metagRoot

F443753

General Info

Members	Datasets	Scaffolds	Average Seq Length
437	264	423	310

Family's Representative Sequence

Representative Sequence	3300009098\|Ga0105245_10102816\|Ga0105245_101028164
Length	328
Sequence	MLEPDGHRLGLRDPMTLIALTGATGFIGRQLLAELPKRGYRIRVLLRRPAQVPLDCDSAVIGDLTRPQNLSAAFRDAAAVVHSAGLAPGMSGMPADDYRTINAEATGALARAAERAGVRRFVFMSSIRAQCGPSAFGTVTEDLPARPTDAYGLSKLGGEHELAALMTMDWVALRPVLVYGRGAAGNMAALVGAARSRVPLPVSALSARRSLLALDNLVDAVTHVLAASQSFRQPFIVADAQALTVAEMIAALRAGLGRGAGVFPMPESLLRFALQYTGRDAWIERLCQPLVASSAALQSLGWTPRVTTVAGLAALTREGTGATTGRPA

Samples

	Sample ID	Description	Type	Environment
1	2508501050	Microvirga lupini Lut6	Isolate	Nodule
2	2643221734	Bosea sp. Root670	Isolate	Unclassified
3	2738541281	Methylobacterium sp. GV094	Isolate	Unclassified
4	2738543032	Methylobacterium sp. GV104	Isolate	Unclassified
5	2773857925	Microvirga vignae BR3299	Isolate	Unclassified
6	2775506901	Microvirga ossetica V5/3m	Isolate	Unclassified
7	2835312727	Microvirga calopogonii CCBAU 65841	Isolate	Nodule
8	2842698319	Methylobacterium sp. R-72139	Isolate	Unclassified
9	2882456835	Microvirga sp. KLBC 81	Isolate	Unclassified
10	2884298095	Microvirga thermotolerans HR1	Isolate	Rhizosphere
11	2894232714	Microvirga tunisiensis Lmie10	Isolate	Nodule
12	3003665799	Methylobacterium aquaticum BG2	Isolate	Unclassified
13	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
14	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
15	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
16	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
17	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
18	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
19	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
20	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
21	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
22	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
23	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
24	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
25	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
26	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
27	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
28	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
29	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
30	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
31	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
32	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
33	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
34	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
35	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
36	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
37	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
38	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
39	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
40	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
41	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
42	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
43	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
44	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
45	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
46	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
47	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
48	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
49	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
50	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
51	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
52	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
53	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
54	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
55	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
56	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
57	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
58	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
59	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
60	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
61	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
62	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
63	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
64	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
66	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
67	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
69	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
70	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
71	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
72	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
73	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
74	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
75	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
76	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
77	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
78	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
79	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
80	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
81	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
82	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
83	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
84	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
85	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
86	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
87	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
88	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
89	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
90	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
91	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
92	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
120	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
121	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
122	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
123	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
124	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
125	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
126	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
127	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
128	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
129	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
130	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
131	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
132	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
133	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
134	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
135	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
136	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
137	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
138	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
139	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
140	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
141	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
142	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
143	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
144	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
145	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
146	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
147	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
148	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
149	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
150	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
151	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
152	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
153	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
154	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
155	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
156	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
157	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
158	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
159	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
160	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
161	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
162	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
163	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
164	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
165	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
166	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
167	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
168	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
169	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
170	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
171	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
172	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
173	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
174	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
175	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
176	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
177	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
178	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
179	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
180	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
181	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
182	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
183	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
184	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
185	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
186	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
187	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
188	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
189	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
190	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
191	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
192	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
193	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
194	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
195	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
196	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
197	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
198	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
199	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
200	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
201	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
202	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
203	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
204	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
205	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
206	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
207	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
208	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
209	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
210	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
211	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
212	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
213	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
214	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
215	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
216	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
217	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
218	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
219	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
220	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
221	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
223	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
224	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
225	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
226	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
227	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
228	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
229	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
230	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
231	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
232	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
233	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
234	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
235	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
236	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
237	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
238	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
239	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
240	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
241	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
242	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
243	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
244	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
245	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
246	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
247	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
248	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
249	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
250	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
251	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
252	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
253	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
254	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
255	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
256	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
257	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
258	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
259	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
260	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
261	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
262	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
263	641522639	Methylobacterium sp. 4-46	Isolate	Nodule
264	643348564	Methylobacterium nodulans ORS 2060	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	96.57
Metatranscriptomes	0.23
Isolates	3.2

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	1.6
Nodule	1.14
Rhizoplane	13.96
Rhizosphere	81.01
Stem	0
Stem Tuber	0
Unclassified	2.29

