F443540

General Info

Members Datasets Scaffolds Average Seq Length
436 251 872 433

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10025067|Ga0105239_100250673
Length 463
Sequence LAGIVMHAIVAGIMTTLIDVIDLPARIDAEVNPLASDTLTITDNRTGKTYEIPIKDGTIRAIDLRQIKDAPDDFGLMTYDPAFMNTAACRSSITYIDGDKGILEYRGYPIEQLAEKSTYLETAWLLLKGELPTKAELEQWQFRVTHHTFLNENLKGVLDSFRYNAHPMGMLIAMISALGTFYPEAKKIFDPEIRQRQIDRLIAKMITIAAFGYRHMMGMPKVYPDNDLSYPGNFLNMMFKTTELKYKPNPALERALDILFILHADHEQNCSTSAMRVIGSSQVNPYSAVAGAAAALYGPLHGGANEEVIRMLEEIGSKQNIPDFIKKVKSGEGVKLMGFGHRVYKNYDPRAKIIKKAAYDVFEVTGKNPLLDIALELERIALEDEYFVKRKLYPNVDFYSGLIYQAMKFPMDMFPVLFAIPRVSGWLSQWQEMLDDPDQKISRPRQVYTGDRTRDFIPIEQRG

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
138 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
145 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
146 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
147 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
170 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
171 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
172 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
173 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
174 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
229 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
233 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
244 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
245 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
246 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
247 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.75
Nodule 0
Rhizoplane 5.05
Rhizosphere 90.83
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10025067 3300010375 Bacteria 6570
2 JGI24748J21848_1000024 3300002074 Bacteria 105887
3 JGI24738J21930_10002435 3300002075 Bacteria 4875
4 JGI24749J21850_1005094 3300002076 Bacteria 1842
5 JGI24744J21845_10004165 3300002077 Bacteria 2981
6 Ga0065715_10158483 3300005293 Bacteria 1652
7 Ga0070683_100000066 3300005329 Bacteria 74244
8 Ga0070683_100071424 3300005329 Bacteria 3239
9 Ga0070690_100061070 3300005330 Bacteria 2427
10 Ga0068869_100018545 3300005334 Bacteria 4738
11 Ga0068869_100117934 3300005334 Bacteria 2027
12 Ga0070680_100018465 3300005336 Bacteria 5509
13 Ga0070680_100029478 3300005336 Bacteria 4408
14 Ga0068868_100002664 3300005338 Bacteria 12388
15 Ga0070691_10034149 3300005341 Bacteria 2394
16 Ga0070692_10000635 3300005345 Bacteria 11122
17 Ga0070692_10007791 3300005345 Bacteria 4744
18 Ga0070675_100026100 3300005354 Bacteria 4686
19 Ga0070674_100072226 3300005356 Bacteria 2443
20 Ga0070688_100146628 3300005365 Bacteria 1609
21 Ga0070659_100023133 3300005366 Bacteria 4751
22 Ga0070703_10000245 3300005406 Bacteria 26412
23 Ga0070703_10033529 3300005406 Bacteria 1564
24 Ga0070709_10006725 3300005434 Bacteria 6277
25 Ga0070713_100032184 3300005436 Bacteria 4186
26 Ga0070711_100062750 3300005439 Bacteria 2591
27 Ga0070705_100049244 3300005440 Bacteria 2445
