F443811

General Info

Members Datasets Scaffolds Average Seq Length
437 195 874 88

Family's Representative Sequence

Representative Sequence 3300035119|Ga0373956_0498789|Ga0373956_0498789_215_526
Length 103
Sequence MEAPGASRRTESEVDVKAIVLGIGSGASMDAIMAVYPRHKAVVDEFVEHGDVIGIGPFADRGGNLAIFRSREAAEAFVKRDPFILEGLIKSYDIREWADQMLA

Samples

Sample ID Description Type Environment
1 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
159 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
160 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
161 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
169 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
170 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
194 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
195 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 0.69
Rhizosphere 96.8
Stem 0
Stem Tuber 0
Unclassified 27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373956_0498789 3300035119 Unclassified 581
2 JGI24745J21846_1021941 3300002073 Unclassified 752
3 JGI24749J21850_1029805 3300002076 Unclassified 782
4 JGI24035J26624_1005381 3300002126 Unclassified 1226
5 JGI24034J26672_10022665 3300002239 Unclassified 993
6 rootL2_10058436 3300003322 Bacteria 3298
7 rootL2_10123446 3300003322 Bacteria 1510
8 rootL2_10205095 3300003322 Bacteria 4488
9 Ga0065704_10361848 3300005289 Bacteria 796
10 Ga0065704_10386029 3300005289 Bacteria 768
11 Ga0065712_10033764 3300005290 Unclassified 1136
12 Ga0065715_10138091 3300005293 Bacteria 1894
13 Ga0070676_10044778 3300005328 Bacteria 2576
14 Ga0070690_100184096 3300005330 Unclassified 1444
15 Ga0070690_100192667 3300005330 Bacteria 1414
16 Ga0070690_100605603 3300005330 Bacteria 832
17 Ga0070690_100649878 3300005330 Archaea 805
18 Ga0070670_100248302 3300005331 Bacteria 1550
19 Ga0070670_100391093 3300005331 Bacteria 1226
20 Ga0070670_100517136 3300005331 Unclassified 1063
21 Ga0070677_10004849 3300005333 Bacteria 4414
22 Ga0068869_100027600 3300005334 Unclassified 3960
23 Ga0068869_100135567 3300005334 Bacteria 1896
24 Ga0068869_100356992 3300005334 Bacteria 1193
25 Ga0070666_10003383 3300005335 Bacteria 9668
26 Ga0070666_10655910 3300005335 Bacteria 768
27 Ga0070680_100004942 3300005336 Bacteria 10040
28 Ga0070680_100417330 3300005336 Unclassified 1145
29 Ga0070680_100703642 3300005336 Bacteria 869
30 Ga0070680_100966926 3300005336 Bacteria 735
31 Ga0070682_100111476 3300005337 Bacteria 1824
32 Ga0068868_100016751 3300005338 Bacteria 5449
33 Ga0070660_100063058 3300005339 Bacteria 2880
34 Ga0070660_100101410 3300005339 Bacteria 2281
35 Ga0070689_100000003 3300005340 Bacteria 579260
36 Ga0070689_100017121 3300005340 Bacteria 5317
37 Ga0070689_100024327 3300005340 Bacteria 4542
38 Ga0070689_100154849 3300005340 Bacteria 1850
39 Ga0070689_100828013 3300005340 Unclassified 815
40 Ga0070691_10027006 3300005341 Unclassified 2677
41 Ga0070691_10670539 3300005341 Bacteria 619
42 Ga0070691_10771685 3300005341 Unclassified 583
43 Ga0070687_100004378 3300005343 Bacteria 5622
44 Ga0070687_101048514 3300005343 Bacteria 593
45 Ga0070661_100001575 3300005344 Bacteria 15817
46 Ga0070661_100022699 3300005344 Bacteria 4494
47 Ga0070661_100098632 3300005344 Bacteria 2170
48 Ga0070692_10470872 3300005345 Unclassified 808
49 Ga0070668_100066594 3300005347 Unclassified 2795
50 Ga0070669_100010179 3300005353 Bacteria 6684
51 Ga0070669_100029389 3300005353 Bacteria 3961
52 Ga0070675_100097313 3300005354 Bacteria 2474
53 Ga0070675_100277364 3300005354 Unclassified 1472
54 Ga0070671_100046178 3300005355 Unclassified 3622
55 Ga0070671_100790619 3300005355 Unclassified 826
56 Ga0070674_100250887 3300005356 Unclassified 1390
57 Ga0070673_100058396 3300005364 Bacteria 3050
58 Ga0070673_100131086 3300005364 Bacteria 2103
59 Ga0070673_100496331 3300005364 Bacteria 1104
60 Ga0070688_100023697 3300005365 Bacteria 3613
61 Ga0070688_100133407 3300005365 Archaea 1678
62 Ga0070688_100178139 3300005365 Unclassified 1472
63 Ga0070659_100024655 3300005366 Unclassified 4613
64 Ga0070659_100475090 3300005366 Bacteria 1063
65 Ga0070659_100627684 3300005366 Bacteria 925
66 Ga0070659_100631401 3300005366 Unclassified 922
67 Ga0070667_100010851 3300005367 Bacteria 7533
68 Ga0070703_10055437 3300005406 Unclassified 1280