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	rootH1_10106330	3300003323	Bacteria	1981
2	Ga0070670_100058543	3300005331	Bacteria	3307
3	Ga0068869_100033528	3300005334	Bacteria	3625
4	Ga0070666_10034663	3300005335	Bacteria	3345
5	Ga0068868_100022983	3300005338	Bacteria	4714
6	Ga0068868_100164585	3300005338	Bacteria	1834
7	Ga0070661_100030673	3300005344	Bacteria	3884
8	Ga0070668_100078924	3300005347	Bacteria	2576
9	Ga0070669_100112616	3300005353	Bacteria	2066
10	Ga0070667_100013697	3300005367	Bacteria	6701
11	Ga0070709_10074621	3300005434	Bacteria	2198
12	Ga0070714_100009251	3300005435	Bacteria	7741
13	Ga0070713_100011742	3300005436	Bacteria	6395
14	Ga0070713_100168787	3300005436	Bacteria	1959
15	Ga0070710_10014757	3300005437	Bacteria	3937
16	Ga0070710_10184096	3300005437	Bacteria	1310
17	Ga0070701_10022673	3300005438	Bacteria	3012
18	Ga0070711_100034819	3300005439	Bacteria	3362
19	Ga0070662_100007330	3300005457	Bacteria	7145
20	Ga0068867_100091166	3300005459	Bacteria	2313
21	Ga0070706_100465773	3300005467	Unclassified	1176
22	Ga0070698_100146753	3300005471	Bacteria	2308
23	Ga0068853_100065423	3300005539	Bacteria	3155
24	Ga0070672_100410393	3300005543	Bacteria	1162
25	Ga0070686_100008180	3300005544	Bacteria	5852
26	Ga0070695_100005074	3300005545	Bacteria	7755
27	Ga0070696_100133210	3300005546	Bacteria	1810
28	Ga0070664_100058372	3300005564	Bacteria	3282
29	Ga0070702_100179144	3300005615	Bacteria	1385
30	Ga0068852_100220189	3300005616	Bacteria	1805
31	Ga0068859_100014661	3300005617	Bacteria	7877
32	Ga0068866_10002755	3300005718	Bacteria	7252
33	Ga0068861_100031239	3300005719	Bacteria	3910
34	Ga0068861_100098047	3300005719	Bacteria	2326
35	Ga0068863_100169827	3300005841	Bacteria	2091
36	Ga0081455_10005582	3300005937	Bacteria	13760
37	Ga0081538_10025304	3300005981	Bacteria	4190
38	Ga0081540_1000032	3300005983	Bacteria	144522
39	Ga0081539_10019998	3300005985	Bacteria	4553
40	Ga0070717_10147962	3300006028	Bacteria	2030
41	Ga0070717_10463812	3300006028	Bacteria	1143
42	Ga0075365_10079656	3300006038	Bacteria	2216
43	Ga0075365_10131705	3300006038	Bacteria	1731
44	Ga0075363_100017020	3300006048	Bacteria	3599
45	Ga0070715_10000896	3300006163	Bacteria	8266
46	Ga0070716_100007056	3300006173	Bacteria	5514
47	Ga0070712_100000165	3300006175	Bacteria	35992
48	Ga0070712_100038299	3300006175	Bacteria	3276
49	Ga0070712_100226770	3300006175	Unclassified	1482
50	Ga0068871_100095330	3300006358	Unclassified	2485
51	Ga0075428_100157800	3300006844	Bacteria	2463
52	Ga0075428_100526427	3300006844	Bacteria	1264
53	Ga0075430_100000821	3300006846	Bacteria	24241
54	Ga0075430_100026606	3300006846	Bacteria	4919
55	Ga0075431_100036436	3300006847	Bacteria	5067
56	Ga0075431_100075329	3300006847	Bacteria	3482
57	Ga0075431_100211345	3300006847	Bacteria	1982
58	Ga0075434_100013846	3300006871	Bacteria	7693
59	Ga0075434_100016976	3300006871	Bacteria	7003
60	Ga0075434_100113923	3300006871	Bacteria	2717
61	Ga0075429_100035014	3300006880	Bacteria	4364
62	Ga0075429_100150599	3300006880	Bacteria	2037
63	Ga0075429_100401069	3300006880	Bacteria	1201
64	Ga0075436_100069091	3300006914	Bacteria	2441
65	Ga0097620_100014660	3300006931	Bacteria	7877
66	Ga0075435_100065785	3300007076	Bacteria	2947
67	Ga0075435_100141042	3300007076	Bacteria	2022
68	Ga0075435_100186404	3300007076	Bacteria	1755
69	Ga0075435_100264251	3300007076	Bacteria	1467
70	Ga0099794_10090216	3300007265	Bacteria	1520
71	Ga0111539_10131964	3300009094	Bacteria	2925
72	Ga0111539_10179891	3300009094	Bacteria	2470
73	Ga0111539_10194521	3300009094	Bacteria	2366
74	Ga0111539_10204364	3300009094	Bacteria	2303
75	Ga0105245_10102816	3300009098	Bacteria	2646
76	Ga0105245_10214169	3300009098	Bacteria	1855
77	Ga0105247_10006172	3300009101	Bacteria	7437
78	Ga0114129_10011285	3300009147	Bacteria	12732
79	Ga0114129_10038749	3300009147	Bacteria	6719
80	Ga0114129_10071187	3300009147	Bacteria	4849
81	Ga0114129_10479030	3300009147	Bacteria	1629
82	Ga0105243_10056774	3300009148	Bacteria	3115
83	Ga0105242_10072007	3300009176	Bacteria	2870
84	Ga0105248_10020474	3300009177	Bacteria	7330
85	Ga0105248_10050919	3300009177	Bacteria	4647
86	Ga0105237_10035802	3300009545	Bacteria	5021
87	Ga0105249_10018832	3300009553	Bacteria	6153
88	Ga0105239_10164771	3300010375	Bacteria	2478
89	Ga0157374_10002466	3300013296	Bacteria	15626
90	Ga0157374_10273954	3300013296	Bacteria	1665
91	Ga0163163_10053005	3300014325	Bacteria	4003
92	Ga0163163_10213910	3300014325	Bacteria	1976
93	Ga0157380_10224478	3300014326	Bacteria	1683
94	Ga0157379_10043843	3300014968	Bacteria	3994
95	Ga0157379_10457580	3300014968	Unclassified	1179
96	Ga0163161_10033692	3300017792	Bacteria	3660
97	Ga0224572_1011707	3300024225	Unclassified	1660
98	Ga0207692_10008624	3300025898	Bacteria	4227
99	Ga0207692_10157652	3300025898	Bacteria	1305
100	Ga0207710_10017012	3300025900	Bacteria	3081
101	Ga0207688_10000117	3300025901	Bacteria	32379
102	Ga0207688_10024528	3300025901	Bacteria	3308
103	Ga0207680_10112027	3300025903	Bacteria	1771
104	Ga0207647_10015624	3300025904	Bacteria	5197
105	Ga0207699_10007287	3300025906	Bacteria	5404
106	Ga0207643_10000291	3300025908	Bacteria	34985
107	Ga0207684_10398025	3300025910	Bacteria	1184
108	Ga0207693_10006232	3300025915	Bacteria	9894
109	Ga0207693_10006770	3300025915	Bacteria	9462
110	Ga0207693_10207868	3300025915	Unclassified	1539
111	Ga0207693_10279578	3300025915	Unclassified	1308
112	Ga0207693_10285589	3300025915	Bacteria	1293
113	Ga0207663_10019637	3300025916	Bacteria	3812
114	Ga0207662_10004840	3300025918	Bacteria	7122
115	Ga0207657_10037546	3300025919	Bacteria	4324
116	Ga0207652_10206391	3300025921	Bacteria	1769
117	Ga0207650_10007981	3300025925	Bacteria	7216
118	Ga0207650_10037956	3300025925	Bacteria	3513
119	Ga0207687_10205609	3300025927	Bacteria	1542
120	Ga0207700_10000458	3300025928	Bacteria	23936
121	Ga0207664_10031202	3300025929	Bacteria	4076
122	Ga0207644_10032511	3300025931	Bacteria	3640
123	Ga0207706_10373489	3300025933	Bacteria	1238
124	Ga0207670_10031516	3300025936	Bacteria	3399
125	Ga0207669_10014161	3300025937	Bacteria	3990
126	Ga0207665_10006165	3300025939	Bacteria	7962
127	Ga0207665_10024600	3300025939	Bacteria	3972
128	Ga0207691_10012255	3300025940	Bacteria	8219
129	Ga0207711_10039010	3300025941	Bacteria	4039
130	Ga0207689_10002877	3300025942	Bacteria	15867
131	Ga0207661_10099866	3300025944	Bacteria	2435
132	Ga0207679_10076308	3300025945	Bacteria	2546
133	Ga0207651_10018905	3300025960	Bacteria	4115
134	Ga0207668_10005839	3300025972	Bacteria	7248
135	Ga0207668_10138395	3300025972	Bacteria	1869
136	Ga0207668_10280253	3300025972	Bacteria	1367
137	Ga0207677_10061643	3300026023	Bacteria	2598
138	Ga0207703_10061763	3300026035	Bacteria	3068
139	Ga0207708_10001828	3300026075	Bacteria	15698
140	Ga0207708_10183747	3300026075	Unclassified	1661
141	Ga0207641_10020581	3300026088	Bacteria	5420
142	Ga0207648_10145861	3300026089	Bacteria	2087
143	Ga0207648_10156136	3300026089	Bacteria	2014
144	Ga0207676_10375581	3300026095	Bacteria	1322
145	Ga0207683_10036001	3300026121	Bacteria	4307
146	Ga0268266_10030720	3300028379	Bacteria	4563
147	Ga0268265_10031473	3300028380	Bacteria	3831
148	Ga0268264_10078844	3300028381	Bacteria	2809
149	Ga0265760_10036223	3300031090	Bacteria	1463
150	Ga0316575_10003861	3300031665	Bacteria	5230
151	Ga0316579_10016074	3300031691	Bacteria	3261
152	Ga0316576_10115359	3300031727	Bacteria	2015
153	Ga0316576_10130885	3300031727	Bacteria	1887
154	Ga0316578_10022830	3300031728	Bacteria	3494
155	Ga0316578_10083458	3300031728	Bacteria	1903
156	Ga0316577_10095340	3300031733	Bacteria	1666
157	Ga0316577_10172540	3300031733	Bacteria	1220
158	Ga0307410_10205439	3300031852	Bacteria	1506
159	Ga0307409_100457600	3300031995	Bacteria	1233
160	Ga0316585_10044677	3300032137	Bacteria	1416
161	Ga0316580_10014519	3300032139	Bacteria	2405
162	Ga0373952_0033036	3300035092	Bacteria	1159
163	Ga0373946_0006727	3300035171	Bacteria	4178
164	Ga0373946_0077756	3300035171	Bacteria	1447
165	Ga0373955_0007178	3300035172	Bacteria	5108
