F443646

General Info

Members Datasets Scaffolds Average Seq Length
436 207 872 283

Family's Representative Sequence

Representative Sequence 3300050508|nmdc:mga09592_125771_c1|nmdc:mga09592_125771_c1_16_1017
Length 333
Sequence LLRRRRLREKADGQQNACSGNQSVHLSSANKHRATASSQQPAADHDIFRPMTSEHLSRRSFLGLTAALPFAAAAFASAAKKVPIGLELYSVRDDLAKDLLGTVTAVGKMGYEVVEFYSPYLSWTPDMAKDVRKRMDDVGLKCHSTHNGGPSFTDDGLKKAIELNQIIGSTNIIMASAPRATGIDSWKKVADQLTAISEKLKPLKMATGYHNHQVEWRPLEGQRPMDVIAAGTPKDVVLQFDVGTCVEVGADPIAWINANPGRIKSVHCKDWAAGKGYAVAFGEGDAPWKKIFDGVESTGGVEYYLIEQETGGPDGALAMVKHCLENYRKIHGV

Samples

Sample ID Description Type Environment
1 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
82 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
131 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
137 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
177 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
178 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
195 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.1
Metatranscriptomes 3.9
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 4.82
Rhizosphere 94.27
Stem 0
Stem Tuber 0
Unclassified 22.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga09592_125771_c1 3300050508 Bacteria 2203
2 MBSR1b_contig_9102745 2162886012 Bacteria 1293
3 Ga0058861_10188922 3300004800 Unclassified 1952
4 Ga0058862_12804635 3300004803 Unclassified 1942
5 Ga0065712_10001071 3300005290 Bacteria 7095
6 Ga0065712_10188665 3300005290 Bacteria 1158
7 Ga0065715_10120689 3300005293 Bacteria 2227
8 Ga0065715_10211180 3300005293 Unclassified 1313
9 Ga0065715_10289300 3300005293 Bacteria 1067
10 Ga0065715_10313170 3300005293 Bacteria 1016
11 Ga0070683_100027263 3300005329 Bacteria 5150
12 Ga0070683_100030697 3300005329 Bacteria 4882
13 Ga0070690_100008277 3300005330 Bacteria 5982
14 Ga0070690_100064542 3300005330 Bacteria 2366
15 Ga0070690_100173059 3300005330 Unclassified 1487
16 Ga0070670_100005618 3300005331 Bacteria 10583
17 Ga0070670_100008151 3300005331 Bacteria 8920
18 Ga0070670_100011218 3300005331 Bacteria 7660
19 Ga0070670_100013564 3300005331 Bacteria 6984
20 Ga0070670_100040437 3300005331 Bacteria 4009
21 Ga0070670_100042649 3300005331 Bacteria 3901
22 Ga0068869_100209883 3300005334 Unclassified 1539
23 Ga0070666_10014911 3300005335 Bacteria 4950
24 Ga0070666_10265641 3300005335 Bacteria 1217
25 Ga0068868_100004111 3300005338 Bacteria 10166
26 Ga0070689_100063613 3300005340 Bacteria 2871
27 Ga0070689_100094945 3300005340 Bacteria 2355
28 Ga0070689_100140921 3300005340 Unclassified 1939
29 Ga0070689_100360580 3300005340 Bacteria 1221
30 Ga0070661_100032361 3300005344 Bacteria 3786
31 Ga0070661_100046331 3300005344 Bacteria 3181
32 Ga0070669_100032029 3300005353 Unclassified 3797
33 Ga0070669_100306227 3300005353 Unclassified 1279
34 Ga0070669_100389092 3300005353 Bacteria 1139
35 Ga0070675_100000232 3300005354 Bacteria 35813
36 Ga0070675_100007529 3300005354 Bacteria 8415
37 Ga0070675_100050078 3300005354 Bacteria 3430
38 Ga0070675_100440413 3300005354 Unclassified 1167
39 Ga0070671_100080932 3300005355 Bacteria 2716
40 Ga0070671_100143922 3300005355 Unclassified 2012
41 Ga0070673_100015346 3300005364 Bacteria 5377
42 Ga0070673_100058888 3300005364 Bacteria 3039
43 Ga0070688_100021921 3300005365 Bacteria 3736
44 Ga0070667_100002532 3300005367 Bacteria 15929
45 Ga0070667_100021577 3300005367 Bacteria 5345
46 Ga0070667_100030194 3300005367 Bacteria 4520
47 Ga0070667_100160450 3300005367 Unclassified 1980
48 Ga0070667_100228711 3300005367 Unclassified 1658
49 Ga0070709_10031520 3300005434 Bacteria 3189
50 Ga0070711_100039219 3300005439 Bacteria 3189
51 Ga0070705_100146657 3300005440 Bacteria 1560
52 Ga0070694_100171125 3300005444 Bacteria 1600
53 Ga0070663_100253208 3300005455 Unclassified 1394
54 Ga0070678_100256687 3300005456 Unclassified 1468
55 Ga0070678_100307778 3300005456 Bacteria 1349
56 Ga0070662_100025285 3300005457 Bacteria 4098
57 Ga0070681_10056522 3300005458 Unclassified 3905
58 Ga0068867_100275310 3300005459 Bacteria 1378
59 Ga0070698_100076733 3300005471 Viruses 3343
60 Ga0070699_100019411 3300005518 Bacteria 5852
61 Ga0070679_100065808 3300005530 Unclassified 3612
62 Ga0070684_100000606 3300005535 Bacteria 24736
