F443734

General Info

Members Datasets Scaffolds Average Seq Length
437 174 874 305

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100252029|Ga0070712_1002520292
Length 318
Sequence MGGFVLRKAGAALIVVFCSSIVVFIGARALPGGPAEALGGENRDPAVVAAIKHAYGLDRPLPVQYVKWITHAVQGDLGLDARQLPVAHTIVTRIPITLELAFLAVLIGTVFGVXXXXIAAVRRGKLSDHAATTSALVGLSVPHFWLGLLMIIVFAVNLQWLPAGGYVPFSQDPIGNLEHMVMPAIVLGTGLSAVLMRQTRSAMLTSLGADYVRTARAKGLSEWSVVGKHALRNSLITVTTVVGLQLGALISGAVITEQIFVIPGFGRLTIEAINERDYTLLQGVVLVAATGYVVVNLLVDVVYSFLNPRIRVSGSATP

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
45 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
46 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
47 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
75 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
76 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
77 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
82 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
85 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
91 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
92 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
96 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
97 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
98 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
106 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
107 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
108 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
114 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
115 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
120 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
121 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
122 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
123 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
124 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
125 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
126 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
127 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
128 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
129 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
130 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
131 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
132 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
136 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
146 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
153 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
170 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
171 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 1.83
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.15
Rhizosphere 90.85
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_100252029 3300006175 Bacteria 1411
2 Ga0070658_10014053 3300005327 Bacteria 6428
3 Ga0070658_10027399 3300005327 Bacteria 4573
4 Ga0070683_100001420 3300005329 Bacteria 18387
5 Ga0070683_100134428 3300005329 Bacteria 2341
6 Ga0070683_100292368 3300005329 Bacteria 1549
7 Ga0070680_100048695 3300005336 Bacteria 3454
8 Ga0070680_100090174 3300005336 Bacteria 2537
9 Ga0070682_100003040 3300005337 Bacteria 9299
10 Ga0070660_100000957 3300005339 Bacteria 19306
11 Ga0070660_100003672 3300005339 Bacteria 10597
12 Ga0070660_100006611 3300005339 Bacteria 8045
13 Ga0070660_100022877 3300005339 Bacteria 4627
14 Ga0070660_100042371 3300005339 Bacteria 3474
15 Ga0070660_100122533 3300005339 Bacteria 2075
16 Ga0070661_100111215 3300005344 Bacteria 2045
17 Ga0070661_100123166 3300005344 Bacteria 1943
18 Ga0070661_100151981 3300005344 Bacteria 1750
19 Ga0070692_10108583 3300005345 Bacteria 1531
20 Ga0070671_100104055 3300005355 Bacteria 2382
21 Ga0070659_100003822 3300005366 Bacteria 10740
22 Ga0070659_100054573 3300005366 Bacteria 3147
23 Ga0070659_100074383 3300005366 Bacteria 2706
24 Ga0070714_100029179 3300005435 Bacteria 4585
25 Ga0070714_100036338 3300005435 Bacteria 4131
26 Ga0070714_100108473 3300005435 Bacteria 2455
27 Ga0070714_100128567 3300005435 Bacteria 2262
28 Ga0070708_100134099 3300005445 Bacteria 2293
29 Ga0070662_100081641 3300005457 Bacteria 2409
30 Ga0070681_10004096 3300005458 Bacteria 13776
31 Ga0070681_10005104 3300005458 Bacteria 12674
32 Ga0070681_10010798 3300005458 Bacteria 9026
33 Ga0070681_10026822 3300005458 Bacteria 5791
34 Ga0070681_10038536 3300005458 Bacteria 4792