69 Ga0070701_10015084 3300005438 Unclassified 3559
70 Ga0070711_100275806 3300005439 Bacteria 1328
71 Ga0070705_100117928 3300005440 Bacteria 1708
72 Ga0070705_101653382 3300005440 Unclassified 540
73 Ga0070700_100021790 3300005441 Bacteria 3728
74 Ga0070663_100075596 3300005455 Unclassified 2462
75 Ga0070663_100327721 3300005455 Bacteria 1233
76 Ga0070663_101868631 3300005455 Bacteria 539
77 Ga0070678_100025849 3300005456 Bacteria 3959
78 Ga0070678_100232158 3300005456 Bacteria 1539
79 Ga0070678_100326119 3300005456 Unclassified 1313
80 Ga0070662_100004495 3300005457 Bacteria 8834
81 Ga0070662_100456409 3300005457 Bacteria 1061
82 Ga0070681_10028568 3300005458 Bacteria 5608
83 Ga0070681_10043871 3300005458 Unclassified 4476
84 Ga0070681_10568262 3300005458 Bacteria 1048
85 Ga0070681_11678905 3300005458 Unclassified 561
86 Ga0070681_12023501 3300005458 Bacteria 504
87 Ga0068867_100019647 3300005459 Bacteria 4812
88 Ga0070685_10021898 3300005466 Bacteria 3477
89 Ga0070685_10106027 3300005466 Bacteria 1723
90 Ga0070685_10818456 3300005466 Bacteria 688
91 Ga0070699_100381649 3300005518 Bacteria 1272
92 Ga0070679_100007239 3300005530 Bacteria 10356
93 Ga0070679_100008311 3300005530 Bacteria 9766
94 Ga0070679_100526113 3300005530 Unclassified 1126
95 Ga0070679_100557093 3300005530 Bacteria 1090
96 Ga0070684_100009579 3300005535 Bacteria 7632
97 Ga0070684_100541063 3300005535 Unclassified 1080
98 Ga0070684_100750698 3300005535 Unclassified 911
99 Ga0068853_100030826 3300005539 Bacteria 4530
100 Ga0068853_100050671 3300005539 Bacteria 3572
101 Ga0068853_100352988 3300005539 Bacteria 1368
102 Ga0068853_102468952 3300005539 Unclassified 503
103 Ga0070672_100000417 3300005543 Bacteria 24703
104 Ga0070672_100028299 3300005543 Bacteria 4191
105 Ga0070672_100078048 3300005543 Bacteria 2649
106 Ga0070672_100215543 3300005543 Bacteria 1609
107 Ga0070686_100033105 3300005544 Bacteria 3174
108 Ga0070686_100035195 3300005544 Unclassified 3091
109 Ga0070686_100129680 3300005544 Bacteria 1742
110 Ga0070695_101503098 3300005545 Bacteria 560
111 Ga0070696_102003796 3300005546 Unclassified 503
112 Ga0070693_100050770 3300005547 Unclassified 2372
113 Ga0070693_100296368 3300005547 Bacteria 1088
114 Ga0070693_100769072 3300005547 Unclassified 711
115 Ga0070665_100040420 3300005548 Bacteria 4688
116 Ga0070665_100094799 3300005548 Bacteria 2989
117 Ga0070665_100559415 3300005548 Bacteria 1156
118 Ga0070665_100904086 3300005548 Unclassified 895
119 Ga0070704_101829035 3300005549 Bacteria 562
120 Ga0068855_100045137 3300005563 Bacteria 5212
121 Ga0068855_100388886 3300005563 Unclassified 1530
122 Ga0068855_100516681 3300005563 Bacteria 1296
123 Ga0068855_100733435 3300005563 Bacteria 1055
124 Ga0070664_100002534 3300005564 Bacteria 14738
125 Ga0070664_100004828 3300005564 Bacteria 10798
126 Ga0070664_100572022 3300005564 Bacteria 1046
127 Ga0070664_102047849 3300005564 Unclassified 543
128 Ga0068857_100025309 3300005577 Bacteria 5226
129 Ga0068857_100045907 3300005577 Bacteria 3877
130 Ga0068857_100480437 3300005577 Unclassified 1164
131 Ga0068857_100577098 3300005577 Unclassified 1061
132 Ga0068857_100920982 3300005577 Unclassified 839
133 Ga0068854_100383111 3300005578 Bacteria 1159
134 Ga0068854_101063906 3300005578 Bacteria 719
135 Ga0070702_100045848 3300005615 Bacteria 2475
136 Ga0070702_100188255 3300005615 Unclassified 1356
137 Ga0068852_100767730 3300005616 Bacteria 977
138 Ga0068852_102068280 3300005616 Bacteria 591
139 Ga0068859_100001069 3300005617 Bacteria 28045
140 Ga0068859_100017762 3300005617 Bacteria 7151
141 Ga0068859_100019906 3300005617 Bacteria 6737
142 Ga0068859_100746783 3300005617 Bacteria 1067
143 Ga0068859_101282326 3300005617 Unclassified 807
144 Ga0068864_100057759 3300005618 Bacteria 3353
145 Ga0068864_100085299 3300005618 Bacteria 2776
146 Ga0068864_100124078 3300005618 Bacteria 2312
147 Ga0068864_100129054 3300005618 Unclassified 2269
148 Ga0068864_100303462 3300005618 Bacteria 1495
149 Ga0068864_101819438 3300005618 Bacteria 614
150 Ga0068861_100007134 3300005719 Bacteria 7650
151 Ga0068861_100070359 3300005719 Bacteria 2709
152 Ga0068861_100156201 3300005719 Bacteria 1877
153 Ga0068861_100915797 3300005719 Unclassified 831
154 Ga0068861_101266871 3300005719 Unclassified 716
155 Ga0068851_10000094 3300005834 Bacteria 49249