166	Ga0316574_0096072	3300035398	Bacteria	1893
167	Ga0373924_0006143	3300035410	Bacteria	4290
168	Ga0373931_0185692	3300035691	Bacteria	1234
169	Ga0373935_0000454	3300035692	Bacteria	21220
170	Ga0373935_0157404	3300035692	Bacteria	1546
171	Ga0373935_0218724	3300035692	Bacteria	1322
172	Ga0373927_0013081	3300035695	Bacteria	5520
173	Ga0373927_0085781	3300035695	Bacteria	2044
174	Ga0373927_0205640	3300035695	Bacteria	1293
175	Ga0373927_0299979	3300035695	Bacteria	1057
176	Ga0373933_0002060	3300035724	Bacteria	11550
177	Ga0373947_0008199	3300035725	Bacteria	6025
178	Ga0373947_0145167	3300035725	Unclassified	1525
179	Ga0373947_0230401	3300035725	Bacteria	1220
180	Ga0373937_0000089	3300036401	Bacteria	84564
181	Ga0373937_0123732	3300036401	Bacteria	2412
182	Ga0316582_0141959	3300036647	Bacteria	1619
183	Ga0316584_0015212	3300036712	Bacteria	5498
184	Ga0316584_0113076	3300036712	Bacteria	2031
185	Ga0373925_0000016	3300037068	Bacteria	176830
186	Ga0395899_0003124	3300037312	Bacteria	13190
187	Ga0395900_0001182	3300037418	Bacteria	32449
188	Ga0395900_0072980	3300037418	Bacteria	3528
189	Ga0395900_0081703	3300037418	Bacteria	3320
190	Ga0395900_0314121	3300037418	Bacteria	1549
191	Ga0395898_0016185	3300037466	Bacteria	7638
192	Ga0395898_0128715	3300037466	Bacteria	2425
193	Ga0395898_0131992	3300037466	Bacteria	2392
194	Ga0395905_0010942	3300037471	Bacteria	8781
195	Ga0395905_0257108	3300037471	Bacteria	1631
196	Ga0436364_0574792	3300037853	Bacteria	3067
197	Ga0395901_0009068	3300038443	Bacteria	10072
198	Ga0395901_0023566	3300038443	Bacteria	6311
199	Ga0395901_0064829	3300038443	Bacteria	3803
200	Ga0395901_0203904	3300038443	Bacteria	2072
201	Ga0395901_0217943	3300038443	Bacteria	1995
202	Ga0439466_0086160	3300041411	Unclassified	987
203	Ga0466966_0030301	3300044684	Bacteria	3513
204	Ga0466961_0081002	3300044693	Bacteria	2055
205	Ga0466967_0096051	3300045976	Bacteria	2703
206	Ga0495592_0001282	3300046454	Bacteria	17428
207	Ga0495629_0009971	3300046459	Bacteria	6932
208	Ga0495651_0002468	3300046462	Bacteria	14299
209	Ga0495651_0170297	3300046462	Bacteria	1552
210	Ga0495653_0000022	3300046463	Bacteria	169653
211	Ga0495580_0208744	3300046472	Bacteria	1344
212	Ga0495662_0000552	3300046476	Bacteria	17176
213	Ga0495662_0128930	3300046476	Bacteria	1243
214	Ga0495662_0153972	3300046476	Bacteria	1132
215	Ga0495664_0000013	3300046477	Bacteria	204282
216	Ga0495584_0002262	3300046491	Bacteria	10979
217	Ga0495585_0004639	3300046492	Bacteria	8872
218	Ga0495594_0080925	3300046499	Bacteria	1813
219	Ga0495596_0039934	3300046500	Bacteria	1853
220	Ga0495608_0000004	3300046511	Bacteria	355027
221	Ga0495618_0000032	3300046514	Bacteria	104874
222	Ga0495628_0000014	3300046516	Bacteria	205818
223	Ga0495630_0008555	3300046517	Bacteria	7343
224	Ga0495630_0217896	3300046517	Bacteria	1457
225	Ga0495644_0058726	3300046523	Bacteria	1446
226	Ga0495652_0000002	3300046529	Bacteria	946606
227	Ga0495652_0029463	3300046529	Unclassified	4822
228	Ga0495665_0025776	3300046531	Bacteria	3157
229	Ga0495665_0098434	3300046531	Bacteria	1536
230	Ga0495640_0000001	3300046533	Bacteria	853827
231	Ga0495640_0015948	3300046533	Bacteria	5637
232	Ga0495640_0049098	3300046533	Unclassified	2912
233	Ga0495587_0000004	3300046536	Bacteria	358433
234	Ga0495598_0002627	3300046537	Bacteria	3721
235	Ga0495645_0000001	3300046543	Bacteria	657910
236	Ga0495633_0055016	3300046558	Bacteria	1871
237	Ga0495667_0000009	3300046559	Bacteria	223329
238	Ga0495656_0014469	3300046615	Bacteria	2959
239	Ga0495668_0117130	3300046616	Bacteria	1457
240	Ga0495634_0000033	3300046642	Bacteria	109811
241	Ga0495611_0103920	3300046648	Bacteria	1321
242	Ga0495635_0000003	3300046663	Bacteria	390055
243	Ga0495661_0079627	3300046665	Bacteria	1893
244	Ga0495588_0106703	3300046674	Bacteria	1474
245	Ga0495657_0000112	3300046675	Bacteria	72999
246	Ga0495657_0115412	3300046675	Bacteria	1697
247	Ga0495599_0000012	3300046678	Bacteria	181156
248	Ga0495623_0000026	3300046679	Bacteria	90660
249	Ga0495646_0000005	3300046680	Bacteria	266899
250	Ga0495647_0040146	3300046681	Bacteria	1777
251	Ga0495613_0108857	3300046689	Unclassified	1998
252	Ga0495624_0028414	3300046690	Bacteria	3655
253	Ga0495624_0165057	3300046690	Bacteria	1352
254	Ga0495670_0017387	3300046691	Bacteria	3538
255	Ga0495600_0000003	3300046809	Bacteria	180457
256	Ga0495660_0143618	3300046810	Bacteria	1185
257	Ga0495581_0025749	3300047315	Bacteria	3411
258	Ga0495604_0000002	3300047317	Bacteria	530904
259	Ga0495674_0000004	3300047319	Bacteria	531855
260	Ga0495674_0101279	3300047319	Bacteria	2450
261	Ga0495676_0180459	3300047321	Bacteria	1480
262	Ga0495676_0250245	3300047321	Bacteria	1209
263	Ga0495680_0000129	3300047322	Bacteria	74623
264	Ga0495675_0000268	3300047444	Bacteria	37760
265	Ga0495675_0095399	3300047444	Bacteria	1865
266	Ga0495677_0014818	3300047445	Bacteria	2836
267	Ga0495684_0000019	3300047471	Bacteria	153938
268	Ga0495593_0000137	3300047673	Bacteria	35364
269	Ga0495593_0050775	3300047673	Bacteria	2196
270	Ga0495602_0000001	3300048088	Bacteria	510904
271	Ga0495602_0059076	3300048088	Bacteria	3351
272	Ga0496100_0004121	3300048903	Bacteria	7665
273	Ga0496100_0028207	3300048903	Bacteria	3461
274	Ga0496101_0002301	3300048904	Bacteria	11683
275	Ga0496101_0011088	3300048904	Bacteria	5973
276	Ga0496101_0015677	3300048904	Bacteria	5113
277	Ga0496101_0363736	3300048904	Bacteria	1137
278	Ga0496102_0001907	3300048905	Bacteria	17978
279	Ga0496102_0007993	3300048905	Bacteria	9039
280	Ga0496102_0037270	3300048905	Bacteria	4385
281	Ga0496102_0099392	3300048905	Bacteria	2700
282	Ga0496103_0066537	3300048906	Unclassified	2249
283	Ga0496103_0242963	3300048906	Bacteria	1158
284	Ga0496104_0001787	3300048907	Bacteria	18622
285	Ga0496104_0003321	3300048907	Bacteria	13883
286	Ga0496104_0004100	3300048907	Bacteria	12644
287	Ga0496104_0064968	3300048907	Bacteria	3462
288	Ga0496104_0156797	3300048907	Bacteria	2184
289	Ga0496104_0199917	3300048907	Bacteria	1910
290	Ga0496105_0001778	3300048908	Bacteria	15399
291	Ga0496105_0011008	3300048908	Bacteria	7130
292	Ga0496105_0012522	3300048908	Bacteria	6715
293	Ga0496105_0026567	3300048908	Bacteria	4724
294	Ga0496105_0110199	3300048908	Bacteria	2272
295	Ga0496105_0126532	3300048908	Bacteria	2106
296	Ga0496106_0001903	3300048909	Bacteria	15629
297	Ga0496106_0022600	3300048909	Bacteria	4675
298	Ga0496106_0046243	3300048909	Bacteria	3271
299	Ga0496106_0289114	3300048909	Bacteria	1314
300	Ga0496107_0000742	3300048910	Bacteria	18683
301	Ga0496107_0084093	3300048910	Bacteria	2321
302	Ga0496108_0004907	3300048911	Bacteria	10804
303	Ga0496108_0005149	3300048911	Bacteria	10570
304	Ga0496108_0012312	3300048911	Bacteria	6957
305	Ga0496108_0113936	3300048911	Bacteria	2314
306	Ga0496109_0001273	3300048912	Bacteria	20907
307	Ga0496109_0002185	3300048912	Bacteria	16231
308	Ga0496109_0042044	3300048912	Bacteria	4139
309	Ga0496109_0045609	3300048912	Bacteria	3978
310	Ga0496110_0001267	3300048913	Bacteria	18072
311	Ga0496110_0001439	3300048913	Bacteria	17212
312	Ga0496110_0008474	3300048913	Bacteria	8276
313	Ga0496110_0049989	3300048913	Bacteria	3670
314	Ga0496110_0299461	3300048913	Bacteria	1465
315	Ga0496111_0005865	3300048914	Bacteria	7920
316	Ga0496111_0011164	3300048914	Bacteria	6046
317	Ga0496111_0021366	3300048914	Bacteria	4518
318	Ga0496111_0112493	3300048914	Bacteria	2006
319	Ga0496111_0279234	3300048914	Bacteria	1239
320	Ga0496112_0002066	3300048915	Bacteria	15919
321	Ga0496112_0047470	3300048915	Bacteria	4212
322	Ga0496112_0228716	3300048915	Bacteria	1814
323	Ga0496113_0000303	3300048916	Bacteria	23409
324	Ga0496113_0099471	3300048916	Bacteria	2252
325	Ga0496113_0107369	3300048916	Bacteria	2169
326	Ga0496114_0034255	3300048917	Bacteria	4188
327	Ga0496114_0036960	3300048917	Bacteria	4037
328	Ga0496114_0074741	3300048917	Unclassified	2853
329	Ga0496114_0371724	3300048917	Bacteria	1265
330	Ga0496115_0046868	3300048918	Bacteria	3456
331	Ga0496115_0147274	3300048918	Bacteria	1943