63 Ga0070672_100070361 3300005543 Bacteria 2780
64 Ga0070672_100127039 3300005543 Bacteria 2092
65 Ga0070672_100281877 3300005543 Unclassified 1405
66 Ga0070686_100218798 3300005544 Bacteria 1375
67 Ga0070704_100192856 3300005549 Bacteria 1639
68 Ga0070704_100543471 3300005549 Unclassified 1014
69 Ga0070664_100000978 3300005564 Bacteria 22369
70 Ga0070664_100002528 3300005564 Bacteria 14753
71 Ga0070664_100367836 3300005564 Bacteria 1310
72 Ga0068857_100033846 3300005577 Bacteria 4520
73 Ga0068857_100052931 3300005577 Bacteria 3601
74 Ga0068854_100379880 3300005578 Bacteria 1164
75 Ga0068859_100000993 3300005617 Bacteria 29036
76 Ga0068859_100006415 3300005617 Bacteria 11934
77 Ga0068864_100012100 3300005618 Bacteria 7128
78 Ga0068864_100316455 3300005618 Bacteria 1465
79 Ga0068864_100348219 3300005618 Unclassified 1397
80 Ga0068861_100145537 3300005719 Unclassified 1939
81 Ga0068861_100409828 3300005719 Unclassified 1205
82 Ga0068851_10276322 3300005834 Unclassified 959
83 Ga0068863_100018228 3300005841 Bacteria 6722
84 Ga0068863_100055566 3300005841 Bacteria 3749
85 Ga0068863_100076607 3300005841 Unclassified 3164
86 Ga0068863_100081995 3300005841 Bacteria 3056
87 Ga0068863_100093067 3300005841 Bacteria 2861
88 Ga0068863_100110930 3300005841 Bacteria 2613
89 Ga0068858_100040802 3300005842 Bacteria 4305
90 Ga0068858_100253536 3300005842 Bacteria 1672
91 Ga0068860_100006146 3300005843 Bacteria 12077
92 Ga0068860_100166339 3300005843 Unclassified 2129
93 Ga0068860_100372665 3300005843 Bacteria 1408
94 Ga0068860_100487211 3300005843 Bacteria 1229
95 Ga0081455_10198631 3300005937 Unclassified 1503
96 Ga0070715_10119087 3300006163 Unclassified 1256
97 Ga0070715_10182055 3300006163 Bacteria 1054
98 Ga0097621_100004111 3300006237 Bacteria 10092
99 Ga0097621_100005249 3300006237 Bacteria 9115
100 Ga0097621_100079053 3300006237 Bacteria 2733
101 Ga0097621_100174080 3300006237 Bacteria 1857
102 Ga0097621_100262236 3300006237 Bacteria 1516
103 Ga0068871_100009441 3300006358 Bacteria 7069
104 Ga0068871_100016009 3300006358 Bacteria 5634
105 Ga0068871_100213668 3300006358 Bacteria 1669
106 Ga0075431_100007779 3300006847 Bacteria 10673
107 Ga0075433_10029558 3300006852 Bacteria 4671
108 Ga0075434_100053243 3300006871 Unclassified 4022
109 Ga0075429_100033438 3300006880 Bacteria 4468
110 Ga0068865_100010963 3300006881 Bacteria 5657
111 Ga0068865_100034698 3300006881 Bacteria 3387
112 Ga0068865_100036960 3300006881 Bacteria 3295
113 Ga0068865_100127204 3300006881 Unclassified 1904
114 Ga0068865_100195175 3300006881 Bacteria 1568
115 Ga0097620_100000993 3300006931 Bacteria 29036
116 Ga0097620_100006415 3300006931 Bacteria 11934
117 Ga0075435_100042922 3300007076 Bacteria 3619
118 Ga0075435_100332680 3300007076 Bacteria 1301
119 Ga0105240_10542160 3300009093 Unclassified 1288
120 Ga0105240_10572029 3300009093 Unclassified 1247
121 Ga0105240_10917644 3300009093 Unclassified 941
122 Ga0111539_10010134 3300009094 Bacteria 11876
123 Ga0111539_10021795 3300009094 Bacteria 7877
124 Ga0111539_10036731 3300009094 Bacteria 5920
125 Ga0111539_10095938 3300009094 Bacteria 3483
126 Ga0111539_10495687 3300009094 Unclassified 1423
127 Ga0114129_10074365 3300009147 Bacteria 4733
128 Ga0105241_10016232 3300009174 Bacteria 5457
129 Ga0105242_10015035 3300009176 Bacteria 6001
130 Ga0105242_10088569 3300009176 Bacteria 2601
131 Ga0105248_10000562 3300009177 Bacteria 42094
132 Ga0105248_10034259 3300009177 Bacteria 5677
133 Ga0105248_10042085 3300009177 Bacteria 5123
134 Ga0105238_10263814 3300009551 Bacteria 1702
135 Ga0105238_10789673 3300009551 Unclassified 965
136 Ga0105249_10023940 3300009553 Bacteria 5485
137 Ga0105249_10088131 3300009553 Bacteria 2898
138 Ga0105246_10188628 3300011119 Bacteria 1594
139 Ga0157370_10044786 3300013104 Unclassified 4249
140 Ga0157369_10046094 3300013105 Bacteria 4739
141 Ga0157369_10450297 3300013105 Unclassified 1333
142 Ga0157374_10024093 3300013296 Bacteria 5452
143 Ga0157374_10057298 3300013296 Bacteria 3639
144 Ga0163162_10000995 3300013306 Bacteria 26367
145 Ga0163162_10001327 3300013306 Bacteria 23119
146 Ga0163162_10284416 3300013306 Bacteria 1785
147 Ga0163162_10310613 3300013306 Bacteria 1709
148 Ga0157372_10052227 3300013307 Unclassified 4551