35 Ga0070681_10039674 3300005458 Bacteria 4720
36 Ga0070681_10076101 3300005458 Bacteria 3316
37 Ga0070681_10160517 3300005458 Bacteria 2172
38 Ga0070681_10250591 3300005458 Unclassified 1683
39 Ga0070698_100022652 3300005471 Bacteria 6569
40 Ga0070679_100003916 3300005530 Bacteria 13692
41 Ga0070679_100031030 3300005530 Bacteria 5280
42 Ga0070679_100055896 3300005530 Bacteria 3932
43 Ga0070679_100060839 3300005530 Bacteria 3764
44 Ga0070679_100066577 3300005530 Bacteria 3591
45 Ga0070679_100090701 3300005530 Bacteria 3044
46 Ga0070679_100113684 3300005530 Bacteria 2692
47 Ga0070679_100243223 3300005530 Bacteria 1757
48 Ga0070679_100425339 3300005530 Bacteria 1273
49 Ga0070684_100004961 3300005535 Bacteria 10158
50 Ga0070684_100077622 3300005535 Bacteria 2933
51 Ga0068853_100090978 3300005539 Bacteria 2682
52 Ga0068853_100237971 3300005539 Bacteria 1668
53 Ga0068853_100285671 3300005539 Bacteria 1522
54 Ga0070686_100232548 3300005544 Bacteria 1338
55 Ga0070695_100002077 3300005545 Bacteria 11454
56 Ga0068855_100019115 3300005563 Bacteria 8232
57 Ga0068855_100086382 3300005563 Bacteria 3627
58 Ga0068855_100106925 3300005563 Bacteria 3215
59 Ga0068855_100146791 3300005563 Bacteria 2684
60 Ga0068855_100182485 3300005563 Bacteria 2372
61 Ga0068855_100259459 3300005563 Bacteria 1936
62 Ga0068857_100012328 3300005577 Bacteria 7439
63 Ga0068857_100145036 3300005577 Bacteria 2148
64 Ga0068854_100096751 3300005578 Bacteria 2206
65 Ga0068854_100145876 3300005578 Bacteria 1820
66 Ga0068856_100291580 3300005614 Bacteria 1648
67 Ga0068856_100452932 3300005614 Bacteria 1304
68 Ga0068852_100026999 3300005616 Bacteria 4674
69 Ga0068852_100062952 3300005616 Bacteria 3228
70 Ga0068852_100214973 3300005616 Bacteria 1826
71 Ga0068851_10138848 3300005834 Bacteria 1320
72 Ga0081455_10009167 3300005937 Bacteria 10200
73 Ga0081539_10001713 3300005985 Bacteria 35164
74 Ga0097621_100066741 3300006237 Bacteria 2964
75 Ga0075433_10034787 3300006852 Bacteria 4329
76 Ga0075434_100064169 3300006871 Bacteria 3656
77 Ga0075436_100238072 3300006914 Bacteria 1294
78 Ga0075435_100031371 3300007076 Bacteria 4186
79 Ga0105240_10012571 3300009093 Bacteria 11678
80 Ga0105240_10028648 3300009093 Bacteria 7270
81 Ga0105240_10039302 3300009093 Bacteria 6060
82 Ga0105240_10123070 3300009093 Bacteria 3121
83 Ga0105245_10105363 3300009098 Bacteria 2616
84 Ga0114129_10037271 3300009147 Bacteria 6865
85 Ga0105237_10010755 3300009545 Bacteria 9711
86 Ga0105237_10037181 3300009545 Bacteria 4922
87 Ga0105237_10066870 3300009545 Bacteria 3588
88 Ga0105239_10311323 3300010375 Bacteria 1775
89 Ga0157373_10033741 3300013100 Bacteria 3678
90 Ga0157371_10366447 3300013102 Bacteria 1051
91 Ga0157370_10015461 3300013104 Bacteria 7758
92 Ga0157370_10053079 3300013104 Bacteria 3867
93 Ga0157370_10096807 3300013104 Bacteria 2769
94 Ga0157369_10004746 3300013105 Bacteria 15971
95 Ga0157369_10054006 3300013105 Bacteria 4339
96 Ga0157369_10077676 3300013105 Bacteria 3558
97 Ga0157369_10092593 3300013105 Bacteria 3226
98 Ga0157369_10106706 3300013105 Bacteria 2980
99 Ga0157369_10131698 3300013105 Bacteria 2649
100 Ga0157369_10287118 3300013105 Bacteria 1713
101 Ga0157369_10364951 3300013105 Bacteria 1499
102 Ga0157372_10039262 3300013307 Bacteria 5224
103 Ga0157372_10106748 3300013307 Bacteria 3203
104 Ga0157372_10119300 3300013307 Bacteria 3028
105 Ga0157372_10195243 3300013307 Bacteria 2345
106 Ga0182008_10006546 3300014497 Bacteria 6504
107 Ga0182008_10151604 3300014497 Bacteria 1163
108 Ga0182008_10155702 3300014497 Bacteria 1148
109 Ga0182007_10031347 3300015262 Bacteria 1811
110 Ga0206356_11131303 3300020070 Unclassified 1681
111 Ga0206354_10742465 3300020081 Bacteria 1628
112 Ga0206353_10530754 3300020082 Bacteria 4835
113 Ga0206353_11635111 3300020082 Bacteria 2900
114 Ga0206353_11788935 3300020082 Bacteria 2944
115 Ga0206353_12060130 3300020082 Bacteria 10172
116 Ga0224712_10052494 3300022467 Bacteria 1592
117 Ga0224712_10092166 3300022467 Bacteria 1271
118 Ga0207685_10026685 3300025905 Bacteria 2012
119 Ga0207705_10009584 3300025909 Bacteria 7043
120 Ga0207705_10016750 3300025909 Bacteria 5249
121 Ga0207705_10024444 3300025909 Bacteria 4311
122 Ga0207705_10049913 3300025909 Bacteria 3012
123 Ga0207705_10181849 3300025909 Bacteria 1587
124 Ga0207684_10153496 3300025910 Bacteria 1982
125 Ga0207707_10003296 3300025912 Bacteria 14347