332	Ga0496115_0479660	3300048918	Bacteria	1002
333	Ga0501031_0039636	3300049568	Bacteria	3075
334	Ga0501031_0110056	3300049568	Bacteria	1799
335	Ga0501033_0013590	3300049570	Bacteria	6197
336	Ga0501036_0037735	3300049572	Bacteria	4087
337	Ga0501036_0258202	3300049572	Bacteria	1460
338	Ga0501038_0218533	3300049574	Bacteria	1521
339	Ga0501039_0075978	3300049575	Bacteria	2612
340	Ga0501039_0203986	3300049575	Bacteria	1555
341	Ga0501041_0338091	3300049577	Bacteria	951
342	Ga0501042_0022700	3300049578	Bacteria	4384
343	Ga0501046_0143013	3300049580	Bacteria	1809
344	Ga0501046_0152187	3300049580	Bacteria	1745
345	Ga0501047_0082444	3300049581	Bacteria	3091
346	Ga0501048_0020365	3300049582	Bacteria	4861
347	Ga0501048_0050840	3300049582	Bacteria	2951
348	Ga0501048_0095929	3300049582	Bacteria	2092
349	Ga0501067_0067523	3300049583	Bacteria	1980
350	Ga0501068_0167865	3300049584	Bacteria	1384
351	Ga0501070_0024439	3300049586	Bacteria	5068
352	Ga0501071_0078814	3300049587	Bacteria	2408
353	Ga0501071_0252787	3300049587	Bacteria	1331
354	Ga0501071_0346350	3300049587	Bacteria	1130
355	Ga0501072_0019090	3300049588	Bacteria	5295
356	Ga0501072_0076716	3300049588	Bacteria	2644
357	Ga0501074_0057473	3300049590	Bacteria	2803
358	Ga0501074_0172408	3300049590	Unclassified	1544
359	Ga0501075_0019838	3300049591	Bacteria	4881
360	Ga0501075_0032573	3300049591	Bacteria	3873
361	Ga0501075_0073487	3300049591	Bacteria	2586
362	Ga0501075_0345836	3300049591	Bacteria	1133
363	Ga0501076_0020624	3300049592	Bacteria	5045
364	Ga0501076_0134828	3300049592	Bacteria	2004
365	Ga0501077_0111650	3300049593	Bacteria	1733
366	Ga0501077_0175905	3300049593	Bacteria	1360
367	Ga0501079_0021305	3300049741	Bacteria	4958
368	Ga0501079_0059627	3300049741	Bacteria	2943
369	Ga0501079_0118862	3300049741	Bacteria	2055
370	Ga0501079_0125471	3300049741	Bacteria	1997
371	Ga0501080_0088030	3300049742	Bacteria	2885
372	Ga0501081_0190533	3300049743	Bacteria	1485
373	Ga0501081_0247889	3300049743	Bacteria	1300
374	Ga0501081_0334639	3300049743	Bacteria	1114
375	Ga0501035_0190512	3300049822	Bacteria	1763
376	Ga0501035_0207181	3300049822	Bacteria	1679
377	Ga0501035_0323482	3300049822	Bacteria	1295
378	Ga0501044_0129600	3300049823	Bacteria	2517
379	Ga0501044_0282983	3300049823	Bacteria	1591
380	Ga0501045_0396943	3300049824	Bacteria	1026
381	nmdc:mga03683_21476_c1	3300050489	Bacteria	1982
382	nmdc:mga03n38_14102_c1	3300050490	Bacteria	3056
383	nmdc:mga0yw44_23391_c1	3300050492	Bacteria	3481
384	nmdc:mga0yw44_36988_c1	3300050492	Bacteria	2880
385	nmdc:mga05p37_10595_c1	3300050507	Bacteria	10933
386	nmdc:mga05p37_128688_c1	3300050507	Bacteria	3108
387	nmdc:mga05p37_24411_c1	3300050507	Bacteria	7347
388	nmdc:mga05p37_45362_c1	3300050507	Bacteria	5407
389	nmdc:mga05p37_64137_c1	3300050507	Bacteria	4520
390	nmdc:mga09592_175345_c1	3300050508	Bacteria	1854
391	nmdc:mga09592_254893_c1	3300050508	Unclassified	1521
392	nmdc:mga0qj67_233123_c1	3300050509	Bacteria	1494
393	nmdc:mga0qj67_7_c1	3300050509	Bacteria	146944
394	nmdc:mga06r32_28380_c1	3300050510	Bacteria	5235
395	nmdc:mga06r32_47274_c1	3300050510	Bacteria	4109
396	nmdc:mga06r32_4897_c1	3300050510	Bacteria	12061
397	nmdc:mga08y16_181785_c1	3300050511	Bacteria	2183
398	nmdc:mga08y16_32342_c1	3300050511	Bacteria	5500
399	nmdc:mga0n895_109175_c1	3300050512	Bacteria	2782
400	nmdc:mga0n895_218219_c1	3300050512	Bacteria	1936
401	nmdc:mga0n895_286064_c1	3300050512	Bacteria	1671
402	nmdc:mga0n895_402777_c1	3300050512	Bacteria	1384
403	nmdc:mga0rr50_477431_c1	3300050513	Bacteria	1059
404	Ga0495601_0000002	3300053077	Bacteria	528704
405	Ga0495601_0033688	3300053077	Bacteria	3192
406	Ga0495601_0153247	3300053077	Bacteria	1505
407	Ga0495612_0000012	3300053078	Bacteria	223883
408	Ga0495612_0066993	3300053078	Bacteria	1493
409	Ga0495595_0000012	3300053084	Bacteria	174322
410	Ga0495595_0039516	3300053084	Bacteria	2153
411	Ga0495595_0079060	3300053084	Bacteria	1564
412	Ga0495595_0079599	3300053084	Bacteria	1559
413	Ga0495619_0000003	3300053085	Bacteria	515784
414	Ga0501084_0001517	3300054114	Bacteria	18424
415	Ga0501084_0031886	3300054114	Bacteria	4407
416	Ga0501082_0054779	3300060353	Bacteria	3438
417	Ga0501082_0291357	3300060353	Bacteria	1421
418	Ga0501082_0342766	3300060353	Bacteria	1302
419	Ga0501082_0569957	3300060353	Bacteria	990
420	Ga0466962_0061028	3300061719	Bacteria	1800
421	Ga0530510_0015708	3300061734	Bacteria	5351
422	Ga0530510_0041812	3300061734	Bacteria	3310
423	Ga0530510_0041954	3300061734	Bacteria	3304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300041411	Ga0439466_0086160	Ga0439466_0086160_201_959	251
2	3300049590	Ga0501074_0172408	Ga0501074_0172408_45_863	271
3	3300005471	Ga0070698_100146753	Ga0070698_1001467532	278
4	3300049587	Ga0501071_0346350	Ga0501071_0346350_204_1109	279
5	3300049824	Ga0501045_0396943	Ga0501045_0396943_41_946	279
6	3300060353	Ga0501082_0569957	Ga0501082_0569957_55_960	279
7	3300050511	nmdc:mga08y16_181785_c1	nmdc:mga08y16_181785_c1_912_1757	281
8	3300049743	Ga0501081_0334639	Ga0501081_0334639_154_1101	285
9	3300049568	Ga0501031_0039636	Ga0501031_0039636_324_1277	286
10	3300049572	Ga0501036_0037735	Ga0501036_0037735_152_1105	286
11	3300049580	Ga0501046_0143013	Ga0501046_0143013_33_986	286
12	3300049582	Ga0501048_0050840	Ga0501048_0050840_1296_2249	286
13	3300049584	Ga0501068_0167865	Ga0501068_0167865_35_988	286
14	3300049588	Ga0501072_0076716	Ga0501072_0076716_1600_2553	286
15	3300049590	Ga0501074_0057473	Ga0501074_0057473_1513_2466	286
16	3300049591	Ga0501075_0032573	Ga0501075_0032573_2829_3782	286
17	3300049592	Ga0501076_0020624	Ga0501076_0020624_2961_3914	286
18	3300049741	Ga0501079_0021305	Ga0501079_0021305_2466_3419	286
19	3300054114	Ga0501084_0031886	Ga0501084_0031886_1699_2652	286
20	3300061734	Ga0530510_0041812	Ga0530510_0041812_782_1735	286
21	3300006846	Ga0075430_100000821	Ga0075430_10000082115	290
22	3300049577	Ga0501041_0338091	Ga0501041_0338091_20_937	290
23	3300050509	nmdc:mga0qj67_7_c1	nmdc:mga0qj67_7_c1_39857_40792	290
24	3300046462	Ga0495651_0170297	Ga0495651_0170297_666_1541	291
25	3300047444	Ga0495675_0095399	Ga0495675_0095399_954_1829	291
26	3300053077	Ga0495601_0033688	Ga0495601_0033688_359_1234	291
27	3300053078	Ga0495612_0066993	Ga0495612_0066993_366_1241	291
28	3300053084	Ga0495595_0079060	Ga0495595_0079060_380_1255	291
29	3300048907	Ga0496104_0001787	Ga0496104_0001787_13779_14708	295
30	3300048908	Ga0496105_0001778	Ga0496105_0001778_2159_3088	295
31	3300048916	Ga0496113_0107369	Ga0496113_0107369_58_987	295
32	3300049743	Ga0501081_0190533	Ga0501081_0190533_33_995	296
33	3300038443	Ga0395901_0064829	Ga0395901_0064829_456_1361	301
34	3300048917	Ga0496114_0371724	Ga0496114_0371724_75_998	302
35	3300005543	Ga0070672_100410393	Ga0070672_1004103932	303
36	3300005983	Ga0081540_1000032	Ga0081540_100003261	303
37	3300006914	Ga0075436_100069091	Ga0075436_1000690912	303
38	3300025933	Ga0207706_10373489	Ga0207706_103734892	303
39	3300026089	Ga0207648_10156136	Ga0207648_101561362	303
40	iso_pu_bacteria	2738541281	2738743478	303
41	iso_pu_bacteria	2738543032	2739352385	303
42	iso_pu_bacteria	3003665799	3003669083	303
43	3300005434	Ga0070709_10074621	Ga0070709_100746212	304
44	3300005435	Ga0070714_100009251	Ga0070714_1000092516	304
45	3300005436	Ga0070713_100011742	Ga0070713_1000117424	304
46	3300005437	Ga0070710_10014757	Ga0070710_100147574	304
47	3300005467	Ga0070706_100465773	Ga0070706_1004657731	304
48	3300005546	Ga0070696_100133210	Ga0070696_1001332101	304
49	3300006028	Ga0070717_10147962	Ga0070717_101479622	304
50	3300006163	Ga0070715_10000896	Ga0070715_100008964	304
51	3300007076	Ga0075435_100065785	Ga0075435_1000657852	304
52	3300007076	Ga0075435_100186404	Ga0075435_1001864042	304
53	3300007265	Ga0099794_10090216	Ga0099794_100902161	304
54	3300025910	Ga0207684_10398025	Ga0207684_103980251	304
55	3300025915	Ga0207693_10285589	Ga0207693_102855892	304
56	3300035695	Ga0373927_0205640	Ga0373927_0205640_315_1229	304
57	3300035725	Ga0373947_0230401	Ga0373947_0230401_83_997	304