28 Ga0070705_100079286 3300005440 Bacteria 2011
29 Ga0070700_100014986 3300005441 Bacteria 4385
30 Ga0070694_100002600 3300005444 Bacteria 10668
31 Ga0070694_100004366 3300005444 Bacteria 8504
32 Ga0070694_100008367 3300005444 Bacteria 6329
33 Ga0070694_100011141 3300005444 Bacteria 5569
34 Ga0070708_100000059 3300005445 Bacteria 70999
35 Ga0070708_100001136 3300005445 Bacteria 20441
36 Ga0070708_100015216 3300005445 Bacteria 6346
37 Ga0070708_100031152 3300005445 Bacteria 4614
38 Ga0070708_100035117 3300005445 Bacteria 4366
39 Ga0070708_100113530 3300005445 Bacteria 2492
40 Ga0070708_100127475 3300005445 Bacteria 2353
41 Ga0070678_100155112 3300005456 Bacteria 1849
42 Ga0068867_100000784 3300005459 Bacteria 21484
43 Ga0068867_100052002 3300005459 Bacteria 3022
44 Ga0070706_100001301 3300005467 Bacteria 26618
45 Ga0070706_100034068 3300005467 Bacteria 4702
46 Ga0070706_100039873 3300005467 Bacteria 4335
47 Ga0070706_100159923 3300005467 Bacteria 2103
48 Ga0070707_100004132 3300005468 Bacteria 13612
49 Ga0070707_100018138 3300005468 Bacteria 6622
50 Ga0070707_100087427 3300005468 Bacteria 3015
51 Ga0070707_100087688 3300005468 Bacteria 3010
52 Ga0070707_100206693 3300005468 Bacteria 1914
53 Ga0070698_100002304 3300005471 Bacteria 21141
54 Ga0070698_100006061 3300005471 Bacteria 13166
55 Ga0070698_100011888 3300005471 Bacteria 9234
56 Ga0070698_100210214 3300005471 Bacteria 1880
57 Ga0070699_100009117 3300005518 Bacteria 8601
58 Ga0070699_100030045 3300005518 Bacteria 4689
59 Ga0070699_100035225 3300005518 Bacteria 4326
60 Ga0070699_100184045 3300005518 Bacteria 1854
61 Ga0070699_100196742 3300005518 Bacteria 1792
62 Ga0070699_100239659 3300005518 Bacteria 1618
63 Ga0070684_100000489 3300005535 Bacteria 27197
64 Ga0070697_100000360 3300005536 Bacteria 35741
65 Ga0070697_100002425 3300005536 Bacteria 14339
66 Ga0070697_100006301 3300005536 Bacteria 9180
67 Ga0070697_100060634 3300005536 Bacteria 3084
68 Ga0070697_100100450 3300005536 Bacteria 2403
69 Ga0070697_100212376 3300005536 Bacteria 1648
70 Ga0070672_100021433 3300005543 Bacteria 4728
71 Ga0070686_100052310 3300005544 Bacteria 2604
72 Ga0070695_100000394 3300005545 Bacteria 22675
73 Ga0070695_100001017 3300005545 Bacteria 15302
74 Ga0070695_100006765 3300005545 Bacteria 6786
75 Ga0070695_100054159 3300005545 Bacteria 2581
76 Ga0070695_100105521 3300005545 Bacteria 1904
77 Ga0070696_100002887 3300005546 Bacteria 11430
78 Ga0070696_100003699 3300005546 Bacteria 10201
79 Ga0070696_100005306 3300005546 Bacteria 8591
80 Ga0070696_100088197 3300005546 Bacteria 2204
81 Ga0070693_100000292 3300005547 Bacteria 23394
82 Ga0070665_100017932 3300005548 Bacteria 7108
83 Ga0070704_100002158 3300005549 Bacteria 10959
84 Ga0070704_100167126 3300005549 Bacteria 1745
85 Ga0068855_100180499 3300005563 Bacteria 2387
86 Ga0068854_100007997 3300005578 Bacteria 6775
87 Ga0068854_100015899 3300005578 Bacteria 5001
88 Ga0070702_100000960 3300005615 Bacteria 11338
89 Ga0068859_100118666 3300005617 Bacteria 2711