149 Ga0157375_10002820 3300013308 Bacteria 15046
150 Ga0157375_10010625 3300013308 Bacteria 8106
151 Ga0157375_10019866 3300013308 Bacteria 6124
152 Ga0157375_10299058 3300013308 Unclassified 1773
153 Ga0157375_10339989 3300013308 Bacteria 1666
154 Ga0157375_10855338 3300013308 Unclassified 1056
155 Ga0163163_10000798 3300014325 Bacteria 26698
156 Ga0163163_10007015 3300014325 Bacteria 9898
157 Ga0163163_10068605 3300014325 Bacteria 3528
158 Ga0163163_10098629 3300014325 Bacteria 2943
159 Ga0163163_10230236 3300014325 Unclassified 1902
160 Ga0163163_10411619 3300014325 Bacteria 1411
161 Ga0157377_10053626 3300014745 Bacteria 2280
162 Ga0157377_10107910 3300014745 Bacteria 1669
163 Ga0157379_10000277 3300014968 Bacteria 40463
164 Ga0157379_10079053 3300014968 Bacteria 2946
165 Ga0157376_10204902 3300014969 Bacteria 1817
166 Ga0163161_10003256 3300017792 Bacteria 11412
167 Ga0197907_10046170 3300020069 Bacteria 1411
168 Ga0206356_10364981 3300020070 Unclassified 1775
169 Ga0206349_1245701 3300020075 Unclassified 1721
170 Ga0206355_1450182 3300020076 Unclassified 2059
171 Ga0206355_1487018 3300020076 Unclassified 1855
172 Ga0206351_10365821 3300020077 Unclassified 1842
173 Ga0206352_10024653 3300020078 Unclassified 1784
174 Ga0206352_11103015 3300020078 Unclassified 1693
175 Ga0206350_10318929 3300020080 Bacteria 2175
176 Ga0206350_11158603 3300020080 Bacteria 1473
177 Ga0206354_10707588 3300020081 Unclassified 1608
178 Ga0154015_1074199 3300020610 Unclassified 1660
179 Ga0224712_10027921 3300022467 Unclassified 2012
180 Ga0224712_10035649 3300022467 Unclassified 1838
181 Ga0224712_10038508 3300022467 Unclassified 1786
182 Ga0207697_10042455 3300025315 Bacteria 1869
183 Ga0207642_10053058 3300025899 Bacteria 1843
184 Ga0207680_10009566 3300025903 Bacteria 4813
185 Ga0207680_10317455 3300025903 Bacteria 1089
186 Ga0207645_10052784 3300025907 Bacteria 2598
187 Ga0207649_10054774 3300025920 Bacteria 2484
188 Ga0207649_10170504 3300025920 Unclassified 1516
189 Ga0207681_10068056 3300025923 Unclassified 2471
190 Ga0207650_10003931 3300025925 Bacteria 10169
191 Ga0207650_10007716 3300025925 Bacteria 7332
192 Ga0207650_10015455 3300025925 Bacteria 5316
193 Ga0207650_10095213 3300025925 Bacteria 2282
194 Ga0207650_10109815 3300025925 Bacteria 2133
195 Ga0207650_10209549 3300025925 Bacteria 1565
196 Ga0207650_10397562 3300025925 Bacteria 1140
197 Ga0207659_10018251 3300025926 Bacteria 4597
198 Ga0207659_10051081 3300025926 Bacteria 2939
199 Ga0207659_10053310 3300025926 Bacteria 2884
200 Ga0207644_10020016 3300025931 Unclassified 4546
201 Ga0207644_10040141 3300025931 Bacteria 3307
202 Ga0207706_10026941 3300025933 Bacteria 5143
203 Ga0207686_10020698 3300025934 Bacteria 3763
204 Ga0207686_10244539 3300025934 Bacteria 1307
205 Ga0207670_10033581 3300025936 Bacteria 3308
206 Ga0207670_10048134 3300025936 Bacteria 2843
207 Ga0207670_10104968 3300025936 Unclassified 2025
208 Ga0207670_10321421 3300025936 Unclassified 1218
209 Ga0207704_10024633 3300025938 Bacteria 3268
210 Ga0207704_10126286 3300025938 Unclassified 1762
211 Ga0207704_10353302 3300025938 Bacteria 1145
212 Ga0207691_10087157 3300025940 Bacteria 2801
213 Ga0207691_10289506 3300025940 Unclassified 1409
214 Ga0207711_10016376 3300025941 Bacteria 6162
215 Ga0207689_10588674 3300025942 Unclassified 935
216 Ga0207661_10025586 3300025944 Unclassified 4488
217 Ga0207661_10047632 3300025944 Unclassified 3404
218 Ga0207661_10120670 3300025944 Bacteria 2231
219 Ga0207679_10005825 3300025945 Bacteria 7739
220 Ga0207679_10138988 3300025945 Bacteria 1961
221 Ga0207651_10005527 3300025960 Bacteria 6503
222 Ga0207651_10138231 3300025960 Bacteria 1877
223 Ga0207712_10065155 3300025961 Unclassified 2600
224 Ga0207712_10216502 3300025961 Bacteria 1529
225 Ga0207658_10006090 3300025986 Bacteria 8234
226 Ga0207658_10049667 3300025986 Bacteria 3083
227 Ga0207658_10084162 3300025986 Bacteria 2447
228 Ga0207658_10101767 3300025986 Unclassified 2252
229 Ga0207658_10189501 3300025986 Unclassified 1708
230 Ga0207677_10008103 3300026023 Bacteria 5850
231 Ga0207703_10151005 3300026035 Bacteria 2026
232 Ga0207641_10001213 3300026088 Bacteria 25798
233 Ga0207641_10063239 3300026088 Unclassified 3161
234 Ga0207641_10088346 3300026088 Bacteria 2706