58	3300036401	Ga0373937_0123732	Ga0373937_0123732_1482_2396	304
59	3300037418	Ga0395900_0081703	Ga0395900_0081703_534_1463	304
60	3300037471	Ga0395905_0257108	Ga0395905_0257108_659_1588	304
61	3300038443	Ga0395901_0217943	Ga0395901_0217943_927_1856	304
62	3300046476	Ga0495662_0128930	Ga0495662_0128930_234_1148	304
63	3300046517	Ga0495630_0217896	Ga0495630_0217896_341_1255	304
64	3300046523	Ga0495644_0058726	Ga0495644_0058726_226_1155	304
65	3300046533	Ga0495640_0015948	Ga0495640_0015948_1288_2202	304
66	3300046675	Ga0495657_0115412	Ga0495657_0115412_182_1096	304
67	3300047319	Ga0495674_0101279	Ga0495674_0101279_392_1306	304
68	3300048088	Ga0495602_0059076	Ga0495602_0059076_2160_3074	304
69	3300048908	Ga0496105_0110199	Ga0496105_0110199_989_1903	304
70	3300048913	Ga0496110_0049989	Ga0496110_0049989_1555_2484	304
71	3300048913	Ga0496110_0299461	Ga0496110_0299461_518_1447	304
72	3300048918	Ga0496115_0147274	Ga0496115_0147274_823_1737	304
73	3300049570	Ga0501033_0013590	Ga0501033_0013590_1405_2334	304
74	3300049574	Ga0501038_0218533	Ga0501038_0218533_92_1021	304
75	3300049575	Ga0501039_0203986	Ga0501039_0203986_216_1145	304
76	3300049581	Ga0501047_0082444	Ga0501047_0082444_251_1180	304
77	3300049586	Ga0501070_0024439	Ga0501070_0024439_1496_2425	304
78	3300049742	Ga0501080_0088030	Ga0501080_0088030_1367_2296	304
79	3300049743	Ga0501081_0247889	Ga0501081_0247889_18_947	304
80	3300049822	Ga0501035_0190512	Ga0501035_0190512_389_1318	304
81	3300049822	Ga0501035_0323482	Ga0501035_0323482_211_1140	304
82	3300049823	Ga0501044_0129600	Ga0501044_0129600_1497_2426	304
83	3300050512	nmdc:mga0n895_218219_c1	nmdc:mga0n895_218219_c1_20_949	304
84	3300060353	Ga0501082_0291357	Ga0501082_0291357_58_987	304
85	iso_pu_bacteria	2643221734	2644737612	304
86	3300005436	Ga0070713_100168787	Ga0070713_1001687871	305
87	3300006173	Ga0070716_100007056	Ga0070716_1000070562	305
88	3300006175	Ga0070712_100226770	Ga0070712_1002267702	305
89	3300006847	Ga0075431_100036436	Ga0075431_1000364363	305
90	3300006871	Ga0075434_100016976	Ga0075434_1000169762	305
91	3300009147	Ga0114129_10038749	Ga0114129_100387495	305
92	3300014325	Ga0163163_10053005	Ga0163163_100530053	305
93	3300024225	Ga0224572_1011707	Ga0224572_10117071	305
94	3300025898	Ga0207692_10008624	Ga0207692_100086243	305
95	3300025906	Ga0207699_10007287	Ga0207699_100072872	305
96	3300025915	Ga0207693_10006232	Ga0207693_1000623210	305
97	3300025915	Ga0207693_10207868	Ga0207693_102078682	305
98	3300025915	Ga0207693_10279578	Ga0207693_102795782	305
99	3300025916	Ga0207663_10019637	Ga0207663_100196372	305
100	3300025928	Ga0207700_10000458	Ga0207700_100004582	305
101	3300025929	Ga0207664_10031202	Ga0207664_100312022	305
102	3300025939	Ga0207665_10006165	Ga0207665_100061653	305
103	3300025939	Ga0207665_10024600	Ga0207665_100246002	305
104	3300025972	Ga0207668_10138395	Ga0207668_101383952	305
105	3300026095	Ga0207676_10375581	Ga0207676_103755811	305
106	3300031090	Ga0265760_10036223	Ga0265760_100362233	305
107	3300031665	Ga0316575_10003861	Ga0316575_100038616	305
108	3300031691	Ga0316579_10016074	Ga0316579_100160744	305
109	3300031727	Ga0316576_10130885	Ga0316576_101308853	305
110	3300031728	Ga0316578_10022830	Ga0316578_100228303	305
111	3300031733	Ga0316577_10172540	Ga0316577_101725401	305
112	3300032139	Ga0316580_10014519	Ga0316580_100145192	305
113	3300035171	Ga0373946_0006727	Ga0373946_0006727_807_1724	305
114	3300035172	Ga0373955_0007178	Ga0373955_0007178_1607_2524	305
115	3300035410	Ga0373924_0006143	Ga0373924_0006143_3304_4221	305
116	3300035692	Ga0373935_0000454	Ga0373935_0000454_2522_3439	305
117	3300035695	Ga0373927_0013081	Ga0373927_0013081_4035_4952	305
118	3300035724	Ga0373933_0002060	Ga0373933_0002060_8327_9244	305
119	3300035725	Ga0373947_0008199	Ga0373947_0008199_2419_3336	305
120	3300036401	Ga0373937_0000089	Ga0373937_0000089_58618_59535	305
121	3300036712	Ga0316584_0015212	Ga0316584_0015212_656_1609	305
122	3300037068	Ga0373925_0000016	Ga0373925_0000016_156542_157459	305
123	3300046454	Ga0495592_0001282	Ga0495592_0001282_6242_7159	305
124	3300046459	Ga0495629_0009971	Ga0495629_0009971_1482_2399	305
125	3300046462	Ga0495651_0002468	Ga0495651_0002468_33_950	305
126	3300046463	Ga0495653_0000022	Ga0495653_0000022_106909_107826	305
127	3300046476	Ga0495662_0000552	Ga0495662_0000552_6713_7630	305
128	3300046477	Ga0495664_0000013	Ga0495664_0000013_83430_84347	305
129	3300046511	Ga0495608_0000004	Ga0495608_0000004_234160_235077	305
130	3300046514	Ga0495618_0000032	Ga0495618_0000032_93338_94255	305
131	3300046516	Ga0495628_0000014	Ga0495628_0000014_121479_122396	305
132	3300046517	Ga0495630_0008555	Ga0495630_0008555_998_1915	305
133	3300046529	Ga0495652_0000002	Ga0495652_0000002_88544_89461	305
134	3300046529	Ga0495652_0029463	Ga0495652_0029463_590_1507	305
135	3300046531	Ga0495665_0025776	Ga0495665_0025776_793_1710	305
136	3300046533	Ga0495640_0000001	Ga0495640_0000001_182547_183464	305
137	3300046536	Ga0495587_0000004	Ga0495587_0000004_237644_238561	305
138	3300046543	Ga0495645_0000001	Ga0495645_0000001_120029_120946	305
139	3300046559	Ga0495667_0000009	Ga0495667_0000009_125078_125995	305
140	3300046642	Ga0495634_0000033	Ga0495634_0000033_96597_97514	305
141	3300046663	Ga0495635_0000003	Ga0495635_0000003_119886_120803	305
142	3300046675	Ga0495657_0000112	Ga0495657_0000112_65849_66766	305
143	3300046678	Ga0495599_0000012	Ga0495599_0000012_177658_178575	305
144	3300046679	Ga0495623_0000026	Ga0495623_0000026_51964_52881	305
145	3300046680	Ga0495646_0000005	Ga0495646_0000005_32426_33343	305
146	3300046690	Ga0495624_0028414	Ga0495624_0028414_2002_2919	305
147	3300046690	Ga0495624_0165057	Ga0495624_0165057_194_1117	305
148	3300046809	Ga0495600_0000003	Ga0495600_0000003_100946_101863	305
149	3300047315	Ga0495581_0025749	Ga0495581_0025749_2164_3081	305
150	3300047317	Ga0495604_0000002	Ga0495604_0000002_410062_410979	305
151	3300047319	Ga0495674_0000004	Ga0495674_0000004_409395_410312	305
152	3300047321	Ga0495676_0180459	Ga0495676_0180459_191_1114	305
153	3300047322	Ga0495680_0000129	Ga0495680_0000129_59291_60208	305
154	3300047444	Ga0495675_0000268	Ga0495675_0000268_14586_15503	305
155	3300047471	Ga0495684_0000019	Ga0495684_0000019_33092_34009	305
156	3300047673	Ga0495593_0000137	Ga0495593_0000137_17475_18392	305
157	3300048088	Ga0495602_0000001	Ga0495602_0000001_119928_120845	305
158	3300048903	Ga0496100_0028207	Ga0496100_0028207_1313_2263	305
159	3300048904	Ga0496101_0363736	Ga0496101_0363736_100_1050	305
160	3300048905	Ga0496102_0007993	Ga0496102_0007993_2922_3845	305
161	3300048907	Ga0496104_0156797	Ga0496104_0156797_433_1356	305
162	3300048908	Ga0496105_0026567	Ga0496105_0026567_3432_4355	305
163	3300048909	Ga0496106_0046243	Ga0496106_0046243_319_1269	305
164	3300048909	Ga0496106_0289114	Ga0496106_0289114_354_1277	305
165	3300048910	Ga0496107_0084093	Ga0496107_0084093_829_1779	305
166	3300048911	Ga0496108_0113936	Ga0496108_0113936_984_1907	305
167	3300048914	Ga0496111_0021366	Ga0496111_0021366_3431_4354	305
168	3300048915	Ga0496112_0228716	Ga0496112_0228716_165_1088	305
169	3300048916	Ga0496113_0099471	Ga0496113_0099471_755_1678	305
170	3300048918	Ga0496115_0046868	Ga0496115_0046868_2335_3258	305
171	3300050507	nmdc:mga05p37_24411_c1	nmdc:mga05p37_24411_c1_2668_3648	305
172	3300050510	nmdc:mga06r32_28380_c1	nmdc:mga06r32_28380_c1_1862_2842	305
173	3300050512	nmdc:mga0n895_109175_c1	nmdc:mga0n895_109175_c1_841_1791	305
174	3300053077	Ga0495601_0000002	Ga0495601_0000002_436534_437451	305
175	3300053078	Ga0495612_0000012	Ga0495612_0000012_103090_104007	305
176	3300053084	Ga0495595_0000012	Ga0495595_0000012_61677_62594	305
177	3300053085	Ga0495619_0000003	Ga0495619_0000003_125050_125967	305
178	iso_pu_bacteria	2842698319	2842698632	305
179	3300005331	Ga0070670_100058543	Ga0070670_1000585432	306
180	3300005334	Ga0068869_100033528	Ga0068869_1000335283	306
181	3300005335	Ga0070666_10034663	Ga0070666_100346633	306
182	3300005338	Ga0068868_100022983	Ga0068868_1000229832	306