156 Ga0068851_10566735 3300005834 Unclassified 688
157 Ga0068851_10668456 3300005834 Bacteria 637
158 Ga0068870_10001909 3300005840 Bacteria 8598
159 Ga0068870_10030617 3300005840 Bacteria 2721
160 Ga0068870_10291148 3300005840 Bacteria 1027
161 Ga0068870_10536072 3300005840 Unclassified 786
162 Ga0068863_100060334 3300005841 Bacteria 3587
163 Ga0068863_100238837 3300005841 Unclassified 1754
164 Ga0068863_100833321 3300005841 Unclassified 921
165 Ga0068863_100904443 3300005841 Bacteria 883
166 Ga0068863_101074305 3300005841 Unclassified 809
167 Ga0068863_101154522 3300005841 Bacteria 780
168 Ga0068863_101635722 3300005841 Unclassified 653
169 Ga0068858_100176239 3300005842 Bacteria 2017
170 Ga0068858_100489623 3300005842 Bacteria 1187
171 Ga0068860_100105243 3300005843 Bacteria 2694
172 Ga0068860_101467805 3300005843 Bacteria 703
173 Ga0068862_100002006 3300005844 Bacteria 18465
174 Ga0068862_100148850 3300005844 Unclassified 2083
175 Ga0068862_100176516 3300005844 Unclassified 1915
176 Ga0068862_100381543 3300005844 Bacteria 1315
177 Ga0068862_100386826 3300005844 Bacteria 1306
178 Ga0068862_101402007 3300005844 Unclassified 702
179 Ga0081539_10416501 3300005985 Unclassified 558
180 Ga0070717_11299852 3300006028 Bacteria 661
181 Ga0075432_10086814 3300006058 Bacteria 1141
182 Ga0075432_10251509 3300006058 Bacteria 717
183 Ga0070715_10595113 3300006163 Unclassified 647
184 Ga0070712_100447052 3300006175 Bacteria 1075
185 Ga0097621_100011147 3300006237 Bacteria 6614
186 Ga0097621_100339262 3300006237 Unclassified 1334
187 Ga0097621_100762240 3300006237 Bacteria 894
188 Ga0097621_102129937 3300006237 Unclassified 536
189 Ga0068871_100087640 3300006358 Bacteria 2588
190 Ga0068871_101010469 3300006358 Bacteria 775
191 Ga0068871_101072889 3300006358 Bacteria 752
192 Ga0068871_102091518 3300006358 Bacteria 539
193 Ga0075428_100089755 3300006844 Unclassified 3352
194 Ga0075428_100262240 3300006844 Bacteria 1860
195 Ga0075428_100442603 3300006844 Unclassified 1392
196 Ga0075430_100092054 3300006846 Bacteria 2535
197 Ga0075431_100044702 3300006847 Bacteria 4566
198 Ga0075431_100320705 3300006847 Bacteria 1562
199 Ga0075431_100883963 3300006847 Bacteria 864
200 Ga0075433_10002636 3300006852 Bacteria 13698
201 Ga0075433_10293162 3300006852 Bacteria 1441
202 Ga0075434_100011961 3300006871 Bacteria 8208
203 Ga0075434_100023987 3300006871 Bacteria 5956
204 Ga0075429_100056172 3300006880 Unclassified 3426
205 Ga0075429_100281510 3300006880 Bacteria 1456
206 Ga0068865_100071607 3300006881 Unclassified 2460
207 Ga0068865_100378926 3300006881 Bacteria 1153
208 Ga0068865_101040286 3300006881 Bacteria 719
209 Ga0097620_100001069 3300006931 Bacteria 28045
210 Ga0097620_100017762 3300006931 Bacteria 7151
211 Ga0097620_100019901 3300006931 Bacteria 6737
212 Ga0097620_100746757 3300006931 Bacteria 1067
213 Ga0097620_101282634 3300006931 Unclassified 807
214 Ga0075435_100017247 3300007076 Bacteria 5460
215 Ga0075435_100150102 3300007076 Unclassified 1959
216 Ga0075435_100315448 3300007076 Unclassified 1338
217 Ga0105240_10010762 3300009093 Bacteria 12829
218 Ga0105240_10202412 3300009093 Unclassified 2326
219 Ga0105240_10374907 3300009093 Bacteria 1608
220 Ga0111539_10000324 3300009094 Bacteria 58406
221 Ga0111539_10008278 3300009094 Bacteria 13237
222 Ga0111539_11640791 3300009094 Bacteria 746
223 Ga0111539_12225080 3300009094 Unclassified 636
224 Ga0111539_13007021 3300009094 Unclassified 545
225 Ga0105245_10690015 3300009098 Unclassified 1054
226 Ga0105245_12341028 3300009098 Bacteria 588
227 Ga0105247_10000817 3300009101 Bacteria 23717
228 Ga0105247_10269038 3300009101 Unclassified 1171
229 Ga0114129_10915365 3300009147 Unclassified 1110
230 Ga0105241_10023143 3300009174 Bacteria 4605
231 Ga0105241_10061340 3300009174 Bacteria 2895
232 Ga0105241_11123085 3300009174 Bacteria 741
233 Ga0105242_10033083 3300009176 Unclassified 4138
234 Ga0105242_12256106 3300009176 Bacteria 590
235 Ga0105248_10428974 3300009177 Bacteria 1489
236 Ga0105248_10505284 3300009177 Bacteria 1363
237 Ga0105248_10782371 3300009177 Unclassified 1077
238 Ga0105237_10001692 3300009545 Bacteria 28560
239 Ga0105237_11312025 3300009545 Unclassified 730
240 Ga0105238_11055398 3300009551 Bacteria 834
241 Ga0105238_11459128 3300009551 Bacteria 712