126 Ga0207707_10025710 3300025912 Bacteria 5150
127 Ga0207707_10027377 3300025912 Bacteria 4986
128 Ga0207707_10062545 3300025912 Bacteria 3239
129 Ga0207707_10075115 3300025912 Bacteria 2948
130 Ga0207707_10286371 3300025912 Bacteria 1426
131 Ga0207707_10418927 3300025912 Bacteria 1148
132 Ga0207695_10296058 3300025913 Bacteria 1510
133 Ga0207671_10037329 3300025914 Bacteria 3603
134 Ga0207693_10267609 3300025915 Bacteria 1339
135 Ga0207663_10014352 3300025916 Bacteria 4332
136 Ga0207660_10007635 3300025917 Bacteria 7003
137 Ga0207660_10010619 3300025917 Bacteria 5982
138 Ga0207660_10083689 3300025917 Bacteria 2350
139 Ga0207660_10230040 3300025917 Bacteria 1457
140 Ga0207657_10003299 3300025919 Bacteria 17249
141 Ga0207657_10006679 3300025919 Bacteria 11929
142 Ga0207657_10010898 3300025919 Bacteria 9048
143 Ga0207657_10012737 3300025919 Bacteria 8283
144 Ga0207657_10014656 3300025919 Bacteria 7639
145 Ga0207657_10021406 3300025919 Bacteria 6086
146 Ga0207657_10024166 3300025919 Bacteria 5639
147 Ga0207657_10043636 3300025919 Bacteria 3948
148 Ga0207657_10074227 3300025919 Bacteria 2873
149 Ga0207649_10115705 3300025920 Bacteria 1799
150 Ga0207649_10122487 3300025920 Bacteria 1755
151 Ga0207652_10018313 3300025921 Bacteria 5743
152 Ga0207652_10019532 3300025921 Bacteria 5574
153 Ga0207652_10037617 3300025921 Bacteria 4096
154 Ga0207652_10052842 3300025921 Bacteria 3489
155 Ga0207652_10061787 3300025921 Bacteria 3236
156 Ga0207652_10331065 3300025921 Bacteria 1375
157 Ga0207694_10028344 3300025924 Bacteria 4269
158 Ga0207694_10089691 3300025924 Bacteria 2425
159 Ga0207687_10078270 3300025927 Bacteria 2380
160 Ga0207664_10010527 3300025929 Bacteria 6532
161 Ga0207664_10062144 3300025929 Bacteria 2982
162 Ga0207664_10088670 3300025929 Bacteria 2532
163 Ga0207690_10018535 3300025932 Bacteria 4269
164 Ga0207690_10037739 3300025932 Bacteria 3139
165 Ga0207706_10074228 3300025933 Bacteria 2991
166 Ga0207661_10077030 3300025944 Bacteria 2741
167 Ga0207661_10135261 3300025944 Bacteria 2116
168 Ga0207661_10547164 3300025944 Bacteria 1060
169 Ga0207667_10022194 3300025949 Bacteria 7020
170 Ga0207667_10033061 3300025949 Bacteria 5565
171 Ga0207667_10107665 3300025949 Bacteria 2876
172 Ga0207667_10146216 3300025949 Bacteria 2433
173 Ga0207640_10208925 3300025981 Bacteria 1485
174 Ga0207639_10281594 3300026041 Bacteria 1462
175 Ga0207702_10078612 3300026078 Bacteria 2857
176 Ga0207702_10406515 3300026078 Bacteria 1314
177 Ga0207674_10004631 3300026116 Bacteria 16509
178 Ga0207674_10126290 3300026116 Bacteria 2524
179 Ga0207698_10046185 3300026142 Bacteria 3287
180 Ga0207698_10046464 3300026142 Bacteria 3279
181 Ga0307409_100339593 3300031995 Bacteria 1413
182 Ga0373926_0025891 3300035083 Bacteria 2050
183 Ga0373944_0023085 3300035089 Bacteria 1812
184 Ga0373945_0005276 3300035116 Bacteria 4134
185 Ga0373945_0081926 3300035116 Bacteria 1237
186 Ga0373943_0002287 3300035170 Bacteria 8699
187 Ga0373943_0004042 3300035170 Bacteria 6668
188 Ga0373946_0002567 3300035171 Bacteria 6422
189 Ga0373946_0003596 3300035171 Bacteria 5497
190 Ga0373946_0095686 3300035171 Bacteria 1323
191 Ga0373935_0031786 3300035692 Bacteria 3278
192 Ga0373935_0114813 3300035692 Bacteria 1792
193 Ga0373927_0078923 3300035695 Bacteria 2132
194 Ga0373947_0004748 3300035725 Bacteria 7969
195 Ga0373947_0005442 3300035725 Bacteria 7429
196 Ga0373947_0075336 3300035725 Bacteria 2077
197 Ga0373937_0101526 3300036401 Bacteria 2670
198 Ga0373925_0001127 3300037068 Bacteria 23700
199 Ga0373925_0005415 3300037068 Bacteria 9509
200 Ga0373925_0005844 3300037068 Bacteria 9128
201 Ga0395899_0011025 3300037312 Bacteria 6922
202 Ga0395899_0041792 3300037312 Bacteria 3424
203 Ga0395899_0043944 3300037312 Bacteria 3329
204 Ga0395899_0094731 3300037312 Bacteria 2160
205 Ga0395900_0020041 3300037418 Bacteria 6820
206 Ga0395900_0227782 3300037418 Bacteria 1876
207 Ga0395900_0232501 3300037418 Bacteria 1853
208 Ga0395900_0304912 3300037418 Bacteria 1577
209 Ga0395898_0066358 3300037466 Bacteria 3496
210 Ga0395898_0091332 3300037466 Bacteria 2930
211 Ga0395898_0162131 3300037466 Bacteria 2138
212 Ga0395898_0202168 3300037466 Bacteria 1896
213 Ga0395898_0270583 3300037466 Bacteria 1620
214 Ga0395905_0014186 3300037471 Bacteria 7612
215 Ga0395905_0086300 3300037471 Bacteria 2941
216 Ga0395905_0103821 3300037471 Bacteria 2668
217 Ga0395905_0146682 3300037471 Bacteria 2220