235 Ga0207641_10172706 3300026088 Bacteria 1974
236 Ga0207641_10178798 3300026088 Unclassified 1942
237 Ga0207648_10152273 3300026089 Bacteria 2041
238 Ga0207676_10019375 3300026095 Bacteria 4963
239 Ga0207674_10015475 3300026116 Bacteria 8379
240 Ga0207674_10089364 3300026116 Bacteria 3073
241 Ga0207675_100082357 3300026118 Unclassified 3018
242 Ga0207675_100138682 3300026118 Bacteria 2309
243 Ga0207698_10212300 3300026142 Bacteria 1742
244 Ga0209971_1043067 3300027682 Bacteria 1087
245 Ga0268265_10114382 3300028380 Bacteria 2210
246 Ga0268264_10003732 3300028381 Bacteria 13080
247 Ga0265332_10017973 3300031238 Bacteria 3117
248 Ga0265342_10072733 3300031712 Bacteria 2001
249 Ga0307409_100075993 3300031995 Unclassified 2692
250 Ga0373953_0016022 3300035117 Unclassified 2728
251 Ga0373957_0039732 3300035120 Unclassified 1766
252 Ga0373957_0104360 3300035120 Bacteria 1137
253 Ga0373955_0204103 3300035172 Unclassified 1177
254 Ga0373933_0065718 3300035724 Bacteria 2197
255 Ga0373937_0090907 3300036401 Bacteria 2828
256 Ga0373937_0142977 3300036401 Bacteria 2239
257 Ga0373937_0206932 3300036401 Bacteria 1845
258 Ga0373925_0199517 3300037068 Bacteria 1590
259 Ga0395898_0112941 3300037466 Unclassified 2604
260 Ga0439461_0010662 3300041410 Bacteria 1692
261 Ga0439460_0055081 3300042461 Bacteria 1201
262 Ga0451576_0322801 3300045051 Bacteria 1616
263 Ga0495603_0114535 3300046455 Bacteria 1572
264 Ga0495629_0144824 3300046459 Bacteria 1653
265 Ga0495582_0340649 3300046473 Unclassified 863
266 Ga0495639_0078969 3300046475 Unclassified 1530
267 Ga0495664_0173937 3300046477 Unclassified 1306
268 Ga0495618_0293228 3300046514 Unclassified 1012
269 Ga0495628_0142127 3300046516 Bacteria 1832
270 Ga0495628_0338450 3300046516 Unclassified 1108
271 Ga0495635_0093886 3300046663 Bacteria 2051
272 Ga0495657_0006580 3300046675 Bacteria 9080
273 Ga0495657_0172978 3300046675 Unclassified 1329
274 Ga0495599_0201067 3300046678 Unclassified 1224
275 Ga0495613_0167928 3300046689 Bacteria 1558
276 Ga0495600_0106356 3300046809 Bacteria 1828
277 Ga0495636_0008341 3300047318 Bacteria 4092
278 Ga0495674_0526243 3300047319 Unclassified 943
279 Ga0495680_0428126 3300047322 Bacteria 909
280 Ga0495684_0397607 3300047471 Unclassified 968
281 Ga0496101_0149335 3300048904 Bacteria 1787
282 Ga0496104_0055641 3300048907 Bacteria 3741
283 Ga0496104_0079479 3300048907 Bacteria 3126
284 Ga0496105_0072944 3300048908 Bacteria 2836
285 Ga0496106_0060464 3300048909 Bacteria 2872
286 Ga0496106_0399191 3300048909 Bacteria 1105
287 Ga0496107_0045508 3300048910 Bacteria 3157
288 Ga0496108_0014936 3300048911 Bacteria 6337
289 Ga0496108_0024656 3300048911 Bacteria 4954
290 Ga0496109_0161291 3300048912 Bacteria 2101
291 Ga0496109_0239465 3300048912 Bacteria 1708
292 Ga0496110_0009255 3300048913 Bacteria 7961
293 Ga0496110_0381510 3300048913 Bacteria 1284
294 Ga0496111_0022934 3300048914 Bacteria 4377
295 Ga0496112_0053644 3300048915 Bacteria 3960
296 Ga0496112_0395052 3300048915 Bacteria 1323
297 Ga0496113_0087315 3300048916 Bacteria 2398
298 Ga0496113_0103063 3300048916 Bacteria 2213
299 Ga0496114_0035041 3300048917 Bacteria 4143
300 Ga0496114_0399007 3300048917 Unclassified 1218
301 Ga0496115_0092912 3300048918 Bacteria 2467
302 Ga0501031_0008643 3300049568 Bacteria 6621
303 Ga0501032_0005782 3300049569 Bacteria 9149
304 Ga0501032_0032864 3300049569 Bacteria 3554
305 Ga0501032_0335388 3300049569 Bacteria 975
306 Ga0501033_0001063 3300049570 Bacteria 25063
307 Ga0501033_0001764 3300049570 Bacteria 18919
308 Ga0501034_0001771 3300049571 Bacteria 27602
309 Ga0501034_0002966 3300049571 Bacteria 19668
310 Ga0501034_0058641 3300049571 Bacteria 3868
311 Ga0501034_0266908 3300049571 Unclassified 1653
312 Ga0501036_0001083 3300049572 Bacteria 20642
313 Ga0501036_0020073 3300049572 Bacteria 5610
314 Ga0501036_0074765 3300049572 Bacteria 2865
315 Ga0501036_0119610 3300049572 Bacteria 2224
316 Ga0501037_0008801 3300049573 Bacteria 7399
317 Ga0501037_0021112 3300049573 Bacteria 4810
318 Ga0501037_0040427 3300049573 Bacteria 3431
319 Ga0501037_0128856 3300049573 Bacteria 1815
320 Ga0501037_0269199 3300049573 Unclassified 1189
321 Ga0501038_0008282 3300049574 Bacteria 9571
322 Ga0501038_0010669 3300049574 Bacteria 8402