90 Ga0068864_100000037 3300005618 Bacteria 188796
91 Ga0068861_100003392 3300005719 Bacteria 10570
92 Ga0068861_100123516 3300005719 Bacteria 2091
93 Ga0068870_10024590 3300005840 Bacteria 2981
94 Ga0068858_100115434 3300005842 Bacteria 2509
95 Ga0068860_100001782 3300005843 Bacteria 22920
96 Ga0070717_10000048 3300006028 Bacteria 104474
97 Ga0075365_10001013 3300006038 Bacteria 12052
98 Ga0075368_10005432 3300006042 Bacteria 4377
99 Ga0075363_100027460 3300006048 Bacteria 2919
100 Ga0075363_100071838 3300006048 Bacteria 1881
101 Ga0075364_10001388 3300006051 Bacteria 13081
102 Ga0070715_10009561 3300006163 Bacteria 3423
103 Ga0070716_100000601 3300006173 Bacteria 15173
104 Ga0070716_100001083 3300006173 Bacteria 11944
105 Ga0070712_100024973 3300006175 Bacteria 3966
106 Ga0070712_100027762 3300006175 Bacteria 3782
107 Ga0070712_100054874 3300006175 Bacteria 2788
108 Ga0075362_10024471 3300006177 Bacteria 2561
109 Ga0097621_100031510 3300006237 Bacteria 4209
110 Ga0068871_100162413 3300006358 Bacteria 1911
111 Ga0075428_100002102 3300006844 Bacteria 21471
112 Ga0075428_100010389 3300006844 Bacteria 10337
113 Ga0075428_100098409 3300006844 Bacteria 3189
114 Ga0075428_100296913 3300006844 Bacteria 1737
115 Ga0075430_100008529 3300006846 Bacteria 8656
116 Ga0075430_100010337 3300006846 Bacteria 7903
117 Ga0075431_100005877 3300006847 Bacteria 12148
118 Ga0075431_100013476 3300006847 Bacteria 8256
119 Ga0075431_100106975 3300006847 Bacteria 2886
120 Ga0075431_100188334 3300006847 Bacteria 2115
121 Ga0075433_10136850 3300006852 Bacteria 2177
122 Ga0075434_100025351 3300006871 Bacteria 5801
123 Ga0075429_100067378 3300006880 Bacteria 3115
124 Ga0075429_100257301 3300006880 Bacteria 1528
125 Ga0068865_100012655 3300006881 Bacteria 5317
126 Ga0075436_100000007 3300006914 Bacteria 288785
127 Ga0075436_100000439 3300006914 Bacteria 26709
128 Ga0075436_100137141 3300006914 Bacteria 1718
129 Ga0097620_100118664 3300006931 Bacteria 2711
130 Ga0075435_100000276 3300007076 Bacteria 31955
131 Ga0075435_100015792 3300007076 Bacteria 5682
132 Ga0075435_100091044 3300007076 Bacteria 2516
133 Ga0099794_10000219 3300007265 Bacteria 20487
134 Ga0099794_10002643 3300007265 Bacteria 6661
135 Ga0099794_10016221 3300007265 Bacteria 3300
136 Ga0099794_10047779 3300007265 Bacteria 2053
137 Ga0105240_10004568 3300009093 Bacteria 20995
138 Ga0105240_10035882 3300009093 Bacteria 6385
139 Ga0111539_10000159 3300009094 Bacteria 76817
140 Ga0111539_10145078 3300009094 Bacteria 2779
141 Ga0105245_10000006 3300009098 Bacteria 330960
142 Ga0105245_10000119 3300009098 Bacteria 76107
143 Ga0114129_10000519 3300009147 Bacteria 47104
144 Ga0114129_10008257 3300009147 Bacteria 14850
145 Ga0114129_10038946 3300009147 Bacteria 6700
146 Ga0114129_10049430 3300009147 Bacteria 5908
147 Ga0114129_10396964 3300009147 Bacteria 1818
148 Ga0105243_10005983 3300009148 Bacteria 9422
149 Ga0105242_10020611 3300009176 Bacteria 5171
150 Ga0105248_10011888 3300009177 Bacteria 9604