218 Ga0395905_0186748 3300037471 Bacteria 1945
219 Ga0395901_0000391 3300038443 Bacteria 52295
220 Ga0395901_0008421 3300038443 Bacteria 10423
221 Ga0395901_0046985 3300038443 Bacteria 4484
222 Ga0395901_0091650 3300038443 Bacteria 3181
223 Ga0395901_0162110 3300038443 Bacteria 2348
224 Ga0466963_0001625 3300044694 Bacteria 12229
225 Ga0466963_0002745 3300044694 Bacteria 9935
226 Ga0466963_0003584 3300044694 Bacteria 8921
227 Ga0466963_0004429 3300044694 Bacteria 8161
228 Ga0466963_0009998 3300044694 Bacteria 5734
229 Ga0466963_0013902 3300044694 Bacteria 4956
230 Ga0466963_0019442 3300044694 Bacteria 4261
231 Ga0466963_0030825 3300044694 Bacteria 3463
232 Ga0466963_0030906 3300044694 Bacteria 3459
233 Ga0466963_0033247 3300044694 Bacteria 3346
234 Ga0466963_0051400 3300044694 Bacteria 2732
235 Ga0466963_0081329 3300044694 Bacteria 2194
236 Ga0466964_0001229 3300044706 Bacteria 8692
237 Ga0466964_0001989 3300044706 Bacteria 7171
238 Ga0466964_0031695 3300044706 Bacteria 2098
239 Ga0466971_0011816 3300044719 Bacteria 3825
240 Ga0466971_0080155 3300044719 Bacteria 1488
241 Ga0466968_0029683 3300044735 Bacteria 2262
242 Ga0466968_0105211 3300044735 Bacteria 1264
243 Ga0466957_0004307 3300044842 Bacteria 7900
244 Ga0466957_0028741 3300044842 Bacteria 3312
245 Ga0466957_0046954 3300044842 Bacteria 2623
246 Ga0466957_0060257 3300044842 Bacteria 2327
247 Ga0466957_0333802 3300044842 Bacteria 1025
248 Ga0466960_0003711 3300044901 Bacteria 5902
249 Ga0466960_0013332 3300044901 Bacteria 3491
250 Ga0466960_0099191 3300044901 Bacteria 1497
251 Ga0466959_0039356 3300045049 Bacteria 3494
252 Ga0466959_0077279 3300045049 Bacteria 2403
253 Ga0466958_0003410 3300045836 Bacteria 8249
254 Ga0466958_0067158 3300045836 Bacteria 2190
255 Ga0466967_0000043 3300045976 Bacteria 45343
256 Ga0466967_0001358 3300045976 Bacteria 14064
257 Ga0466967_0002217 3300045976 Bacteria 11952
258 Ga0466967_0003135 3300045976 Bacteria 10648
259 Ga0466967_0007009 3300045976 Bacteria 8069
260 Ga0466967_0010076 3300045976 Bacteria 7064
261 Ga0466967_0017502 3300045976 Bacteria 5693
262 Ga0466967_0021639 3300045976 Bacteria 5229
263 Ga0466967_0022104 3300045976 Bacteria 5183
264 Ga0466967_0048350 3300045976 Bacteria 3713
265 Ga0466967_0059184 3300045976 Bacteria 3390
266 Ga0466967_0081705 3300045976 Bacteria 2919
267 Ga0466967_0086226 3300045976 Bacteria 2844
268 Ga0466967_0086814 3300045976 Bacteria 2835
269 Ga0466967_0102135 3300045976 Bacteria 2622
270 Ga0466967_0108930 3300045976 Bacteria 2542
271 Ga0466967_0109594 3300045976 Bacteria 2535
272 Ga0466967_0120225 3300045976 Bacteria 2426
273 Ga0466967_0125650 3300045976 Bacteria 2375
274 Ga0466967_0183913 3300045976 Bacteria 1972
275 Ga0466967_0192760 3300045976 Bacteria 1927
276 Ga0466967_0210358 3300045976 Bacteria 1844
277 Ga0466967_0308232 3300045976 Archaea 1524
278 Ga0466967_0729060 3300045976 Archaea 982
279 Ga0495592_0040013 3300046454 Bacteria 3519
280 Ga0495592_0098532 3300046454 Bacteria 2086
281 Ga0495629_0000079 3300046459 Bacteria 85673
282 Ga0495629_0072269 3300046459 Bacteria 2408
283 Ga0495641_0000806 3300046461 Bacteria 26604
284 Ga0495641_0041085 3300046461 Bacteria 2149
285 Ga0495651_0054568 3300046462 Bacteria 3072
286 Ga0495653_0012332 3300046463 Bacteria 6973
287 Ga0495653_0018226 3300046463 Bacteria 5704
288 Ga0495653_0091675 3300046463 Bacteria 2221
289 Ga0495580_0020907 3300046472 Bacteria 4835
290 Ga0495582_0000556 3300046473 Bacteria 20608
291 Ga0495582_0001234 3300046473 Bacteria 14403
292 Ga0495639_0000286 3300046475 Bacteria 24902
293 Ga0495662_0010889 3300046476 Bacteria 4448
294 Ga0495662_0026050 3300046476 Bacteria 2824
295 Ga0495662_0133418 3300046476 Bacteria 1221
296 Ga0495664_0033709 3300046477 Bacteria 3010
297 Ga0495664_0063654 3300046477 Bacteria 2198
298 Ga0495664_0085044 3300046477 Bacteria 1899
299 Ga0495664_0090594 3300046477 Bacteria 1838
300 Ga0495594_0011052 3300046499 Bacteria 4690
301 Ga0495594_0197448 3300046499 Bacteria 1147
302 Ga0495608_0055109 3300046511 Bacteria 2627
303 Ga0495618_0016731 3300046514 Bacteria 4491
304 Ga0495618_0038998 3300046514 Bacteria 2986
305 Ga0495618_0056740 3300046514 Bacteria 2479
306 Ga0495628_0042826 3300046516 Bacteria 3609
307 Ga0495630_0019945 3300046517 Bacteria 4936
308 Ga0495630_0170165 3300046517 Bacteria 1659
309 Ga0495666_0007503 3300046526 Bacteria 5457
310 Ga0495666_0051342 3300046526 Bacteria 1981