183	3300005344	Ga0070661_100030673	Ga0070661_1000306732	306
184	3300005353	Ga0070669_100112616	Ga0070669_1001126161	306
185	3300005367	Ga0070667_100013697	Ga0070667_1000136976	306
186	3300005437	Ga0070710_10184096	Ga0070710_101840962	306
187	3300005438	Ga0070701_10022673	Ga0070701_100226731	306
188	3300005439	Ga0070711_100034819	Ga0070711_1000348191	306
189	3300005457	Ga0070662_100007330	Ga0070662_1000073307	306
190	3300005459	Ga0068867_100091166	Ga0068867_1000911662	306
191	3300005539	Ga0068853_100065423	Ga0068853_1000654232	306
192	3300005544	Ga0070686_100008180	Ga0070686_1000081805	306
193	3300005564	Ga0070664_100058372	Ga0070664_1000583722	306
194	3300005616	Ga0068852_100220189	Ga0068852_1002201892	306
195	3300005617	Ga0068859_100014661	Ga0068859_1000146618	306
196	3300005718	Ga0068866_10002755	Ga0068866_100027557	306
197	3300005719	Ga0068861_100031239	Ga0068861_1000312391	306
198	3300005841	Ga0068863_100169827	Ga0068863_1001698272	306
199	3300006028	Ga0070717_10463812	Ga0070717_104638121	306
200	3300006038	Ga0075365_10079656	Ga0075365_100796562	306
201	3300006038	Ga0075365_10131705	Ga0075365_101317052	306
202	3300006048	Ga0075363_100017020	Ga0075363_1000170203	306
203	3300006175	Ga0070712_100038299	Ga0070712_1000382992	306
204	3300006847	Ga0075431_100211345	Ga0075431_1002113451	306
205	3300006871	Ga0075434_100113923	Ga0075434_1001139232	306
206	3300006880	Ga0075429_100035014	Ga0075429_1000350141	306
207	3300006880	Ga0075429_100150599	Ga0075429_1001505992	306
208	3300006931	Ga0097620_100014660	Ga0097620_1000146602	306
209	3300009094	Ga0111539_10131964	Ga0111539_101319642	306
210	3300009094	Ga0111539_10179891	Ga0111539_101798912	306
211	3300009098	Ga0105245_10214169	Ga0105245_102141692	306
212	3300009101	Ga0105247_10006172	Ga0105247_100061723	306
213	3300009147	Ga0114129_10011285	Ga0114129_100112857	306
214	3300009147	Ga0114129_10479030	Ga0114129_104790302	306
215	3300009148	Ga0105243_10056774	Ga0105243_100567742	306
216	3300009176	Ga0105242_10072007	Ga0105242_100720072	306
217	3300009177	Ga0105248_10050919	Ga0105248_100509193	306
218	3300009545	Ga0105237_10035802	Ga0105237_100358025	306
219	3300009553	Ga0105249_10018832	Ga0105249_100188322	306
220	3300010375	Ga0105239_10164771	Ga0105239_101647712	306
221	3300013296	Ga0157374_10002466	Ga0157374_100024664	306
222	3300014325	Ga0163163_10213910	Ga0163163_102139102	306
223	3300014968	Ga0157379_10043843	Ga0157379_100438432	306
224	3300017792	Ga0163161_10033692	Ga0163161_100336922	306
225	3300025898	Ga0207692_10157652	Ga0207692_101576521	306
226	3300025900	Ga0207710_10017012	Ga0207710_100170123	306
227	3300025901	Ga0207688_10000117	Ga0207688_1000011726	306
228	3300025903	Ga0207680_10112027	Ga0207680_101120272	306
229	3300025904	Ga0207647_10015624	Ga0207647_100156243	306
230	3300025908	Ga0207643_10000291	Ga0207643_1000029124	306
231	3300025918	Ga0207662_10004840	Ga0207662_100048405	306
232	3300025919	Ga0207657_10037546	Ga0207657_100375464	306
233	3300025925	Ga0207650_10007981	Ga0207650_100079816	306
234	3300025925	Ga0207650_10037956	Ga0207650_100379562	306
235	3300025931	Ga0207644_10032511	Ga0207644_100325111	306
236	3300025936	Ga0207670_10031516	Ga0207670_100315162	306
237	3300025937	Ga0207669_10014161	Ga0207669_100141613	306
238	3300025940	Ga0207691_10012255	Ga0207691_100122558	306
239	3300025941	Ga0207711_10039010	Ga0207711_100390102	306
240	3300025942	Ga0207689_10002877	Ga0207689_1000287716	306
241	3300025944	Ga0207661_10099866	Ga0207661_100998662	306
242	3300025945	Ga0207679_10076308	Ga0207679_100763083	306
243	3300025960	Ga0207651_10018905	Ga0207651_100189053	306
244	3300025972	Ga0207668_10005839	Ga0207668_100058393	306
245	3300026023	Ga0207677_10061643	Ga0207677_100616432	306
246	3300026035	Ga0207703_10061763	Ga0207703_100617632	306
247	3300026075	Ga0207708_10001828	Ga0207708_100018286	306
248	3300026088	Ga0207641_10020581	Ga0207641_100205813	306
249	3300026089	Ga0207648_10145861	Ga0207648_101458612	306
250	3300026121	Ga0207683_10036001	Ga0207683_100360014	306
251	3300028379	Ga0268266_10030720	Ga0268266_100307204	306
252	3300028380	Ga0268265_10031473	Ga0268265_100314732	306
253	3300028381	Ga0268264_10078844	Ga0268264_100788443	306
254	3300035171	Ga0373946_0077756	Ga0373946_0077756_84_1019	306
255	3300035691	Ga0373931_0185692	Ga0373931_0185692_62_997	306
256	3300035692	Ga0373935_0218724	Ga0373935_0218724_11_946	306
257	3300035695	Ga0373927_0085781	Ga0373927_0085781_770_1705	306
258	3300035725	Ga0373947_0145167	Ga0373947_0145167_47_982	306
259	3300046476	Ga0495662_0153972	Ga0495662_0153972_70_1005	306
260	3300046491	Ga0495584_0002262	Ga0495584_0002262_3675_4610	306
261	3300046492	Ga0495585_0004639	Ga0495585_0004639_5023_5958	306
262	3300046499	Ga0495594_0080925	Ga0495594_0080925_541_1476	306
263	3300046500	Ga0495596_0039934	Ga0495596_0039934_367_1302	306
264	3300046531	Ga0495665_0098434	Ga0495665_0098434_538_1473	306
265	3300046533	Ga0495640_0049098	Ga0495640_0049098_1691_2626	306
266	3300046537	Ga0495598_0002627	Ga0495598_0002627_2731_3666	306
267	3300046558	Ga0495633_0055016	Ga0495633_0055016_475_1410	306
268	3300046616	Ga0495668_0117130	Ga0495668_0117130_268_1203	306
269	3300046648	Ga0495611_0103920	Ga0495611_0103920_86_1021	306
270	3300046665	Ga0495661_0079627	Ga0495661_0079627_25_960	306
271	3300046674	Ga0495588_0106703	Ga0495588_0106703_38_973	306
272	3300046681	Ga0495647_0040146	Ga0495647_0040146_689_1624	306
273	3300046689	Ga0495613_0108857	Ga0495613_0108857_537_1472	306
274	3300046691	Ga0495670_0017387	Ga0495670_0017387_1700_2635	306
275	3300046810	Ga0495660_0143618	Ga0495660_0143618_149_1084	306
276	3300047321	Ga0495676_0250245	Ga0495676_0250245_142_1077	306
277	3300047445	Ga0495677_0014818	Ga0495677_0014818_1191_2126	306
278	3300047673	Ga0495593_0050775	Ga0495593_0050775_510_1445	306
279	3300048904	Ga0496101_0015677	Ga0496101_0015677_1929_2864	306
280	3300048905	Ga0496102_0037270	Ga0496102_0037270_3390_4325	306
281	3300048905	Ga0496102_0099392	Ga0496102_0099392_1349_2284	306
282	3300048906	Ga0496103_0242963	Ga0496103_0242963_143_1078	306
283	3300048907	Ga0496104_0199917	Ga0496104_0199917_300_1235	306
284	3300048908	Ga0496105_0012522	Ga0496105_0012522_1714_2649	306
285	3300048908	Ga0496105_0126532	Ga0496105_0126532_973_1908	306
286	3300048909	Ga0496106_0022600	Ga0496106_0022600_3258_4193	306
287	3300048911	Ga0496108_0004907	Ga0496108_0004907_619_1554	306
288	3300048912	Ga0496109_0001273	Ga0496109_0001273_11970_12905	306
289	3300048912	Ga0496109_0042044	Ga0496109_0042044_2664_3599	306
290	3300048913	Ga0496110_0008474	Ga0496110_0008474_4502_5437	306
291	3300048915	Ga0496112_0047470	Ga0496112_0047470_1929_2864	306
292	3300048916	Ga0496113_0000303	Ga0496113_0000303_14448_15383	306
293	3300048917	Ga0496114_0034255	Ga0496114_0034255_2451_3386	306
294	3300048917	Ga0496114_0036960	Ga0496114_0036960_2917_3852	306
295	3300049580	Ga0501046_0152187	Ga0501046_0152187_745_1680	306
296	3300049591	Ga0501075_0073487	Ga0501075_0073487_581_1516	306
297	3300049591	Ga0501075_0345836	Ga0501075_0345836_126_1061	306
298	3300049593	Ga0501077_0111650	Ga0501077_0111650_218_1153	306
299	3300049593	Ga0501077_0175905	Ga0501077_0175905_291_1226	306
300	3300049741	Ga0501079_0118862	Ga0501079_0118862_368_1303	306
301	3300049741	Ga0501079_0125471	Ga0501079_0125471_441_1376	306
302	3300050489	nmdc:mga03683_21476_c1	nmdc:mga03683_21476_c1_559_1494	306
303	3300050490	nmdc:mga03n38_14102_c1	nmdc:mga03n38_14102_c1_682_1617	306
304	3300050492	nmdc:mga0yw44_23391_c1	nmdc:mga0yw44_23391_c1_1987_2922	306
305	3300050492	nmdc:mga0yw44_36988_c1	nmdc:mga0yw44_36988_c1_25_960	306
306	3300050507	nmdc:mga05p37_10595_c1	nmdc:mga05p37_10595_c1_7271_8212	306
307	3300050507	nmdc:mga05p37_128688_c1	nmdc:mga05p37_128688_c1_828_1763	306
308	3300050507	nmdc:mga05p37_45362_c1	nmdc:mga05p37_45362_c1_690_1625	306
309	3300050508	nmdc:mga09592_175345_c1	nmdc:mga09592_175345_c1_333_1268	306
310	3300050508	nmdc:mga09592_254893_c1	nmdc:mga09592_254893_c1_36_977	306