242 Ga0105249_10001361 3300009553 Bacteria 21366
243 Ga0105249_10013406 3300009553 Bacteria 7239
244 Ga0105249_11690352 3300009553 Unclassified 705
245 Ga0105239_10248834 3300010375 Bacteria 1996
246 Ga0105239_10646781 3300010375 Bacteria 1207
247 Ga0105239_11547519 3300010375 Unclassified 767
248 Ga0105239_12593291 3300010375 Unclassified 591
249 Ga0157373_10016368 3300013100 Bacteria 5411
250 Ga0157373_10514832 3300013100 Bacteria 865
251 Ga0157373_10529032 3300013100 Bacteria 853
252 Ga0157373_10804169 3300013100 Bacteria 693
253 Ga0157373_10975116 3300013100 Bacteria 632
254 Ga0157371_10053973 3300013102 Unclassified 2854
255 Ga0157371_10083630 3300013102 Bacteria 2260
256 Ga0157371_10280023 3300013102 Bacteria 1204
257 Ga0157371_10356609 3300013102 Bacteria 1065
258 Ga0157371_10570817 3300013102 Bacteria 840
259 Ga0157371_10688644 3300013102 Bacteria 765
260 Ga0157370_10287778 3300013104 Unclassified 1518
261 Ga0157370_10459352 3300013104 Bacteria 1170
262 Ga0157370_10873754 3300013104 Bacteria 816
263 Ga0157374_10392630 3300013296 Unclassified 1383
264 Ga0157374_11258166 3300013296 Bacteria 762
265 Ga0157378_10304318 3300013297 Bacteria 1544
266 Ga0157378_11098537 3300013297 Unclassified 832
267 Ga0157378_11250035 3300013297 Bacteria 783
268 Ga0157378_11505972 3300013297 Unclassified 717
269 Ga0163162_10017165 3300013306 Bacteria 7083
270 Ga0163162_10120507 3300013306 Bacteria 2727
271 Ga0163162_10149285 3300013306 Bacteria 2454
272 Ga0163162_11008523 3300013306 Unclassified 941
273 Ga0163162_12901789 3300013306 Bacteria 551
274 Ga0157372_10396112 3300013307 Bacteria 1609
275 Ga0157372_10513355 3300013307 Bacteria 1397
276 Ga0157372_10855198 3300013307 Bacteria 1056
277 Ga0157375_10196057 3300013308 Bacteria 2175
278 Ga0157375_10430306 3300013308 Unclassified 1486
279 Ga0157375_10889792 3300013308 Bacteria 1035
280 Ga0157375_12396758 3300013308 Unclassified 630
281 Ga0163163_10078374 3300014325 Unclassified 3301
282 Ga0163163_11050017 3300014325 Unclassified 878
283 Ga0163163_11195525 3300014325 Bacteria 823
284 Ga0157380_10163413 3300014326 Bacteria 1938
285 Ga0157380_10706962 3300014326 Bacteria 1013
286 Ga0157380_10723685 3300014326 Unclassified 1003
287 Ga0157380_10988280 3300014326 Bacteria 874
288 Ga0157380_12820745 3300014326 Bacteria 552
289 Ga0157377_10047918 3300014745 Bacteria 2395
290 Ga0157379_10148359 3300014968 Bacteria 2115
291 Ga0157379_10159451 3300014968 Bacteria 2036
292 Ga0157379_12077779 3300014968 Unclassified 563
293 Ga0157379_12572573 3300014968 Unclassified 509
294 Ga0157376_10015436 3300014969 Bacteria 5770
295 Ga0157376_10024192 3300014969 Bacteria 4765
296 Ga0157376_10203896 3300014969 Unclassified 1822
297 Ga0157376_11056494 3300014969 Unclassified 836
298 Ga0157376_11272482 3300014969 Bacteria 765
299 Ga0157376_12181752 3300014969 Bacteria 593
300 Ga0163161_10866605 3300017792 Bacteria 763
301 Ga0207656_10000061 3300025321 Bacteria 42734
302 Ga0207682_10207248 3300025893 Bacteria 903
303 Ga0207642_10732475 3300025899 Unclassified 625
304 Ga0207710_10001472 3300025900 Bacteria 11683
305 Ga0207647_10001496 3300025904 Bacteria 17962
306 Ga0207647_10202960 3300025904 Bacteria 1146
307 Ga0207643_10006417 3300025908 Bacteria 6297
308 Ga0207643_10643270 3300025908 Bacteria 684
309 Ga0207705_10016021 3300025909 Bacteria 5380
310 Ga0207654_10016015 3300025911 Bacteria 3898
311 Ga0207707_10005837 3300025912 Bacteria 10760
312 Ga0207707_10460689 3300025912 Bacteria 1087
313 Ga0207707_10467232 3300025912 Bacteria 1078
314 Ga0207707_11492194 3300025912 Bacteria 536
315 Ga0207695_10038113 3300025913 Bacteria 5180
316 Ga0207695_10369799 3300025913 Unclassified 1320
317 Ga0207671_10000189 3300025914 Bacteria 95291
318 Ga0207660_10038487 3300025917 Unclassified 3339
319 Ga0207660_10408056 3300025917 Bacteria 1095
320 Ga0207660_10592443 3300025917 Bacteria 903
321 Ga0207662_10028797 3300025918 Bacteria 3214
322 Ga0207662_10035871 3300025918 Bacteria 2898
323 Ga0207662_10290030 3300025918 Bacteria 1085
324 Ga0207657_10073115 3300025919 Bacteria 2899
325 Ga0207657_10111862 3300025919 Bacteria 2254
326 Ga0207649_10008443 3300025920 Bacteria 5616
327 Ga0207652_10004988 3300025921 Bacteria 10748
328 Ga0207652_10012635 3300025921 Bacteria 6826
329 Ga0207652_10028657 3300025921 Bacteria 4649