323 Ga0501038_0041373 3300049574 Bacteria 4018
324 Ga0501039_0006229 3300049575 Bacteria 9065
325 Ga0501039_0014666 3300049575 Bacteria 5996
326 Ga0501039_0198731 3300049575 Unclassified 1576
327 Ga0501039_0377935 3300049575 Bacteria 1113
328 Ga0501040_0048755 3300049576 Bacteria 2895
329 Ga0501040_0223499 3300049576 Bacteria 1340
330 Ga0501042_0025051 3300049578 Bacteria 4188
331 Ga0501042_0035094 3300049578 Bacteria 3558
332 Ga0501043_0005655 3300049579 Bacteria 10073
333 Ga0501043_0015494 3300049579 Bacteria 5972
334 Ga0501043_0021249 3300049579 Bacteria 5088
335 Ga0501043_0033514 3300049579 Bacteria 4041
336 Ga0501043_0142941 3300049579 Bacteria 1873
337 Ga0501043_0217836 3300049579 Unclassified 1478
338 Ga0501046_0022045 3300049580 Bacteria 5250
339 Ga0501046_0030339 3300049580 Bacteria 4388
340 Ga0501046_0132055 3300049580 Bacteria 1893
341 Ga0501047_0000424 3300049581 Bacteria 47217
342 Ga0501047_0001907 3300049581 Bacteria 20046
343 Ga0501047_0007936 3300049581 Bacteria 10008
344 Ga0501047_0019002 3300049581 Bacteria 6592
345 Ga0501047_0151296 3300049581 Bacteria 2196
346 Ga0501047_0180291 3300049581 Unclassified 1979
347 Ga0501048_0001461 3300049582 Bacteria 17919
348 Ga0501048_0017419 3300049582 Bacteria 5292
349 Ga0501048_0018181 3300049582 Bacteria 5171
350 Ga0501067_0001242 3300049583 Bacteria 13864
351 Ga0501067_0010663 3300049583 Bacteria 5085
352 Ga0501067_0041851 3300049583 Bacteria 2544
353 Ga0501067_0103180 3300049583 Bacteria 1584
354 Ga0501068_0009946 3300049584 Bacteria 5331
355 Ga0501068_0030785 3300049584 Bacteria 3185
356 Ga0501068_0031856 3300049584 Bacteria 3132
357 Ga0501068_0067226 3300049584 Bacteria 2183
358 Ga0501069_0029432 3300049585 Bacteria 3013
359 Ga0501069_0051345 3300049585 Bacteria 2294
360 Ga0501070_0011078 3300049586 Bacteria 7611
361 Ga0501070_0099079 3300049586 Unclassified 2411
362 Ga0501070_0408350 3300049586 Unclassified 1098
363 Ga0501071_0002606 3300049587 Bacteria 11025
364 Ga0501071_0044497 3300049587 Bacteria 3184
365 Ga0501072_0012678 3300049588 Bacteria 6446
366 Ga0501072_0104899 3300049588 Bacteria 2247
367 Ga0501073_0012160 3300049589 Bacteria 6285
368 Ga0501073_0021317 3300049589 Bacteria 4671
369 Ga0501073_0024743 3300049589 Bacteria 4310
370 Ga0501073_0038180 3300049589 Bacteria 3408
371 Ga0501073_0068152 3300049589 Unclassified 2480
372 Ga0501073_0083712 3300049589 Bacteria 2219
373 Ga0501073_0124022 3300049589 Bacteria 1790
374 Ga0501074_0010928 3300049590 Bacteria 6589
375 Ga0501074_0048147 3300049590 Bacteria 3079
376 Ga0501076_0025631 3300049592 Bacteria 4566
377 Ga0501076_0355036 3300049592 Bacteria 1204
378 Ga0501079_0020085 3300049741 Bacteria 5103
379 Ga0501079_0048140 3300049741 Bacteria 3289
380 Ga0501079_0112937 3300049741 Bacteria 2112
381 Ga0501079_0162494 3300049741 Bacteria 1742
382 Ga0501080_0000719 3300049742 Bacteria 26690
383 Ga0501080_0039577 3300049742 Bacteria 4399
384 Ga0501080_0074034 3300049742 Bacteria 3168
385 Ga0501080_0249145 3300049742 Bacteria 1620
386 Ga0501080_0389172 3300049742 Unclassified 1255
387 Ga0501080_0523080 3300049742 Bacteria 1058
388 Ga0501080_0532406 3300049742 Bacteria 1047
389 Ga0501083_0001406 3300049744 Bacteria 16376
390 Ga0501083_0001927 3300049744 Bacteria 14266
391 Ga0501083_0008463 3300049744 Bacteria 7269
392 Ga0501083_0052969 3300049744 Bacteria 2724
393 Ga0501083_0076315 3300049744 Bacteria 2224
394 Ga0501083_0158028 3300049744 Unclassified 1483
395 Ga0501035_0001091 3300049822 Bacteria 28462
396 Ga0501035_0049216 3300049822 Unclassified 3778
397 Ga0501035_0051467 3300049822 Bacteria 3687
398 Ga0501035_0073283 3300049822 Unclassified 3030
399 Ga0501035_0107929 3300049822 Bacteria 2440
400 Ga0501044_0000736 3300049823 Bacteria 39492
401 Ga0501044_0005091 3300049823 Bacteria 14658
402 Ga0501044_0022156 3300049823 Bacteria 6773
403 Ga0501044_0083076 3300049823 Bacteria 3239
404 Ga0501044_0116602 3300049823 Bacteria 2675
405 Ga0501044_0129691 3300049823 Bacteria 2516
406 Ga0501045_0123398 3300049824 Bacteria 1923
407 nmdc:mga05p37_54412_c1 3300050507 Bacteria 4924
408 nmdc:mga09592_264716_c1 3300050508 Unclassified 1491
409 nmdc:mga06r32_7476_c1 3300050510 Bacteria 9826
410 nmdc:mga08y16_112356_c1 3300050511 Bacteria 2836