311 Ga0495666_0079193 3300046526 Bacteria 1556
312 Ga0495652_0068952 3300046529 Bacteria 2961
313 Ga0495652_0309306 3300046529 Bacteria 1145
314 Ga0495665_0000308 3300046531 Bacteria 24739
315 Ga0495665_0039833 3300046531 Bacteria 2502
316 Ga0495640_0004264 3300046533 Bacteria 11434
317 Ga0495640_0046890 3300046533 Bacteria 2991
318 Ga0495640_0061050 3300046533 Bacteria 2562
319 Ga0495586_0069485 3300046535 Bacteria 1922
320 Ga0495645_0040929 3300046543 Bacteria 3379
321 Ga0495667_0009057 3300046559 Bacteria 6764
322 Ga0495667_0012031 3300046559 Bacteria 5861
323 Ga0495667_0033268 3300046559 Bacteria 3451
324 Ga0495667_0104065 3300046559 Bacteria 1835
325 Ga0495667_0191401 3300046559 Bacteria 1311
326 Ga0495634_0042592 3300046642 Bacteria 3079
327 Ga0495634_0098495 3300046642 Bacteria 1891
328 Ga0495635_0031592 3300046663 Bacteria 3675
329 Ga0495635_0038144 3300046663 Bacteria 3326
330 Ga0495635_0042548 3300046663 Bacteria 3136
331 Ga0495635_0118276 3300046663 Bacteria 1808
332 Ga0495657_0018051 3300046675 Bacteria 5114
333 Ga0495657_0033410 3300046675 Bacteria 3582
334 Ga0495657_0076359 3300046675 Bacteria 2176
335 Ga0495657_0122943 3300046675 Bacteria 1633
336 Ga0495647_0001463 3300046681 Bacteria 7322
337 Ga0495658_0004330 3300046683 Bacteria 6992
338 Ga0495613_0005586 3300046689 Bacteria 9439
339 Ga0495613_0022224 3300046689 Bacteria 4727
340 Ga0495613_0043237 3300046689 Bacteria 3332
341 Ga0495613_0285928 3300046689 Bacteria 1144
342 Ga0495624_0000812 3300046690 Bacteria 24679
343 Ga0495581_0000733 3300047315 Bacteria 17360
344 Ga0495581_0009466 3300047315 Bacteria 5637
345 Ga0495604_0037895 3300047317 Bacteria 3794
346 Ga0495604_0039384 3300047317 Bacteria 3715
347 Ga0495674_0001328 3300047319 Bacteria 24089
348 Ga0495674_0040161 3300047319 Bacteria 4187
349 Ga0495676_0004417 3300047321 Bacteria 12857
350 Ga0495676_0033374 3300047321 Bacteria 4335
351 Ga0495680_0014279 3300047322 Bacteria 6885
352 Ga0495680_0018063 3300047322 Bacteria 6001
353 Ga0495680_0038485 3300047322 Bacteria 3821
354 Ga0495680_0091552 3300047322 Bacteria 2279
355 Ga0495680_0150921 3300047322 Bacteria 1694
356 Ga0495675_0046581 3300047444 Bacteria 2760
357 Ga0495684_0017585 3300047471 Bacteria 5504
358 Ga0495684_0023542 3300047471 Bacteria 4735
359 Ga0495684_0074042 3300047471 Bacteria 2587
360 Ga0495593_0002864 3300047673 Bacteria 10398
361 Ga0495602_0093359 3300048088 Bacteria 2490
362 Ga0495614_0003772 3300048089 Bacteria 6807
363 Ga0495614_0019061 3300048089 Bacteria 2970
364 Ga0496100_0074580 3300048903 Bacteria 2273
365 Ga0496100_0090083 3300048903 Bacteria 2091
366 Ga0496101_0005260 3300048904 Bacteria 8238
367 Ga0496101_0045777 3300048904 Bacteria 3135
368 Ga0496101_0463551 3300048904 Bacteria 1000
369 Ga0496102_0001563 3300048905 Bacteria 20213
370 Ga0496102_0009582 3300048905 Bacteria 8329
371 Ga0496102_0047640 3300048905 Bacteria 3896
372 Ga0496102_0064927 3300048905 Bacteria 3344
373 Ga0496103_0011838 3300048906 Bacteria 5177
374 Ga0496103_0058237 3300048906 Bacteria 2400
375 Ga0496103_0142327 3300048906 Bacteria 1534
376 Ga0496104_0003556 3300048907 Bacteria 13445
377 Ga0496104_0249374 3300048907 Bacteria 1688
378 Ga0496105_0000475 3300048908 Bacteria 26269
379 Ga0496105_0127026 3300048908 Bacteria 2102
380 Ga0496106_0002790 3300048909 Bacteria 12948
381 Ga0496106_0005806 3300048909 Bacteria 9124
382 Ga0496107_0000803 3300048910 Bacteria 18222
383 Ga0496107_0012521 3300048910 Bacteria 5921
384 Ga0496107_0023687 3300048910 Bacteria 4339
385 Ga0496108_0000549 3300048911 Bacteria 29334
386 Ga0496109_0000479 3300048912 Bacteria 34013
387 Ga0496109_0062463 3300048912 Bacteria 3406
388 Ga0496109_0272430 3300048912 Bacteria 1595
389 Ga0496110_0007464 3300048913 Bacteria 8738
390 Ga0496110_0022224 3300048913 Bacteria 5383
391 Ga0496110_0095406 3300048913 Bacteria 2664
392 Ga0496111_0009953 3300048914 Bacteria 6359
393 Ga0496111_0020334 3300048914 Bacteria 4621
394 Ga0496112_0026437 3300048915 Bacteria 5584
395 Ga0496112_0100105 3300048915 Bacteria 2868
396 Ga0496113_0241822 3300048916 Bacteria 1440
397 Ga0496114_0003391 3300048917 Bacteria 12234
398 Ga0496114_0005669 3300048917 Bacteria 9792
399 Ga0496114_0011698 3300048917 Bacteria 7017
400 Ga0496114_0089681 3300048917 Bacteria 2609
401 Ga0496115_0001916 3300048918 Bacteria 14859
402 Ga0496115_0001920 3300048918 Bacteria 14839