151 Ga0105248_10123536 3300009177 Bacteria 2920
152 Ga0105248_10202854 3300009177 Bacteria 2234
153 Ga0105248_10225985 3300009177 Bacteria 2107
154 Ga0105238_10000115 3300009551 Bacteria 89300
155 Ga0105249_10006314 3300009553 Bacteria 10299
156 Ga0099796_10006054 3300010159 Bacteria 3073
157 Ga0105246_10104872 3300011119 Bacteria 2065
158 Ga0157371_10045659 3300013102 Bacteria 3117
159 Ga0157369_10000335 3300013105 Bacteria 62500
160 Ga0157374_10000006 3300013296 Bacteria 640284
161 Ga0157378_10000441 3300013297 Bacteria 40161
162 Ga0157378_10001287 3300013297 Bacteria 22568
163 Ga0157378_10007066 3300013297 Bacteria 9802
164 Ga0157378_10007527 3300013297 Bacteria 9507
165 Ga0157378_10010478 3300013297 Bacteria 8096
166 Ga0157378_10075338 3300013297 Bacteria 3038
167 Ga0163162_10297643 3300013306 Bacteria 1745
168 Ga0163162_10400930 3300013306 Bacteria 1504
169 Ga0157372_10067008 3300013307 Bacteria 4033
170 Ga0157372_10097076 3300013307 Bacteria 3360
171 Ga0157375_10000022 3300013308 Bacteria 239765
172 Ga0157375_10000671 3300013308 Bacteria 30301
173 Ga0157375_10134807 3300013308 Bacteria 2592
174 Ga0163163_10216863 3300014325 Bacteria 1962
175 Ga0157377_10000003 3300014745 Bacteria 435133
176 Ga0157377_10000046 3300014745 Bacteria 96700
177 Ga0157377_10021593 3300014745 Bacteria 3388
178 Ga0157379_10009902 3300014968 Bacteria 8303
179 Ga0157376_10000005 3300014969 Bacteria 443695
180 Ga0157376_10000009 3300014969 Bacteria 340244
181 Ga0157376_10002721 3300014969 Bacteria 12049
182 Ga0213876_10000028 3300021384 Bacteria 222108
183 Ga0213876_10064865 3300021384 Bacteria 1927
184 Ga0207653_10000024 3300025885 Bacteria 117069
185 Ga0207653_10002364 3300025885 Bacteria 6015
186 Ga0207653_10009100 3300025885 Bacteria 3098
187 Ga0207642_10003527 3300025899 Bacteria 4952
188 Ga0207710_10051626 3300025900 Bacteria 1847
189 Ga0207699_10004025 3300025906 Bacteria 7036
190 Ga0207699_10074670 3300025906 Bacteria 2084
191 Ga0207643_10001725 3300025908 Bacteria 12260
192 Ga0207643_10054755 3300025908 Bacteria 2268
193 Ga0207684_10003935 3300025910 Bacteria 14214
194 Ga0207684_10026375 3300025910 Bacteria 4954
195 Ga0207684_10047855 3300025910 Bacteria 3627
196 Ga0207684_10056937 3300025910 Bacteria 3317
197 Ga0207684_10149722 3300025910 Bacteria 2008
198 Ga0207695_10108946 3300025913 Bacteria 2753
199 Ga0207693_10012936 3300025915 Bacteria 6735
200 Ga0207693_10083335 3300025915 Bacteria 2505
201 Ga0207693_10110004 3300025915 Bacteria 2161
202 Ga0207663_10023467 3300025916 Bacteria 3540
203 Ga0207660_10008422 3300025917 Bacteria 6670
204 Ga0207660_10083675 3300025917 Bacteria 2350
205 Ga0207662_10016217 3300025918 Bacteria 4201
206 Ga0207646_10004491 3300025922 Bacteria 15127
207 Ga0207646_10048046 3300025922 Bacteria 3826
208 Ga0207646_10200834 3300025922 Bacteria 1801
209 Ga0207694_10000001 3300025924 Bacteria 4078485
210 Ga0207650_10000070 3300025925 Bacteria 138201
211 Ga0207650_10023758 3300025925 Bacteria 4352
212 Ga0207659_10000025 3300025926 Bacteria 139965