411 nmdc:mga08y16_23842_c1 3300050511 Bacteria 6462
412 nmdc:mga08y16_282389_c1 3300050511 Bacteria 1712
413 nmdc:mga08y16_30905_c1 3300050511 Bacteria 5631
414 nmdc:mga0n895_16196_c1 3300050512 Bacteria 6835
415 nmdc:mga0n895_175835_c1 3300050512 Bacteria 2171
416 nmdc:mga0rr50_220453_c1 3300050513 Unclassified 1566
417 nmdc:mga0a205_121685_c1 3300050515 Unclassified 2509
418 nmdc:mga0a205_417325_c1 3300050515 Bacteria 1204
419 Ga0495601_0003748 3300053077 Bacteria 8750
420 Ga0495595_0031202 3300053084 Bacteria 2394
421 Ga0495619_0000592 3300053085 Bacteria 24059
422 Ga0495619_0164935 3300053085 Bacteria 1531
423 Ga0500555_000698 3300053103 Bacteria 12671
424 Ga0500568_0002104 3300053139 Bacteria 12031
425 Ga0500616_0000929 3300053153 Bacteria 32035
426 Ga0500645_000218 3300053730 Bacteria 43808
427 Ga0501084_0001047 3300054114 Bacteria 21511
428 Ga0501084_0026852 3300054114 Bacteria 4809
429 Ga0501084_0071489 3300054114 Bacteria 2905
430 Ga0501084_0120717 3300054114 Bacteria 2204
431 Ga0501084_0228477 3300054114 Bacteria 1570
432 Ga0590071_000240 3300059421 Bacteria 16011
433 Ga0590075_000260 3300059424 Bacteria 14836
434 Ga0501082_0008428 3300060353 Bacteria 8892
435 Ga0501082_0027929 3300060353 Bacteria 4859
436 Ga0501082_0349215 3300060353 Bacteria 1289
437 nmdc:mga09592_125771_c1
438 MBSR1b_contig_9102745
439 Ga0058861_10188922
440 Ga0058862_12804635
441 Ga0065712_10001071
442 Ga0065712_10188665
443 Ga0065715_10120689
444 Ga0065715_10211180
445 Ga0065715_10289300
446 Ga0065715_10313170
447 Ga0070683_100027263
448 Ga0070683_100030697
449 Ga0070690_100008277
450 Ga0070690_100064542
451 Ga0070690_100173059
452 Ga0070670_100005618
453 Ga0070670_100008151
454 Ga0070670_100011218
455 Ga0070670_100013564
456 Ga0070670_100040437
457 Ga0070670_100042649
458 Ga0068869_100209883
459 Ga0070666_10014911
460 Ga0070666_10265641
461 Ga0068868_100004111
462 Ga0070689_100063613
463 Ga0070689_100094945
464 Ga0070689_100140921
465 Ga0070689_100360580
466 Ga0070661_100032361
467 Ga0070661_100046331
468 Ga0070669_100032029
469 Ga0070669_100306227
470 Ga0070669_100389092
471 Ga0070675_100000232
472 Ga0070675_100007529
473 Ga0070675_100050078
474 Ga0070675_100440413
475 Ga0070671_100080932
476 Ga0070671_100143922
477 Ga0070673_100015346
478 Ga0070673_100058888
479 Ga0070688_100021921
480 Ga0070667_100002532
481 Ga0070667_100021577
482 Ga0070667_100030194
483 Ga0070667_100160450
484 Ga0070667_100228711
485 Ga0070709_10031520
486 Ga0070711_100039219
487 Ga0070705_100146657
488 Ga0070694_100171125
489 Ga0070663_100253208
490 Ga0070678_100256687
491 Ga0070678_100307778
492 Ga0070662_100025285
493 Ga0070681_10056522
494 Ga0068867_100275310
495 Ga0070698_100076733
496 Ga0070699_100019411
497 Ga0070679_100065808
498 Ga0070684_100000606
499 Ga0070672_100070361
500 Ga0070672_100127039
501 Ga0070672_100281877
502 Ga0070686_100218798
503 Ga0070704_100192856
504 Ga0070704_100543471
505 Ga0070664_100000978
506 Ga0070664_100002528
507 Ga0070664_100367836
508 Ga0068857_100033846
509 Ga0068857_100052931
510 Ga0068854_100379880
511 Ga0068859_100000993
512 Ga0068859_100006415
513 Ga0068864_100012100
514 Ga0068864_100316455
515 Ga0068864_100348219
516 Ga0068861_100145537
517 Ga0068861_100409828
518 Ga0068851_10276322
519 Ga0068863_100018228
520 Ga0068863_100055566
521 Ga0068863_100076607
522 Ga0068863_100081995
523 Ga0068863_100093067
524 Ga0068863_100110930
525 Ga0068858_100040802
526 Ga0068858_100253536
527 Ga0068860_100006146
528 Ga0068860_100166339
529 Ga0068860_100372665
530 Ga0068860_100487211
531 Ga0081455_10198631
532 Ga0070715_10119087
533 Ga0070715_10182055
534 Ga0097621_100004111
535 Ga0097621_100005249
536 Ga0097621_100079053
537 Ga0097621_100174080
538 Ga0097621_100262236
539 Ga0068871_100009441
540 Ga0068871_100016009
541 Ga0068871_100213668
542 Ga0075431_100007779
543 Ga0075433_10029558
544 Ga0075434_100053243
545 Ga0075429_100033438
546 Ga0068865_100010963
547 Ga0068865_100034698
548 Ga0068865_100036960
549 Ga0068865_100127204
550 Ga0068865_100195175
551 Ga0097620_100000993
552 Ga0097620_100006415
553 Ga0075435_100042922
554 Ga0075435_100332680
555 Ga0105240_10542160
556 Ga0105240_10572029
557 Ga0105240_10917644
558 Ga0111539_10010134
559 Ga0111539_10021795
560 Ga0111539_10036731
561 Ga0111539_10095938