403 Ga0496115_0004495 3300048918 Bacteria 10092
404 Ga0501036_0035581 3300049572 Bacteria 4213
405 Ga0501037_0132352 3300049573 Bacteria 1788
406 Ga0501039_0032439 3300049575 Bacteria 4027
407 Ga0501040_0009057 3300049576 Bacteria 6476
408 Ga0501042_0043363 3300049578 Bacteria 3203
409 Ga0501067_0001498 3300049583 Bacteria 12720
410 Ga0501067_0009910 3300049583 Bacteria 5277
411 Ga0501068_0016947 3300049584 Bacteria 4209
412 Ga0501069_0006332 3300049585 Bacteria 6189
413 Ga0501069_0009939 3300049585 Bacteria 5031
414 Ga0501069_0025146 3300049585 Bacteria 3253
415 Ga0501070_0000318 3300049586 Bacteria 43769
416 Ga0501070_0230110 3300049586 Bacteria 1519
417 Ga0501071_0127511 3300049587 Bacteria 1889
418 Ga0501072_0006983 3300049588 Bacteria 8571
419 nmdc:mga05p37_31533_c1 3300050507 Bacteria 6474
420 nmdc:mga0n895_10309_c1 3300050512 Bacteria 8242
421 nmdc:mga0rr50_11884_c1 3300050513 Bacteria 5595
422 nmdc:mga0a205_140791_c1 3300050515 Bacteria 2312
423 nmdc:mga0a205_40863_c1 3300050515 Bacteria 4466
424 Ga0495601_0022426 3300053077 Bacteria 3875
425 Ga0495601_0061371 3300053077 Bacteria 2386
426 Ga0495601_0251714 3300053077 Bacteria 1153
427 Ga0495612_0014422 3300053078 Bacteria 3178
428 Ga0495595_0024775 3300053084 Bacteria 2652
429 Ga0495595_0036809 3300053084 Bacteria 2222
430 Ga0495619_0007149 3300053085 Bacteria 7070
431 Ga0495619_0012540 3300053085 Bacteria 5338
432 Ga0495619_0055561 3300053085 Bacteria 2622
433 Ga0501082_0026022 3300060353 Bacteria 5043
434 Ga0501082_0350684 3300060353 Bacteria 1287
435 Ga0466962_0021115 3300061719 Bacteria 3128
436 Ga0466962_0031354 3300061719 Bacteria 2545
437 Ga0466962_0168622 3300061719 Bacteria 1066
438 Ga0070712_100252029
439 Ga0070658_10014053
440 Ga0070658_10027399
441 Ga0070683_100001420
442 Ga0070683_100134428
443 Ga0070683_100292368
444 Ga0070680_100048695
445 Ga0070680_100090174
446 Ga0070682_100003040
447 Ga0070660_100000957
448 Ga0070660_100003672
449 Ga0070660_100006611
450 Ga0070660_100022877
451 Ga0070660_100042371
452 Ga0070660_100122533
453 Ga0070661_100111215
454 Ga0070661_100123166
455 Ga0070661_100151981
456 Ga0070692_10108583
457 Ga0070671_100104055
458 Ga0070659_100003822
459 Ga0070659_100054573
460 Ga0070659_100074383
461 Ga0070714_100029179
462 Ga0070714_100036338
463 Ga0070714_100108473
464 Ga0070714_100128567
465 Ga0070708_100134099
466 Ga0070662_100081641
467 Ga0070681_10004096
468 Ga0070681_10005104
469 Ga0070681_10010798
470 Ga0070681_10026822
471 Ga0070681_10038536
472 Ga0070681_10039674
473 Ga0070681_10076101
474 Ga0070681_10160517
475 Ga0070681_10250591
476 Ga0070698_100022652
477 Ga0070679_100003916
478 Ga0070679_100031030
479 Ga0070679_100055896
480 Ga0070679_100060839
481 Ga0070679_100066577
482 Ga0070679_100090701
483 Ga0070679_100113684
484 Ga0070679_100243223
485 Ga0070679_100425339
486 Ga0070684_100004961
487 Ga0070684_100077622
488 Ga0068853_100090978
489 Ga0068853_100237971
490 Ga0068853_100285671
491 Ga0070686_100232548
492 Ga0070695_100002077
493 Ga0068855_100019115
494 Ga0068855_100086382
495 Ga0068855_100106925
496 Ga0068855_100146791
497 Ga0068855_100182485
498 Ga0068855_100259459
499 Ga0068857_100012328
500 Ga0068857_100145036
501 Ga0068854_100096751
502 Ga0068854_100145876
503 Ga0068856_100291580
504 Ga0068856_100452932
505 Ga0068852_100026999
506 Ga0068852_100062952
507 Ga0068852_100214973
508 Ga0068851_10138848
509 Ga0081455_10009167
510 Ga0081539_10001713
511 Ga0097621_100066741
512 Ga0075433_10034787
513 Ga0075434_100064169
514 Ga0075436_100238072
515 Ga0075435_100031371
516 Ga0105240_10012571
517 Ga0105240_10028648
518 Ga0105240_10039302
519 Ga0105240_10123070
520 Ga0105245_10105363
521 Ga0114129_10037271
522 Ga0105237_10010755
523 Ga0105237_10037181
524 Ga0105237_10066870
525 Ga0105239_10311323
526 Ga0157373_10033741
527 Ga0157371_10366447
528 Ga0157370_10015461
529 Ga0157370_10053079
530 Ga0157370_10096807
531 Ga0157369_10004746
532 Ga0157369_10054006
533 Ga0157369_10077676
534 Ga0157369_10092593
535 Ga0157369_10106706
536 Ga0157369_10131698
537 Ga0157369_10287118
538 Ga0157369_10364951
539 Ga0157372_10039262
540 Ga0157372_10106748
541 Ga0157372_10119300
542 Ga0157372_10195243
543 Ga0182008_10006546
544 Ga0182008_10151604
545 Ga0182008_10155702
546 Ga0182007_10031347
547 Ga0206356_11131303
548 Ga0206354_10742465
549 Ga0206353_10530754
550 Ga0206353_11635111
551 Ga0206353_11788935
552 Ga0206353_12060130