330 Ga0207652_10568696 3300025921 Bacteria 1018
331 Ga0207681_10061712 3300025923 Bacteria 2578
332 Ga0207650_10353848 3300025925 Bacteria 1209
333 Ga0207659_11530906 3300025926 Bacteria 570
334 Ga0207687_10525502 3300025927 Unclassified 990
335 Ga0207644_10502709 3300025931 Bacteria 1000
336 Ga0207690_10003236 3300025932 Bacteria 9775
337 Ga0207690_10138822 3300025932 Bacteria 1788
338 Ga0207706_10490326 3300025933 Bacteria 1061
339 Ga0207670_10000006 3300025936 Bacteria 401723
340 Ga0207670_10014706 3300025936 Bacteria 4654
341 Ga0207670_10327241 3300025936 Bacteria 1207
342 Ga0207670_10645308 3300025936 Bacteria 872
343 Ga0207691_10005431 3300025940 Bacteria 12306
344 Ga0207691_10219880 3300025940 Bacteria 1647
345 Ga0207661_10003677 3300025944 Bacteria 10693
346 Ga0207679_10003687 3300025945 Bacteria 9488
347 Ga0207667_10107946 3300025949 Unclassified 2872
348 Ga0207667_10185382 3300025949 Bacteria 2136
349 Ga0207667_10416041 3300025949 Bacteria 1368
350 Ga0207651_10235029 3300025960 Bacteria 1490
351 Ga0207651_11884825 3300025960 Bacteria 538
352 Ga0207712_10002874 3300025961 Bacteria 11008
353 Ga0207712_10298897 3300025961 Bacteria 1320
354 Ga0207712_10373673 3300025961 Unclassified 1191
355 Ga0207640_11022679 3300025981 Bacteria 728
356 Ga0207703_11681849 3300026035 Unclassified 610
357 Ga0207639_10011142 3300026041 Bacteria 6238
358 Ga0207639_10171588 3300026041 Unclassified 1837
359 Ga0207708_10121769 3300026075 Bacteria 2033
360 Ga0207702_10162915 3300026078 Bacteria 2038
361 Ga0207641_10248512 3300026088 Bacteria 1660
362 Ga0207641_10373942 3300026088 Unclassified 1363
363 Ga0207641_12274942 3300026088 Bacteria 542
364 Ga0207676_10026842 3300026095 Bacteria 4284
365 Ga0207676_10058172 3300026095 Bacteria 3048
366 Ga0207676_10071943 3300026095 Bacteria 2778
367 Ga0207676_10084041 3300026095 Bacteria 2594
368 Ga0207674_10004912 3300026116 Bacteria 15987
369 Ga0207674_10379192 3300026116 Unclassified 1367
370 Ga0207674_10490974 3300026116 Bacteria 1187
371 Ga0207674_10581797 3300026116 Bacteria 1082
372 Ga0207675_100440502 3300026118 Unclassified 1290
373 Ga0207675_100444304 3300026118 Bacteria 1284
374 Ga0207683_10007854 3300026121 Bacteria 9131
375 Ga0207683_10240170 3300026121 Bacteria 1652
376 Ga0207698_10158745 3300026142 Bacteria 1974
377 Ga0207428_10557720 3300027907 Bacteria 828
378 Ga0268266_10004556 3300028379 Bacteria 13240
379 Ga0268265_10333504 3300028380 Bacteria 1378
380 Ga0268264_10056680 3300028381 Bacteria 3276
381 Ga0268264_12578064 3300028381 Bacteria 513
382 Ga0265318_10196527 3300028577 Bacteria 737
383 Ga0265318_10305677 3300028577 Unclassified 580
384 Ga0265336_10046876 3300028666 Bacteria 1312
385 Ga0265340_10019646 3300031247 Bacteria 3478
386 Ga0265340_10084187 3300031247 Bacteria 1494
387 Ga0307508_10003970 3300031616 Bacteria 14667
388 Ga0307516_10005675 3300031730 Bacteria 14812
389 Ga0373935_0807036 3300035692 Unclassified 693
390 Ga0373927_1129039 3300035695 Unclassified 517
391 Ga0373937_0214887 3300036401 Bacteria 1810
392 Ga0373937_0759021 3300036401 Bacteria 917
393 Ga0395905_0634560 3300037471 Bacteria 970
394 Ga0436365_1045331 3300039437 Bacteria 728
395 Ga0451800_1048949 3300041459 Bacteria 626
396 Ga0451807_1291138 3300041486 Bacteria 743
397 Ga0451847_0520967 3300041503 Unclassified 511
398 Ga0439432_092793 3300042006 Bacteria 908
399 Ga0439446_0109308 3300042156 Bacteria 881
400 Ga0451577_0831252 3300042876 Bacteria 833
401 Ga0453683_0176301 3300044673 Bacteria 1355
402 Ga0453683_0315313 3300044673 Bacteria 1001
403 Ga0453683_0753029 3300044673 Unclassified 640
404 Ga0453683_0766566 3300044673 Bacteria 634
405 Ga0453684_0001013 3300044712 Bacteria 90676
406 Ga0453684_0014305 3300044712 Bacteria 12716
407 Ga0453684_0056738 3300044712 Bacteria 5077
408 Ga0453684_0238607 3300044712 Bacteria 2094
409 Ga0453684_0466998 3300044712 Bacteria 1402
410 Ga0453684_1352186 3300044712 Unclassified 741
411 Ga0451576_0006967 3300045051 Bacteria 13681
412 Ga0451576_0818040 3300045051 Bacteria 978
413 Ga0495651_1022934 3300046462 Bacteria 500
414 Ga0495665_0450180 3300046531 Unclassified 651
415 Ga0495621_0154389 3300046539 Bacteria 905
416 Ga0495633_0480913 3300046558 Bacteria 560
417 Ga0495658_0162947 3300046683 Bacteria 1376