213 Ga0207687_10000006 3300025927 Bacteria 641680
214 Ga0207687_10000276 3300025927 Bacteria 35207
215 Ga0207700_10019122 3300025928 Bacteria 4621
216 Ga0207700_10156125 3300025928 Bacteria 1891
217 Ga0207690_10014465 3300025932 Bacteria 4767
218 Ga0207686_10035345 3300025934 Bacteria 2998
219 Ga0207709_10012343 3300025935 Bacteria 4708
220 Ga0207704_10007836 3300025938 Bacteria 5068
221 Ga0207665_10000020 3300025939 Bacteria 117316
222 Ga0207665_10004335 3300025939 Bacteria 9421
223 Ga0207665_10006519 3300025939 Bacteria 7740
224 Ga0207665_10034367 3300025939 Bacteria 3363
225 Ga0207665_10037375 3300025939 Bacteria 3232
226 Ga0207665_10044591 3300025939 Bacteria 2967
227 Ga0207665_10047220 3300025939 Bacteria 2886
228 Ga0207691_10008019 3300025940 Bacteria 10151
229 Ga0207711_10085481 3300025941 Bacteria 2764
230 Ga0207689_10007349 3300025942 Bacteria 9661
231 Ga0207661_10000006 3300025944 Bacteria 537727
232 Ga0207661_10157796 3300025944 Bacteria 1966
233 Ga0207667_10181359 3300025949 Bacteria 2162
234 Ga0207651_10123694 3300025960 Bacteria 1967
235 Ga0207712_10018625 3300025961 Bacteria 4525
236 Ga0207640_10011652 3300025981 Bacteria 4983
237 Ga0207677_10000180 3300026023 Bacteria 50319
238 Ga0207708_10001069 3300026075 Bacteria 20541
239 Ga0207702_10028895 3300026078 Bacteria 4611
240 Ga0207641_10001507 3300026088 Bacteria 22801
241 Ga0207648_10015087 3300026089 Bacteria 7114
242 Ga0207648_10060021 3300026089 Bacteria 3317
243 Ga0207676_10000067 3300026095 Bacteria 104863
244 Ga0207675_100030904 3300026118 Bacteria 4988
245 Ga0209588_1000444 3300027671 Bacteria 10653
246 Ga0209588_1004019 3300027671 Bacteria 4118
247 Ga0209588_1010948 3300027671 Bacteria 2733
248 Ga0209588_1014286 3300027671 Bacteria 2429
249 Ga0209588_1014483 3300027671 Bacteria 2415
250 Ga0209588_1023200 3300027671 Bacteria 1955
251 Ga0207428_10014492 3300027907 Bacteria 6844
252 Ga0265354_1000136 3300028016 Bacteria 13180
253 Ga0268266_10000529 3300028379 Bacteria 53323
254 Ga0268264_10009050 3300028381 Bacteria 8262
255 Ga0268264_10009267 3300028381 Bacteria 8152
256 Ga0268264_10136830 3300028381 Bacteria 2179
257 Ga0307511_10002163 3300030521 Bacteria 20649
258 Ga0265770_1000862 3300030878 Bacteria 4201
259 Ga0265765_1001762 3300030879 Bacteria 2030
260 Ga0265760_10011702 3300031090 Bacteria 2507
261 Ga0265325_10008980 3300031241 Bacteria 5869
262 Ga0265331_10004382 3300031250 Bacteria 8829
263 Ga0307408_100064853 3300031548 Bacteria 2677
264 Ga0265342_10044579 3300031712 Bacteria 2673
265 Ga0316576_10003613 3300031727 Bacteria 9121
266 Ga0316576_10004029 3300031727 Bacteria 8744
267 Ga0316576_10049102 3300031727 Bacteria 3063
268 Ga0316576_10057254 3300031727 Bacteria 2848
269 Ga0316576_10073018 3300031727 Bacteria 2534
270 Ga0316578_10057273 3300031728 Bacteria 2289
271 Ga0307405_10079901 3300031731 Bacteria 2133
272 Ga0307412_10009164 3300031911 Bacteria 5672
273 Ga0307409_100043236 3300031995 Bacteria 3381
274 Ga0307416_100014383 3300032002 Bacteria 5421