553 Ga0224712_10052494
554 Ga0224712_10092166
555 Ga0207685_10026685
556 Ga0207705_10009584
557 Ga0207705_10016750
558 Ga0207705_10024444
559 Ga0207705_10049913
560 Ga0207705_10181849
561 Ga0207684_10153496
562 Ga0207707_10003296
563 Ga0207707_10025710
564 Ga0207707_10027377
565 Ga0207707_10062545
566 Ga0207707_10075115
567 Ga0207707_10286371
568 Ga0207707_10418927
569 Ga0207695_10296058
570 Ga0207671_10037329
571 Ga0207693_10267609
572 Ga0207663_10014352
573 Ga0207660_10007635
574 Ga0207660_10010619
575 Ga0207660_10083689
576 Ga0207660_10230040
577 Ga0207657_10003299
578 Ga0207657_10006679
579 Ga0207657_10010898
580 Ga0207657_10012737
581 Ga0207657_10014656
582 Ga0207657_10021406
583 Ga0207657_10024166
584 Ga0207657_10043636
585 Ga0207657_10074227
586 Ga0207649_10115705
587 Ga0207649_10122487
588 Ga0207652_10018313
589 Ga0207652_10019532
590 Ga0207652_10037617
591 Ga0207652_10052842
592 Ga0207652_10061787
593 Ga0207652_10331065
594 Ga0207694_10028344
595 Ga0207694_10089691
596 Ga0207687_10078270
597 Ga0207664_10010527
598 Ga0207664_10062144
599 Ga0207664_10088670
600 Ga0207690_10018535
601 Ga0207690_10037739
602 Ga0207706_10074228
603 Ga0207661_10077030
604 Ga0207661_10135261
605 Ga0207661_10547164
606 Ga0207667_10022194
607 Ga0207667_10033061
608 Ga0207667_10107665
609 Ga0207667_10146216
610 Ga0207640_10208925
611 Ga0207639_10281594
612 Ga0207702_10078612
613 Ga0207702_10406515
614 Ga0207674_10004631
615 Ga0207674_10126290
616 Ga0207698_10046185
617 Ga0207698_10046464
618 Ga0307409_100339593
619 Ga0373926_0025891
620 Ga0373944_0023085
621 Ga0373945_0005276
622 Ga0373945_0081926
623 Ga0373943_0002287
624 Ga0373943_0004042
625 Ga0373946_0002567
626 Ga0373946_0003596
627 Ga0373946_0095686
628 Ga0373935_0031786
629 Ga0373935_0114813
630 Ga0373927_0078923
631 Ga0373947_0004748
632 Ga0373947_0005442
633 Ga0373947_0075336
634 Ga0373937_0101526
635 Ga0373925_0001127
636 Ga0373925_0005415
637 Ga0373925_0005844
638 Ga0395899_0011025
639 Ga0395899_0041792
640 Ga0395899_0043944
641 Ga0395899_0094731
642 Ga0395900_0020041
643 Ga0395900_0227782
644 Ga0395900_0232501
645 Ga0395900_0304912
646 Ga0395898_0066358
647 Ga0395898_0091332
648 Ga0395898_0162131
649 Ga0395898_0202168
650 Ga0395898_0270583
651 Ga0395905_0014186
652 Ga0395905_0086300
653 Ga0395905_0103821
654 Ga0395905_0146682
655 Ga0395905_0186748
656 Ga0395901_0000391
657 Ga0395901_0008421
658 Ga0395901_0046985
659 Ga0395901_0091650
660 Ga0395901_0162110
661 Ga0466963_0001625
662 Ga0466963_0002745
663 Ga0466963_0003584
664 Ga0466963_0004429
665 Ga0466963_0009998
666 Ga0466963_0013902
667 Ga0466963_0019442
668 Ga0466963_0030825
669 Ga0466963_0030906
670 Ga0466963_0033247
671 Ga0466963_0051400
672 Ga0466963_0081329
673 Ga0466964_0001229
674 Ga0466964_0001989
675 Ga0466964_0031695
676 Ga0466971_0011816
677 Ga0466971_0080155
678 Ga0466968_0029683
679 Ga0466968_0105211
680 Ga0466957_0004307
681 Ga0466957_0028741
682 Ga0466957_0046954
683 Ga0466957_0060257
684 Ga0466957_0333802
685 Ga0466960_0003711
686 Ga0466960_0013332
687 Ga0466960_0099191
688 Ga0466959_0039356
689 Ga0466959_0077279
690 Ga0466958_0003410
691 Ga0466958_0067158
692 Ga0466967_0000043
693 Ga0466967_0001358
694 Ga0466967_0002217
695 Ga0466967_0003135
696 Ga0466967_0007009
697 Ga0466967_0010076
698 Ga0466967_0017502
699 Ga0466967_0021639
700 Ga0466967_0022104
701 Ga0466967_0048350
702 Ga0466967_0059184
703 Ga0466967_0081705
704 Ga0466967_0086226
705 Ga0466967_0086814
706 Ga0466967_0102135
707 Ga0466967_0108930
708 Ga0466967_0109594
709 Ga0466967_0120225
710 Ga0466967_0125650
711 Ga0466967_0183913
712 Ga0466967_0192760
713 Ga0466967_0210358
714 Ga0466967_0308232
715 Ga0466967_0729060
716 Ga0495592_0040013
717 Ga0495592_0098532
718 Ga0495629_0000079
719 Ga0495629_0072269
720 Ga0495641_0000806
721 Ga0495641_0041085
722 Ga0495651_0054568
723 Ga0495653_0012332
724 Ga0495653_0018226
725 Ga0495653_0091675
726 Ga0495580_0020907
727 Ga0495582_0000556
728 Ga0495582_0001234
729 Ga0495639_0000286
730 Ga0495662_0010889
731 Ga0495662_0026050
732 Ga0495662_0133418
733 Ga0495664_0033709
734 Ga0495664_0063654
735 Ga0495664_0085044
736 Ga0495664_0090594
737 Ga0495594_0011052
738 Ga0495594_0197448
739 Ga0495608_0055109
740 Ga0495618_0016731
741 Ga0495618_0038998
742 Ga0495618_0056740
743 Ga0495628_0042826
744 Ga0495630_0019945
745 Ga0495630_0170165
746 Ga0495666_0007503
747 Ga0495666_0051342
748 Ga0495666_0079193
