913914299

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00698

Acyl_transf_1

Acyl transferase domain

18

318

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g2y-assembly1.cif.gz_A structure of e.coli fabd complexed with malonate 0.9655 2 307
3h0p-assembly1.cif.gz_A 2.0 angstrom crystal structure of an acyl carrier protein s-malonyltransferase from salmonella typhimurium. 0.9605 1 308
2g2y-assembly1.cif.gz_A structure of e.coli fabd complexed with malonate 0.9593 2 307
6smd-assembly2.cif.gz_C plmcat:antf (holo): type ii pks acyl-carrier protein in complex with its malonyl-transacylase 0.9582 1 310
6smd-assembly2.cif.gz_C plmcat:antf (holo): type ii pks acyl-carrier protein in complex with its malonyl-transacylase 0.9522 1 310
ID Description Score Start End Superfamily
2g1hA01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9627 2 309 3.40.366.10
af_P0AAI9_6_286_3.20.10.10 Alpha Beta;Alpha-Beta Barrel;D-amino Acid Aminotransferase; Chain A, domain 2;D-amino Acid Aminotransferase, subunit A, domain 2 0.9589 6 287 3.20.10.10
1nm2A02 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9588 3 307 3.40.366.10
2cuyB01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9548 1 310 3.40.366.10
2g1hA01 Alpha Beta;3-Layer(aba) Sandwich;Malonyl-Coenzyme A Acyl Carrier Protein; domain 2;Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 0.9547 2 309 3.40.366.10
ID Description Score Start End GO Terms
AF-A0A7C5CIY7-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9744 1 311 GO:0004314
GO:0005829
GO:0006633
AF-A0A258XHI3-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9744 4 120 GO:0004314
GO:0005829
GO:0006633
AF-A0A2D6LXJ3-F1-model_v4 deleted 0.9741 2 304
AF-A0A7C5I091-F1-model_v4 [acyl-carrier-protein] S-malonyltransferase (EC 2.3.1.39) 0.9727 93 308 GO:0004314
GO:0005829
GO:0006633
AF-A0A497B2I1-F1-model_v4 Malonyl CoA-acyl carrier protein transacylase (EC 2.3.1.39) 0.9726 1 310 GO:0004314
GO:0005829
GO:0006633

Map