311	3300050510	nmdc:mga06r32_47274_c1	nmdc:mga06r32_47274_c1_2979_3914	306
312	3300050510	nmdc:mga06r32_4897_c1	nmdc:mga06r32_4897_c1_9004_9945	306
313	3300050511	nmdc:mga08y16_32342_c1	nmdc:mga08y16_32342_c1_2797_3732	306
314	3300053084	Ga0495595_0039516	Ga0495595_0039516_158_1093	306
315	3300061734	Ga0530510_0015708	Ga0530510_0015708_1279_2214	306
316	iso_pu_bacteria	2884298095	2884298283	306
317	3300009094	Ga0111539_10194521	Ga0111539_101945211	307
318	3300037853	Ga0436364_0574792	Ga0436364_0574792_362_1288	307
319	3300048903	Ga0496100_0004121	Ga0496100_0004121_4372_5313	307
320	3300048904	Ga0496101_0002301	Ga0496101_0002301_8074_9015	307
321	3300048905	Ga0496102_0001907	Ga0496102_0001907_5283_6224	307
322	3300048906	Ga0496103_0066537	Ga0496103_0066537_653_1594	307
323	3300048907	Ga0496104_0003321	Ga0496104_0003321_10800_11741	307
324	3300048908	Ga0496105_0011008	Ga0496105_0011008_4015_4956	307
325	3300048909	Ga0496106_0001903	Ga0496106_0001903_10090_11031	307
326	3300048910	Ga0496107_0000742	Ga0496107_0000742_4263_5204	307
327	3300048911	Ga0496108_0005149	Ga0496108_0005149_4730_5671	307
328	3300048911	Ga0496108_0012312	Ga0496108_0012312_2316_3257	307
329	3300048912	Ga0496109_0002185	Ga0496109_0002185_3788_4729	307
330	3300048912	Ga0496109_0045609	Ga0496109_0045609_2313_3254	307
331	3300048913	Ga0496110_0001267	Ga0496110_0001267_4762_5703	307
332	3300048913	Ga0496110_0001439	Ga0496110_0001439_4826_5767	307
333	3300048914	Ga0496111_0005865	Ga0496111_0005865_3303_4244	307
334	3300048914	Ga0496111_0011164	Ga0496111_0011164_785_1726	307
335	3300048915	Ga0496112_0002066	Ga0496112_0002066_10913_11854	307
336	3300048917	Ga0496114_0074741	Ga0496114_0074741_1798_2739	307
337	3300049583	Ga0501067_0067523	Ga0501067_0067523_669_1610	307
338	3300049587	Ga0501071_0252787	Ga0501071_0252787_366_1313	307
339	3300037312	Ga0395899_0003124	Ga0395899_0003124_9989_10918	308
340	3300037418	Ga0395900_0001182	Ga0395900_0001182_3591_4520	308
341	3300037466	Ga0395898_0016185	Ga0395898_0016185_2541_3470	308
342	3300038443	Ga0395901_0203904	Ga0395901_0203904_260_1189	308
343	3300046615	Ga0495656_0014469	Ga0495656_0014469_1260_2231	308
344	3300005985	Ga0081539_10019998	Ga0081539_100199985	309
345	3300006880	Ga0075429_100401069	Ga0075429_1004010692	309
346	3300009147	Ga0114129_10071187	Ga0114129_100711874	309
347	3300048904	Ga0496101_0011088	Ga0496101_0011088_1375_2313	309
348	3300048907	Ga0496104_0004100	Ga0496104_0004100_4504_5442	309
349	3300048914	Ga0496111_0279234	Ga0496111_0279234_221_1159	309
350	3300050507	nmdc:mga05p37_64137_c1	nmdc:mga05p37_64137_c1_1564_2493	309
351	iso_pu_bacteria	2508501050	2508734461	309
352	iso_pu_bacteria	2773857925	2774869540	309
353	iso_pu_bacteria	2775506901	2776257277	309
354	iso_pu_bacteria	2835312727	2835314410	309
355	iso_pu_bacteria	2882456835	2882458791	309
356	iso_pu_bacteria	2894232714	2894241230	309
357	iso_pu_bacteria	643348564	643597815	309
358	3300006844	Ga0075428_100526427	Ga0075428_1005264272	310
359	3300007076	Ga0075435_100264251	Ga0075435_1002642512	310
360	3300009094	Ga0111539_10204364	Ga0111539_102043642	310
361	3300025921	Ga0207652_10206391	Ga0207652_102063911	310
362	3300031727	Ga0316576_10115359	Ga0316576_101153593	310
363	3300031728	Ga0316578_10083458	Ga0316578_100834582	310
364	3300031733	Ga0316577_10095340	Ga0316577_100953402	310
365	3300032137	Ga0316585_10044677	Ga0316585_100446771	310
366	3300035398	Ga0316574_0096072	Ga0316574_0096072_348_1301	310
367	3300036647	Ga0316582_0141959	Ga0316582_0141959_190_1143	310
368	3300036712	Ga0316584_0113076	Ga0316584_0113076_565_1518	310
369	3300037418	Ga0395900_0072980	Ga0395900_0072980_2509_3444	310
370	3300037418	Ga0395900_0314121	Ga0395900_0314121_598_1533	310
371	3300037466	Ga0395898_0128715	Ga0395898_0128715_1274_2209	310
372	3300037466	Ga0395898_0131992	Ga0395898_0131992_283_1218	310
373	3300038443	Ga0395901_0009068	Ga0395901_0009068_2470_3405	310
374	3300038443	Ga0395901_0023566	Ga0395901_0023566_951_1886	310
375	3300049572	Ga0501036_0258202	Ga0501036_0258202_293_1264	310
376	3300049582	Ga0501048_0095929	Ga0501048_0095929_556_1527	310
377	3300050512	nmdc:mga0n895_286064_c1	nmdc:mga0n895_286064_c1_318_1250	310
378	3300060353	Ga0501082_0342766	Ga0501082_0342766_156_1127	310
379	3300031995	Ga0307409_100457600	Ga0307409_1004576001	311
380	3300013296	Ga0157374_10273954	Ga0157374_102739543	312
381	3300044684	Ga0466966_0030301	Ga0466966_0030301_23_970	312
382	3300044693	Ga0466961_0081002	Ga0466961_0081002_863_1810	312
383	3300048907	Ga0496104_0064968	Ga0496104_0064968_578_1516	312
384	3300048914	Ga0496111_0112493	Ga0496111_0112493_976_1914	312
385	3300048918	Ga0496115_0479660	Ga0496115_0479660_50_988	312
386	3300049822	Ga0501035_0207181	Ga0501035_0207181_117_1088	312
387	3300053077	Ga0495601_0153247	Ga0495601_0153247_324_1262	312
388	3300053084	Ga0495595_0079599	Ga0495595_0079599_335_1273	312
389	3300005338	Ga0068868_100164585	Ga0068868_1001645852	313
390	3300005347	Ga0070668_100078924	Ga0070668_1000789242	313
391	3300005615	Ga0070702_100179144	Ga0070702_1001791442	313
392	3300005981	Ga0081538_10025304	Ga0081538_100253042	313
393	3300006175	Ga0070712_100000165	Ga0070712_10000016527	313
394	3300006358	Ga0068871_100095330	Ga0068871_1000953304	313
395	3300009177	Ga0105248_10020474	Ga0105248_100204746	313
396	3300025901	Ga0207688_10024528	Ga0207688_100245282	313
397	3300025927	Ga0207687_10205609	Ga0207687_102056092	313
398	3300025972	Ga0207668_10280253	Ga0207668_102802531	313
399	3300031852	Ga0307410_10205439	Ga0307410_102054391	313
400	3300037471	Ga0395905_0010942	Ga0395905_0010942_650_1591	313
401	3300049568	Ga0501031_0110056	Ga0501031_0110056_182_1123	313
402	3300049575	Ga0501039_0075978	Ga0501039_0075978_435_1376	313
403	3300049578	Ga0501042_0022700	Ga0501042_0022700_3014_3955	313
404	3300049587	Ga0501071_0078814	Ga0501071_0078814_1026_1967	313
405	3300049592	Ga0501076_0134828	Ga0501076_0134828_1050_1991	313
406	3300060353	Ga0501082_0054779	Ga0501082_0054779_1957_2898	313
407	iso_pu_bacteria	641522639	641640377	313
408	3300025915	Ga0207693_10006770	Ga0207693_100067709	314
409	3300007076	Ga0075435_100141042	Ga0075435_1001410423	315
410	3300035092	Ga0373952_0033036	Ga0373952_0033036_155_1102	315
411	3300035692	Ga0373935_0157404	Ga0373935_0157404_58_1005	315
412	3300045976	Ga0466967_0096051	Ga0466967_0096051_276_1226	315
413	3300050513	nmdc:mga0rr50_477431_c1	nmdc:mga0rr50_477431_c1_34_981	315
414	3300006844	Ga0075428_100157800	Ga0075428_1001578001	316
415	3300006846	Ga0075430_100026606	Ga0075430_1000266066	316
416	3300006847	Ga0075431_100075329	Ga0075431_1000753292	316
417	3300006871	Ga0075434_100013846	Ga0075434_1000138464	316
418	3300049823	Ga0501044_0282983	Ga0501044_0282983_484_1449	316
419	3300050509	nmdc:mga0qj67_233123_c1	nmdc:mga0qj67_233123_c1_303_1268	316
420	3300050512	nmdc:mga0n895_402777_c1	nmdc:mga0n895_402777_c1_291_1247	316
421	3300009098	Ga0105245_10102816	Ga0105245_101028164	317
422	3300005545	Ga0070695_100005074	Ga0070695_1000050743	319
423	3300005719	Ga0068861_100098047	Ga0068861_1000980472	319
424	3300005937	Ga0081455_10005582	Ga0081455_100055821	319
425	3300014326	Ga0157380_10224478	Ga0157380_102244782	319
426	3300014968	Ga0157379_10457580	Ga0157379_104575801	319
427	3300026075	Ga0207708_10183747	Ga0207708_101837471	319
428	3300035695	Ga0373927_0299979	Ga0373927_0299979_43_1011	319
429	3300046472	Ga0495580_0208744	Ga0495580_0208744_73_1041	319
430	3300049582	Ga0501048_0020365	Ga0501048_0020365_1542_2552	321
431	3300049588	Ga0501072_0019090	Ga0501072_0019090_1381_2391	321
432	3300049591	Ga0501075_0019838	Ga0501075_0019838_1942_2952	321
433	3300049741	Ga0501079_0059627	Ga0501079_0059627_1335_2345	321
434	3300054114	Ga0501084_0001517	Ga0501084_0001517_9551_10561	321
435	3300061734	Ga0530510_0041954	Ga0530510_0041954_522_1532	321
436	3300003323	rootH1_10106330	rootH1_101063303	322
437	3300061719	Ga0466962_0061028	Ga0466962_0061028_272_1240	322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