749 Ga0495652_0068952
750 Ga0495652_0309306
751 Ga0495665_0000308
752 Ga0495665_0039833
753 Ga0495640_0004264
754 Ga0495640_0046890
755 Ga0495640_0061050
756 Ga0495586_0069485
757 Ga0495645_0040929
758 Ga0495667_0009057
759 Ga0495667_0012031
760 Ga0495667_0033268
761 Ga0495667_0104065
762 Ga0495667_0191401
763 Ga0495634_0042592
764 Ga0495634_0098495
765 Ga0495635_0031592
766 Ga0495635_0038144
767 Ga0495635_0042548
768 Ga0495635_0118276
769 Ga0495657_0018051
770 Ga0495657_0033410
771 Ga0495657_0076359
772 Ga0495657_0122943
773 Ga0495647_0001463
774 Ga0495658_0004330
775 Ga0495613_0005586
776 Ga0495613_0022224
777 Ga0495613_0043237
778 Ga0495613_0285928
779 Ga0495624_0000812
780 Ga0495581_0000733
781 Ga0495581_0009466
782 Ga0495604_0037895
783 Ga0495604_0039384
784 Ga0495674_0001328
785 Ga0495674_0040161
786 Ga0495676_0004417
787 Ga0495676_0033374
788 Ga0495680_0014279
789 Ga0495680_0018063
790 Ga0495680_0038485
791 Ga0495680_0091552
792 Ga0495680_0150921
793 Ga0495675_0046581
794 Ga0495684_0017585
795 Ga0495684_0023542
796 Ga0495684_0074042
797 Ga0495593_0002864
798 Ga0495602_0093359
799 Ga0495614_0003772
800 Ga0495614_0019061
801 Ga0496100_0074580
802 Ga0496100_0090083
803 Ga0496101_0005260
804 Ga0496101_0045777
805 Ga0496101_0463551
806 Ga0496102_0001563
807 Ga0496102_0009582
808 Ga0496102_0047640
809 Ga0496102_0064927
810 Ga0496103_0011838
811 Ga0496103_0058237
812 Ga0496103_0142327
813 Ga0496104_0003556
814 Ga0496104_0249374
815 Ga0496105_0000475
816 Ga0496105_0127026
817 Ga0496106_0002790
818 Ga0496106_0005806
819 Ga0496107_0000803
820 Ga0496107_0012521
821 Ga0496107_0023687
822 Ga0496108_0000549
823 Ga0496109_0000479
824 Ga0496109_0062463
825 Ga0496109_0272430
826 Ga0496110_0007464
827 Ga0496110_0022224
828 Ga0496110_0095406
829 Ga0496111_0009953
830 Ga0496111_0020334
831 Ga0496112_0026437
832 Ga0496112_0100105
833 Ga0496113_0241822
834 Ga0496114_0003391
835 Ga0496114_0005669
836 Ga0496114_0011698
837 Ga0496114_0089681
838 Ga0496115_0001916
839 Ga0496115_0001920
840 Ga0496115_0004495
841 Ga0501036_0035581
842 Ga0501037_0132352
843 Ga0501039_0032439
844 Ga0501040_0009057
845 Ga0501042_0043363
846 Ga0501067_0001498
847 Ga0501067_0009910
848 Ga0501068_0016947
849 Ga0501069_0006332
850 Ga0501069_0009939
851 Ga0501069_0025146
852 Ga0501070_0000318
853 Ga0501070_0230110
854 Ga0501071_0127511
855 Ga0501072_0006983
856 nmdc:mga05p37_31533_c1
857 nmdc:mga0n895_10309_c1
858 nmdc:mga0rr50_11884_c1
859 nmdc:mga0a205_140791_c1
860 nmdc:mga0a205_40863_c1
861 Ga0495601_0022426
862 Ga0495601_0061371
863 Ga0495601_0251714
864 Ga0495612_0014422
865 Ga0495595_0024775
866 Ga0495595_0036809
867 Ga0495619_0007149
868 Ga0495619_0012540
869 Ga0495619_0055561
870 Ga0501082_0026022
871 Ga0501082_0350684
872 Ga0466962_0021115
873 Ga0466962_0031354
874 Ga0466962_0168622

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

104

312

0.97

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

1

101

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.765 91 307
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7309 91 307
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7214 90 307
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.6925 90 307
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.6753 66 309
ID Description Score Start End Superfamily
af_P75798_87_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8674 87 307 1.10.3720.10
af_Q2G1F7_265_478_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8605 90 303 1.10.3720.10
af_P75798_87_300_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.86 87 307 1.10.3720.10
af_P0AGH3_48_312_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8498 70 308 1.10.3720.10
af_I6YGV9_86_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8456 85 307 1.10.3720.10
ID Description Score Start End GO Terms
AF-C6C521-F1-model_v4 Binding-protein-dependent transport systems inner membrane component 0.9107 1 311 GO:0005886
GO:0071916
AF-A0A0K2VTK8-F1-model_v4 Putative peptide transporter permease subunit: membrane component of ABC superfamily 0.9057 1 311 GO:0005886
GO:0071916
AF-A0A7V9BQ96-F1-model_v4 ABC transporter permease 0.904 1 310 GO:0005886
GO:0055085
AF-A0A7V7DZH0-F1-model_v4 ABC transporter permease 0.9031 1 311 GO:0005886
GO:0055085
AF-A0A285QT51-F1-model_v4 Peptide/nickel transport system permease protein 0.9031 1 311 GO:0005886
GO:0055085

Map