562 Ga0111539_10495687
563 Ga0114129_10074365
564 Ga0105241_10016232
565 Ga0105242_10015035
566 Ga0105242_10088569
567 Ga0105248_10000562
568 Ga0105248_10034259
569 Ga0105248_10042085
570 Ga0105238_10263814
571 Ga0105238_10789673
572 Ga0105249_10023940
573 Ga0105249_10088131
574 Ga0105246_10188628
575 Ga0157370_10044786
576 Ga0157369_10046094
577 Ga0157369_10450297
578 Ga0157374_10024093
579 Ga0157374_10057298
580 Ga0163162_10000995
581 Ga0163162_10001327
582 Ga0163162_10284416
583 Ga0163162_10310613
584 Ga0157372_10052227
585 Ga0157375_10002820
586 Ga0157375_10010625
587 Ga0157375_10019866
588 Ga0157375_10299058
589 Ga0157375_10339989
590 Ga0157375_10855338
591 Ga0163163_10000798
592 Ga0163163_10007015
593 Ga0163163_10068605
594 Ga0163163_10098629
595 Ga0163163_10230236
596 Ga0163163_10411619
597 Ga0157377_10053626
598 Ga0157377_10107910
599 Ga0157379_10000277
600 Ga0157379_10079053
601 Ga0157376_10204902
602 Ga0163161_10003256
603 Ga0197907_10046170
604 Ga0206356_10364981
605 Ga0206349_1245701
606 Ga0206355_1450182
607 Ga0206355_1487018
608 Ga0206351_10365821
609 Ga0206352_10024653
610 Ga0206352_11103015
611 Ga0206350_10318929
612 Ga0206350_11158603
613 Ga0206354_10707588
614 Ga0154015_1074199
615 Ga0224712_10027921
616 Ga0224712_10035649
617 Ga0224712_10038508
618 Ga0207697_10042455
619 Ga0207642_10053058
620 Ga0207680_10009566
621 Ga0207680_10317455
622 Ga0207645_10052784
623 Ga0207649_10054774
624 Ga0207649_10170504
625 Ga0207681_10068056
626 Ga0207650_10003931
627 Ga0207650_10007716
628 Ga0207650_10015455
629 Ga0207650_10095213
630 Ga0207650_10109815
631 Ga0207650_10209549
632 Ga0207650_10397562
633 Ga0207659_10018251
634 Ga0207659_10051081
635 Ga0207659_10053310
636 Ga0207644_10020016
637 Ga0207644_10040141
638 Ga0207706_10026941
639 Ga0207686_10020698
640 Ga0207686_10244539
641 Ga0207670_10033581
642 Ga0207670_10048134
643 Ga0207670_10104968
644 Ga0207670_10321421
645 Ga0207704_10024633
646 Ga0207704_10126286
647 Ga0207704_10353302
648 Ga0207691_10087157
649 Ga0207691_10289506
650 Ga0207711_10016376
651 Ga0207689_10588674
652 Ga0207661_10025586
653 Ga0207661_10047632
654 Ga0207661_10120670
655 Ga0207679_10005825
656 Ga0207679_10138988
657 Ga0207651_10005527
658 Ga0207651_10138231
659 Ga0207712_10065155
660 Ga0207712_10216502
661 Ga0207658_10006090
662 Ga0207658_10049667
663 Ga0207658_10084162
664 Ga0207658_10101767
665 Ga0207658_10189501
666 Ga0207677_10008103
667 Ga0207703_10151005
668 Ga0207641_10001213
669 Ga0207641_10063239
670 Ga0207641_10088346
671 Ga0207641_10172706
672 Ga0207641_10178798
673 Ga0207648_10152273
674 Ga0207676_10019375
675 Ga0207674_10015475
676 Ga0207674_10089364
677 Ga0207675_100082357
678 Ga0207675_100138682
679 Ga0207698_10212300
680 Ga0209971_1043067
681 Ga0268265_10114382
682 Ga0268264_10003732
683 Ga0265332_10017973
684 Ga0265342_10072733
685 Ga0307409_100075993
686 Ga0373953_0016022
687 Ga0373957_0039732
688 Ga0373957_0104360
689 Ga0373955_0204103
690 Ga0373933_0065718
691 Ga0373937_0090907
692 Ga0373937_0142977
693 Ga0373937_0206932
694 Ga0373925_0199517
695 Ga0395898_0112941
696 Ga0439461_0010662
697 Ga0439460_0055081
698 Ga0451576_0322801
699 Ga0495603_0114535
700 Ga0495629_0144824
701 Ga0495582_0340649
702 Ga0495639_0078969
703 Ga0495664_0173937
704 Ga0495618_0293228
705 Ga0495628_0142127
706 Ga0495628_0338450
707 Ga0495635_0093886
708 Ga0495657_0006580
709 Ga0495657_0172978
710 Ga0495599_0201067
711 Ga0495613_0167928
712 Ga0495600_0106356
713 Ga0495636_0008341
714 Ga0495674_0526243
715 Ga0495680_0428126
716 Ga0495684_0397607
717 Ga0496101_0149335
718 Ga0496104_0055641
719 Ga0496104_0079479
720 Ga0496105_0072944
721 Ga0496106_0060464
722 Ga0496106_0399191
723 Ga0496107_0045508
724 Ga0496108_0014936
725 Ga0496108_0024656
726 Ga0496109_0161291
727 Ga0496109_0239465
728 Ga0496110_0009255
729 Ga0496110_0381510
730 Ga0496111_0022934
731 Ga0496112_0053644
732 Ga0496112_0395052
733 Ga0496113_0087315
734 Ga0496113_0103063
735 Ga0496114_0035041
736 Ga0496114_0399007
737 Ga0496115_0092912
738 Ga0501031_0008643
739 Ga0501032_0005782
740 Ga0501032_0032864
741 Ga0501032_0335388
742 Ga0501033_0001063
743 Ga0501033_0001764
744 Ga0501034_0001771
745 Ga0501034_0002966
746 Ga0501034_0058641
747 Ga0501034_0266908
748 Ga0501036_0001083