275 Ga0316580_10034708 3300032139 Bacteria 1561
276 Ga0373926_0004150 3300035083 Bacteria 4727
277 Ga0373932_0000914 3300035112 Bacteria 8625
278 Ga0373953_0000856 3300035117 Bacteria 8539
279 Ga0373954_0006881 3300035118 Bacteria 4964
280 Ga0373956_0009663 3300035119 Bacteria 3926
281 Ga0373955_0006764 3300035172 Bacteria 5235
282 Ga0316574_0058711 3300035398 Bacteria 2410
283 Ga0373931_0141254 3300035691 Bacteria 1395
284 Ga0373935_0166529 3300035692 Bacteria 1505
285 Ga0373927_0063635 3300035695 Bacteria 2386
286 Ga0373927_0166695 3300035695 Bacteria 1443
287 Ga0373933_0017881 3300035724 Bacteria 3981
288 Ga0373937_0004783 3300036401 Bacteria 11499
289 Ga0373937_0013795 3300036401 Bacteria 7120
290 Ga0373937_0027764 3300036401 Bacteria 5120
291 Ga0373937_0236122 3300036401 Bacteria 1722
292 Ga0316582_0053582 3300036647 Bacteria 2567
293 Ga0316584_0006800 3300036712 Bacteria 7761
294 Ga0316584_0031038 3300036712 Bacteria 3951
295 Ga0400489_86979 3300039093 Bacteria 2732
296 Ga0436365_0043200 3300039437 Bacteria 3526
297 Ga0436365_0414850 3300039437 Bacteria 153664
298 Ga0436362_0210496 3300039453 Bacteria 11009
299 Ga0439435_0001156 3300042436 Bacteria 4732
300 Ga0451577_0004268 3300042876 Bacteria 15196
301 Ga0451577_0022732 3300042876 Bacteria 5725
302 Ga0451577_0091094 3300042876 Bacteria 2721
303 Ga0453683_0073527 3300044673 Bacteria 2140
304 Ga0466966_0003226 3300044684 Bacteria 10750
305 Ga0466961_0038606 3300044693 Bacteria 3063
306 Ga0466963_0107792 3300044694 Bacteria 1910
307 Ga0453684_0008851 3300044712 Bacteria 17840
308 Ga0453684_0151217 3300044712 Bacteria 2758
309 Ga0466971_0017800 3300044719 Bacteria 3147
310 Ga0466957_0028898 3300044842 Bacteria 3303
311 Ga0466957_0041203 3300044842 Bacteria 2792
312 Ga0466959_0026435 3300045049 Bacteria 4301
313 Ga0451576_0004464 3300045051 Bacteria 18132
314 Ga0451576_0007334 3300045051 Bacteria 13226
315 Ga0451576_0029684 3300045051 Bacteria 5849
316 Ga0451576_0034841 3300045051 Bacteria 5344
317 Ga0466958_0009328 3300045836 Bacteria 5467
318 Ga0466967_0059981 3300045976 Bacteria 3369
319 Ga0466967_0184496 3300045976 Bacteria 1969
320 Ga0495629_0020283 3300046459 Bacteria 4747
321 Ga0495651_0034684 3300046462 Bacteria 3933
322 Ga0495650_0000053 3300046471 Bacteria 316684
323 Ga0495580_0001699 3300046472 Bacteria 19345
324 Ga0495580_0007644 3300046472 Bacteria 8669
325 Ga0495580_0057322 3300046472 Bacteria 2742
326 Ga0495580_0156000 3300046472 Bacteria 1581
327 Ga0495582_0002917 3300046473 Bacteria 9562
328 Ga0495582_0044211 3300046473 Bacteria 2454
329 Ga0495639_0001506 3300046475 Bacteria 10387
330 Ga0495662_0058832 3300046476 Bacteria 1856
331 Ga0495594_0011328 3300046499 Bacteria 4632
332 Ga0495628_0033342 3300046516 Bacteria 4152
333 Ga0495666_0057328 3300046526 Bacteria 1865
334 Ga0495665_0036627 3300046531 Bacteria 2619
335 Ga0495640_0005329 3300046533 Bacteria 10227
336 Ga0495587_0006028 3300046536 Bacteria 7902
337 Ga0495587_0006805 3300046536 Bacteria 7441