15

232

0.88 PF05368

NmrA

NmrA-like family

18

132

0.88 PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

19

169

0.88 PF01370

Epimerase

NAD dependent epimerase/dehydratase family

18

238

0.87 PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

19

237

0.85 PF13460

NAD_binding_10

NAD(P)H-binding

22

197

0.82 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3m2p-assembly1.cif.gz_B	the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus	0.8866	5	309
3m2p-assembly1.cif.gz_B	the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus	0.8801	5	309
3m2p-assembly2.cif.gz_C	the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus	0.877	5	307
3m2p-assembly2.cif.gz_F	the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus	0.8706	5	309
3m2p-assembly3.cif.gz_E	the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus	0.8671	5	308

ID	Description	Score	Start	End	Superfamily
af_K7VJC9_94_197_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9492	5	35	3.40.50.720
4j36B00	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain	0.8684	5	40	3.50.50.60
3m2pE00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.8658	5	308	3.40.50.720
3m2pE00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.8595	5	308	3.40.50.720
3sc6D01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.8559	2	229	3.40.50.720

ID	Description	Score	Start	End
AF-A0A2G8MH58-F1-model_v4	deleted	0.9642	188	308
AF-A0A1Q3QFD4-F1-model_v4	deleted	0.9547	61	306
AF-A0A2G8MH58-F1-model_v4	deleted	0.949	188	308
AF-W2TXR6-F1-model_v4	Putative epimerase/dehydratase WbiG	0.947	82	312
AF-A0A1E3W2W6-F1-model_v4	NAD-dependent epimerase/dehydratase domain-containing protein	0.9445	7	308

Feature Viewer

pLDDT	pTM	Quality
87.18	0.87	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F443753

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF04321

RmlD_sub_bind

RmlD substrate binding domain

15

232

0.88

PF05368

NmrA

NmrA-like family

18

132

0.88

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

19

169

0.88

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

18

238

0.87

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

19

237

0.85

PF13460

NAD_binding_10

NAD(P)H-binding

22

197

0.82

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map