749 Ga0501036_0020073
750 Ga0501036_0074765
751 Ga0501036_0119610
752 Ga0501037_0008801
753 Ga0501037_0021112
754 Ga0501037_0040427
755 Ga0501037_0128856
756 Ga0501037_0269199
757 Ga0501038_0008282
758 Ga0501038_0010669
759 Ga0501038_0041373
760 Ga0501039_0006229
761 Ga0501039_0014666
762 Ga0501039_0198731
763 Ga0501039_0377935
764 Ga0501040_0048755
765 Ga0501040_0223499
766 Ga0501042_0025051
767 Ga0501042_0035094
768 Ga0501043_0005655
769 Ga0501043_0015494
770 Ga0501043_0021249
771 Ga0501043_0033514
772 Ga0501043_0142941
773 Ga0501043_0217836
774 Ga0501046_0022045
775 Ga0501046_0030339
776 Ga0501046_0132055
777 Ga0501047_0000424
778 Ga0501047_0001907
779 Ga0501047_0007936
780 Ga0501047_0019002
781 Ga0501047_0151296
782 Ga0501047_0180291
783 Ga0501048_0001461
784 Ga0501048_0017419
785 Ga0501048_0018181
786 Ga0501067_0001242
787 Ga0501067_0010663
788 Ga0501067_0041851
789 Ga0501067_0103180
790 Ga0501068_0009946
791 Ga0501068_0030785
792 Ga0501068_0031856
793 Ga0501068_0067226
794 Ga0501069_0029432
795 Ga0501069_0051345
796 Ga0501070_0011078
797 Ga0501070_0099079
798 Ga0501070_0408350
799 Ga0501071_0002606
800 Ga0501071_0044497
801 Ga0501072_0012678
802 Ga0501072_0104899
803 Ga0501073_0012160
804 Ga0501073_0021317
805 Ga0501073_0024743
806 Ga0501073_0038180
807 Ga0501073_0068152
808 Ga0501073_0083712
809 Ga0501073_0124022
810 Ga0501074_0010928
811 Ga0501074_0048147
812 Ga0501076_0025631
813 Ga0501076_0355036
814 Ga0501079_0020085
815 Ga0501079_0048140
816 Ga0501079_0112937
817 Ga0501079_0162494
818 Ga0501080_0000719
819 Ga0501080_0039577
820 Ga0501080_0074034
821 Ga0501080_0249145
822 Ga0501080_0389172
823 Ga0501080_0523080
824 Ga0501080_0532406
825 Ga0501083_0001406
826 Ga0501083_0001927
827 Ga0501083_0008463
828 Ga0501083_0052969
829 Ga0501083_0076315
830 Ga0501083_0158028
831 Ga0501035_0001091
832 Ga0501035_0049216
833 Ga0501035_0051467
834 Ga0501035_0073283
835 Ga0501035_0107929
836 Ga0501044_0000736
837 Ga0501044_0005091
838 Ga0501044_0022156
839 Ga0501044_0083076
840 Ga0501044_0116602
841 Ga0501044_0129691
842 Ga0501045_0123398
843 nmdc:mga05p37_54412_c1
844 nmdc:mga09592_264716_c1
845 nmdc:mga06r32_7476_c1
846 nmdc:mga08y16_112356_c1
847 nmdc:mga08y16_23842_c1
848 nmdc:mga08y16_282389_c1
849 nmdc:mga08y16_30905_c1
850 nmdc:mga0n895_16196_c1
851 nmdc:mga0n895_175835_c1
852 nmdc:mga0rr50_220453_c1
853 nmdc:mga0a205_121685_c1
854 nmdc:mga0a205_417325_c1
855 Ga0495601_0003748
856 Ga0495595_0031202
857 Ga0495619_0000592
858 Ga0495619_0164935
859 Ga0500555_000698
860 Ga0500568_0002104
861 Ga0500616_0000929
862 Ga0500645_000218
863 Ga0501084_0001047
864 Ga0501084_0026852
865 Ga0501084_0071489
866 Ga0501084_0120717
867 Ga0501084_0228477
868 Ga0590071_000240
869 Ga0590075_000260
870 Ga0501082_0008428
871 Ga0501082_0027929
872 Ga0501082_0349215

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

103

326

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8745 22 256
8bvk-assembly1.cif.gz_B the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8556 22 256
8bvk-assembly1.cif.gz_A the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8184 17 261
8bvk-assembly1.cif.gz_A the crystal structure of o-glycoside cleaving beta-eliminase from a. tumefaciens atoge 0.8048 17 261
3obe-assembly2.cif.gz_B crystal structure of a sugar phosphate isomerase/epimerase (bdi_3400) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.7959 23 274
ID Description Score Start End Superfamily
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7669 23 278 3.20.20.150
3p6lA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7636 25 279 3.20.20.150
3obeA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.759 18 274 3.20.20.150
3lmzA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7581 17 279 3.20.20.150
af_Q2G1E4_1_314_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.7564 23 279 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A1Q6YDU6-F1-model_v4 Xylose isomerase 0.9802 23 280 GO:0016853
AF-A0A359LM66-F1-model_v4 Xylose isomerase 0.9751 21 281 GO:0016853
AF-A0A1Q6YDU6-F1-model_v4 Xylose isomerase 0.9687 23 280 GO:0016853
AF-A0A359LM66-F1-model_v4 Xylose isomerase 0.9602 21 281 GO:0016853
AF-A0A3D1AXT5-F1-model_v4 Xylose isomerase 0.9579 128 281 GO:0016853

Map