418 Ga0495600_0121870 3300046809 Bacteria 1696
419 Ga0495600_0470142 3300046809 Bacteria 776
420 Ga0496104_1468226 3300048907 Unclassified 585
421 Ga0501257_058575 3300049686 Bacteria 970
422 nmdc:mga09592_97912_c1 3300050508 Bacteria 2511
423 nmdc:mga0qj67_29494_c1 3300050509 Bacteria 4262
424 nmdc:mga06r32_513161_c1 3300050510 Unclassified 1175
425 nmdc:mga06r32_56273_c1 3300050510 Bacteria 3775
426 nmdc:mga08y16_1725677_c1 3300050511 Unclassified 581
427 nmdc:mga08y16_31904_c1 3300050511 Bacteria 5539
428 nmdc:mga08y16_455930_c1 3300050511 Bacteria 1303
429 nmdc:mga0n895_489670_c1 3300050512 Bacteria 1240
430 nmdc:mga0rr50_247854_c1 3300050513 Bacteria 1478
431 nmdc:mga0rr50_404974_c1 3300050513 Bacteria 1153
432 nmdc:mga0a205_278955_c1 3300050515 Bacteria 1547
433 Ga0495619_0552572 3300053085 Unclassified 790
434 Ga0500647_0140793 3300053091 Unclassified 1132
435 Ga0500647_0347333 3300053091 Bacteria 619
436 Ga0500616_0129808 3300053153 Bacteria 1192
437 Ga0500584_218376 3300053726 Bacteria 612
438 Ga0373956_0498789
439 JGI24745J21846_1021941
440 JGI24749J21850_1029805
441 JGI24035J26624_1005381
442 JGI24034J26672_10022665
443 rootL2_10058436
444 rootL2_10123446
445 rootL2_10205095
446 Ga0065704_10361848
447 Ga0065704_10386029
448 Ga0065712_10033764
449 Ga0065715_10138091
450 Ga0070676_10044778
451 Ga0070690_100184096
452 Ga0070690_100192667
453 Ga0070690_100605603
454 Ga0070690_100649878
455 Ga0070670_100248302
456 Ga0070670_100391093
457 Ga0070670_100517136
458 Ga0070677_10004849
459 Ga0068869_100027600
460 Ga0068869_100135567
461 Ga0068869_100356992
462 Ga0070666_10003383
463 Ga0070666_10655910
464 Ga0070680_100004942
465 Ga0070680_100417330
466 Ga0070680_100703642
467 Ga0070680_100966926
468 Ga0070682_100111476
469 Ga0068868_100016751
470 Ga0070660_100063058
471 Ga0070660_100101410
472 Ga0070689_100000003
473 Ga0070689_100017121
474 Ga0070689_100024327
475 Ga0070689_100154849
476 Ga0070689_100828013
477 Ga0070691_10027006
478 Ga0070691_10670539
479 Ga0070691_10771685
480 Ga0070687_100004378
481 Ga0070687_101048514
482 Ga0070661_100001575
483 Ga0070661_100022699
484 Ga0070661_100098632
485 Ga0070692_10470872
486 Ga0070668_100066594
487 Ga0070669_100010179
488 Ga0070669_100029389
489 Ga0070675_100097313
490 Ga0070675_100277364
491 Ga0070671_100046178
492 Ga0070671_100790619
493 Ga0070674_100250887
494 Ga0070673_100058396
495 Ga0070673_100131086
496 Ga0070673_100496331
497 Ga0070688_100023697
498 Ga0070688_100133407
499 Ga0070688_100178139
500 Ga0070659_100024655
501 Ga0070659_100475090
502 Ga0070659_100627684
503 Ga0070659_100631401
504 Ga0070667_100010851
505 Ga0070703_10055437
506 Ga0070701_10015084
507 Ga0070711_100275806
508 Ga0070705_100117928
509 Ga0070705_101653382
510 Ga0070700_100021790
511 Ga0070663_100075596
512 Ga0070663_100327721
513 Ga0070663_101868631
514 Ga0070678_100025849
515 Ga0070678_100232158
516 Ga0070678_100326119
517 Ga0070662_100004495
518 Ga0070662_100456409
519 Ga0070681_10028568
520 Ga0070681_10043871
521 Ga0070681_10568262
522 Ga0070681_11678905
523 Ga0070681_12023501
524 Ga0068867_100019647
525 Ga0070685_10021898
526 Ga0070685_10106027
527 Ga0070685_10818456
528 Ga0070699_100381649
529 Ga0070679_100007239
530 Ga0070679_100008311
531 Ga0070679_100526113
532 Ga0070679_100557093
533 Ga0070684_100009579
534 Ga0070684_100541063
535 Ga0070684_100750698
536 Ga0068853_100030826
537 Ga0068853_100050671
538 Ga0068853_100352988
539 Ga0068853_102468952
540 Ga0070672_100000417
541 Ga0070672_100028299
542 Ga0070672_100078048
543 Ga0070672_100215543
544 Ga0070686_100033105
545 Ga0070686_100035195
546 Ga0070686_100129680
547 Ga0070695_101503098
548 Ga0070696_102003796
549 Ga0070693_100050770
550 Ga0070693_100296368
551 Ga0070693_100769072
552 Ga0070665_100040420
553 Ga0070665_100094799
554 Ga0070665_100559415
555 Ga0070665_100904086
556 Ga0070704_101829035
557 Ga0068855_100045137
558 Ga0068855_100388886
559 Ga0068855_100516681
560 Ga0068855_100733435
561 Ga0070664_100002534
562 Ga0070664_100004828
563 Ga0070664_100572022
564 Ga0070664_102047849
565 Ga0068857_100025309
566 Ga0068857_100045907
567 Ga0068857_100480437
568 Ga0068857_100577098
569 Ga0068857_100920982
570 Ga0068854_100383111
571 Ga0068854_101063906
572 Ga0070702_100045848
573 Ga0070702_100188255
574 Ga0068852_100767730
575 Ga0068852_102068280
576 Ga0068859_100001069
577 Ga0068859_100017762
578 Ga0068859_100019906
579 Ga0068859_100746783
580 Ga0068859_101282326
581 Ga0068864_100057759
582 Ga0068864_100085299
583 Ga0068864_100124078
584 Ga0068864_100129054
585 Ga0068864_100303462
586 Ga0068864_101819438
587 Ga0068861_100007134
588 Ga0068861_100070359
589 Ga0068861_100156201
590 Ga0068861_100915797
591 Ga0068861_101266871
592 Ga0068851_10000094
593 Ga0068851_10566735
594 Ga0068851_10668456
595 Ga0068870_10001909
596 Ga0068870_10030617
597 Ga0068870_10291148
598 Ga0068870_10536072
599 Ga0068863_100060334
600 Ga0068863_100238837
601 Ga0068863_100833321
602 Ga0068863_100904443
603 Ga0068863_101074305
604 Ga0068863_101154522
605 Ga0068863_101635722
606 Ga0068858_100176239
607 Ga0068858_100489623
608 Ga0068860_100105243
609 Ga0068860_101467805
610 Ga0068862_100002006
611 Ga0068862_100148850
612 Ga0068862_100176516
613 Ga0068862_100381543
614 Ga0068862_100386826
615 Ga0068862_101402007
616 Ga0081539_10416501
617 Ga0070717_11299852
618 Ga0075432_10086814
619 Ga0075432_10251509
620 Ga0070715_10595113
621 Ga0070712_100447052
622 Ga0097621_100011147
623 Ga0097621_100339262
624 Ga0097621_100762240
625 Ga0097621_102129937
626 Ga0068871_100087640
627 Ga0068871_101010469
628 Ga0068871_101072889
629 Ga0068871_102091518
630 Ga0075428_100089755
631 Ga0075428_100262240
632 Ga0075428_100442603
633 Ga0075430_100092054
634 Ga0075431_100044702
635 Ga0075431_100320705
636 Ga0075431_100883963
637 Ga0075433_10002636
638 Ga0075433_10293162
639 Ga0075434_100011961
640 Ga0075434_100023987
641 Ga0075429_100056172
642 Ga0075429_100281510
643 Ga0068865_100071607
644 Ga0068865_100378926
645 Ga0068865_101040286
646 Ga0097620_100001069
647 Ga0097620_100017762
648 Ga0097620_100019901
649 Ga0097620_100746757
650 Ga0097620_101282634
651 Ga0075435_100017247
652 Ga0075435_100150102
653 Ga0075435_100315448
654 Ga0105240_10010762
655 Ga0105240_10202412
656 Ga0105240_10374907
657 Ga0111539_10000324
658 Ga0111539_10008278
659 Ga0111539_11640791
660 Ga0111539_12225080
661 Ga0111539_13007021
662 Ga0105245_10690015
663 Ga0105245_12341028
664 Ga0105247_10000817
665 Ga0105247_10269038
666 Ga0114129_10915365
667 Ga0105241_10023143
668 Ga0105241_10061340
669 Ga0105241_11123085
670 Ga0105242_10033083
671 Ga0105242_12256106
672 Ga0105248_10428974
673 Ga0105248_10505284
674 Ga0105248_10782371
675 Ga0105237_10001692
676 Ga0105237_11312025
677 Ga0105238_11055398
678 Ga0105238_11459128
679 Ga0105249_10001361
680 Ga0105249_10013406
681 Ga0105249_11690352
682 Ga0105239_10248834
683 Ga0105239_10646781
684 Ga0105239_11547519
685 Ga0105239_12593291
686 Ga0157373_10016368
687 Ga0157373_10514832
688 Ga0157373_10529032
689 Ga0157373_10804169
690 Ga0157373_10975116
691 Ga0157371_10053973
692 Ga0157371_10083630
693 Ga0157371_10280023
694 Ga0157371_10356609
695 Ga0157371_10570817
696 Ga0157371_10688644
697 Ga0157370_10287778
698 Ga0157370_10459352
699 Ga0157370_10873754
700 Ga0157374_10392630
701 Ga0157374_11258166
702 Ga0157378_10304318
703 Ga0157378_11098537
704 Ga0157378_11250035
705 Ga0157378_11505972
706 Ga0163162_10017165
707 Ga0163162_10120507
708 Ga0163162_10149285
709 Ga0163162_11008523
710 Ga0163162_12901789
711 Ga0157372_10396112
712 Ga0157372_10513355
713 Ga0157372_10855198
714 Ga0157375_10196057
715 Ga0157375_10430306
716 Ga0157375_10889792
717 Ga0157375_12396758
718 Ga0163163_10078374
719 Ga0163163_11050017
720 Ga0163163_11195525
721 Ga0157380_10163413
722 Ga0157380_10706962
723 Ga0157380_10723685
724 Ga0157380_10988280
725 Ga0157380_12820745
726 Ga0157377_10047918
727 Ga0157379_10148359
728 Ga0157379_10159451
729 Ga0157379_12077779
730 Ga0157379_12572573
731 Ga0157376_10015436
732 Ga0157376_10024192
733 Ga0157376_10203896
734 Ga0157376_11056494
735 Ga0157376_11272482
736 Ga0157376_12181752
737 Ga0163161_10866605
738 Ga0207656_10000061
739 Ga0207682_10207248
740 Ga0207642_10732475
741 Ga0207710_10001472
742 Ga0207647_10001496
743 Ga0207647_10202960
744 Ga0207643_10006417
745 Ga0207643_10643270
746 Ga0207705_10016021
747 Ga0207654_10016015
748 Ga0207707_10005837
749 Ga0207707_10460689
750 Ga0207707_10467232
751 Ga0207707_11492194
752 Ga0207695_10038113
753 Ga0207695_10369799
754 Ga0207671_10000189
755 Ga0207660_10038487
756 Ga0207660_10408056
757 Ga0207660_10592443
758 Ga0207662_10028797
759 Ga0207662_10035871
760 Ga0207662_10290030
761 Ga0207657_10073115
762 Ga0207657_10111862
763 Ga0207649_10008443
764 Ga0207652_10004988
765 Ga0207652_10012635
766 Ga0207652_10028657
767 Ga0207652_10568696
768 Ga0207681_10061712
769 Ga0207650_10353848
770 Ga0207659_11530906
771 Ga0207687_10525502
772 Ga0207644_10502709
773 Ga0207690_10003236
774 Ga0207690_10138822
775 Ga0207706_10490326
776 Ga0207670_10000006
777 Ga0207670_10014706
778 Ga0207670_10327241
779 Ga0207670_10645308
780 Ga0207691_10005431
781 Ga0207691_10219880
782 Ga0207661_10003677
783 Ga0207679_10003687
784 Ga0207667_10107946
785 Ga0207667_10185382
786 Ga0207667_10416041
787 Ga0207651_10235029
788 Ga0207651_11884825
789 Ga0207712_10002874
790 Ga0207712_10298897
791 Ga0207712_10373673
792 Ga0207640_11022679
793 Ga0207703_11681849
794 Ga0207639_10011142
795 Ga0207639_10171588
796 Ga0207708_10121769
797 Ga0207702_10162915
798 Ga0207641_10248512
799 Ga0207641_10373942
800 Ga0207641_12274942
801 Ga0207676_10026842
802 Ga0207676_10058172
803 Ga0207676_10071943
804 Ga0207676_10084041
805 Ga0207674_10004912
806 Ga0207674_10379192
807 Ga0207674_10490974
808 Ga0207674_10581797
809 Ga0207675_100440502
810 Ga0207675_100444304
811 Ga0207683_10007854
812 Ga0207683_10240170
813 Ga0207698_10158745
814 Ga0207428_10557720
815 Ga0268266_10004556
816 Ga0268265_10333504
817 Ga0268264_10056680
818 Ga0268264_12578064
819 Ga0265318_10196527
820 Ga0265318_10305677
821 Ga0265336_10046876
822 Ga0265340_10019646
823 Ga0265340_10084187
824 Ga0307508_10003970
825 Ga0307516_10005675
826 Ga0373935_0807036
827 Ga0373927_1129039
828 Ga0373937_0214887
829 Ga0373937_0759021
830 Ga0395905_0634560
831 Ga0436365_1045331
832 Ga0451800_1048949
833 Ga0451807_1291138
834 Ga0451847_0520967
835 Ga0439432_092793
836 Ga0439446_0109308
837 Ga0451577_0831252
838 Ga0453683_0176301
839 Ga0453683_0315313
840 Ga0453683_0753029
841 Ga0453683_0766566
842 Ga0453684_0001013
843 Ga0453684_0014305
844 Ga0453684_0056738
845 Ga0453684_0238607
846 Ga0453684_0466998
847 Ga0453684_1352186
848 Ga0451576_0006967
849 Ga0451576_0818040
850 Ga0495651_1022934
851 Ga0495665_0450180
852 Ga0495621_0154389
853 Ga0495633_0480913
854 Ga0495658_0162947
855 Ga0495600_0121870
856 Ga0495600_0470142
857 Ga0496104_1468226
858 Ga0501257_058575
859 nmdc:mga09592_97912_c1
860 nmdc:mga0qj67_29494_c1
861 nmdc:mga06r32_513161_c1
862 nmdc:mga06r32_56273_c1
863 nmdc:mga08y16_1725677_c1
864 nmdc:mga08y16_31904_c1
865 nmdc:mga08y16_455930_c1
866 nmdc:mga0n895_489670_c1
867 nmdc:mga0rr50_247854_c1
868 nmdc:mga0rr50_404974_c1
869 nmdc:mga0a205_278955_c1
870 Ga0495619_0552572
871 Ga0500647_0140793
872 Ga0500647_0347333
873 Ga0500616_0129808
874 Ga0500584_218376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03795

YCII

YCII-related domain

16

98

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.8401 1 84
1mwq-assembly1.cif.gz_A structure of hi0828, a hypothetical protein from haemophilus influenzae with a putative active-site phosphohistidine 0.8056 1 84
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.7967 1 85
4lbp-assembly1.cif.gz_A 5-chloro-2-hydroxyhydroquinone dehydrochlorinase (tftg) from burkholderia phenoliruptrix ac1100: complex with 2,5-dihydroxybenzoquinone 0.7724 1 85
3zo7-assembly1.cif.gz_E crystal structure of clcfe27a with substrate 0.7454 1 83
ID Description Score Start End Superfamily
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.8264 1 84 3.30.70.1060
af_P0AB55_1_98_3.30.70.1060 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7926 1 84 3.30.70.1060
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7737 3 84 3.30.70.1060
af_Q6ZSC3_96_357_3.30.2130.10 Alpha Beta;2-Layer Sandwich;VC0802-like;VC0802-like 0.7328 2 70 3.30.2130.10
4lbiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Dimeric alpha+beta barrel 0.7279 3 84 3.30.70.1060
ID Description Score Start End GO Terms
AF-A0A3D0W9F2-F1-model_v4 YCII-related domain-containing protein 0.9498 2 81
AF-A0A2L0F5R9-F1-model_v4 YCII-related domain-containing protein 0.9495 2 84
AF-A0A177LJT1-F1-model_v4 YCII-related domain-containing protein 0.9468 1 84
AF-A0A6S9EHW5-F1-model_v4 YCII-related domain-containing protein 0.9465 2 81
AF-A0A402ARI9-F1-model_v4 YCII-related domain-containing protein 0.945 1 87

Map