338 Ga0495634_0147210 3300046642 Bacteria 1491
339 Ga0495623_0026737 3300046679 Bacteria 3713
340 Ga0495658_0014987 3300046683 Bacteria 3971
341 Ga0495613_0081584 3300046689 Bacteria 2349
342 Ga0495581_0008243 3300047315 Bacteria 6040
343 Ga0495604_0000609 3300047317 Bacteria 30758
344 Ga0495674_0090315 3300047319 Bacteria 2618
345 Ga0495684_0114131 3300047471 Bacteria 2037
346 Ga0495602_0022181 3300048088 Bacteria 6223
347 Ga0495602_0280096 3300048088 Bacteria 1229
348 Ga0496100_0030141 3300048903 Bacteria 3363
349 Ga0496101_0075585 3300048904 Bacteria 2480
350 Ga0496102_0000946 3300048905 Bacteria 27368
351 Ga0496104_0041955 3300048907 Bacteria 4291
352 Ga0496105_0094836 3300048908 Bacteria 2465
353 Ga0496105_0121245 3300048908 Bacteria 2156
354 Ga0496106_0059670 3300048909 Bacteria 2890
355 Ga0496108_0016525 3300048911 Bacteria 6023
356 Ga0496108_0041425 3300048911 Bacteria 3845
357 Ga0496108_0256135 3300048911 Bacteria 1523
358 Ga0496109_0092698 3300048912 Bacteria 2794
359 Ga0496110_0003040 3300048913 Bacteria 12725
360 Ga0496111_0002619 3300048914 Bacteria 10907
361 Ga0496111_0045737 3300048914 Bacteria 3150
362 Ga0496111_0094891 3300048914 Bacteria 2188
363 Ga0496112_0006423 3300048915 Bacteria 10319
364 Ga0496112_0076685 3300048915 Bacteria 3306
365 Ga0496112_0102698 3300048915 Bacteria 2829
366 Ga0496114_0022228 3300048917 Bacteria 5167
367 Ga0496114_0057845 3300048917 Bacteria 3237
368 Ga0496114_0157811 3300048917 Bacteria 1971
369 Ga0496115_0007202 3300048918 Bacteria 8172
370 Ga0501031_0161487 3300049568 Bacteria 1465
371 Ga0501033_0259150 3300049570 Bacteria 1231
372 Ga0501036_0007069 3300049572 Bacteria 9133
373 Ga0501038_0092392 3300049574 Bacteria 2534
374 Ga0501041_0051155 3300049577 Bacteria 2518
375 Ga0501048_0048661 3300049582 Bacteria 3023
376 Ga0501067_0028238 3300049583 Bacteria 3108
377 Ga0501067_0031605 3300049583 Bacteria 2937
378 Ga0501071_0033514 3300049587 Bacteria 3649
379 Ga0501074_0112078 3300049590 Bacteria 1952
380 Ga0501075_0031282 3300049591 Bacteria 3949
381 Ga0501075_0031983 3300049591 Bacteria 3908
382 Ga0501076_0084297 3300049592 Bacteria 2553
383 Ga0501249_031986 3300049679 Bacteria 1176
384 Ga0501079_0073420 3300049741 Bacteria 2644
385 Ga0501081_0039481 3300049743 Bacteria 3230
386 Ga0501081_0100604 3300049743 Bacteria 2043
387 Ga0501045_0033091 3300049824 Bacteria 3748
388 Ga0501045_0077303 3300049824 Bacteria 2452
389 nmdc:mga03683_22151_c1 3300050489 Bacteria 2460
390 nmdc:mga03683_47152_c1 3300050489 Bacteria 1787
391 nmdc:mga03n38_61151_c1 3300050490 Bacteria 1715
392 nmdc:mga00v17_171758_c1 3300050491 Bacteria 1398
393 nmdc:mga00v17_2828_c1 3300050491 Bacteria 8918
394 nmdc:mga05p37_115_c1 3300050507 Bacteria 71893
395 nmdc:mga05p37_259042_c1 3300050507 Bacteria 2083
396 nmdc:mga05p37_29144_c1 3300050507 Bacteria 6738
397 nmdc:mga05p37_3248_c1 3300050507 Bacteria 18933
398 nmdc:mga05p37_351950_c1 3300050507 Bacteria 1734
399 nmdc:mga05p37_45333_c1 3300050507 Bacteria 5409
400 nmdc:mga05p37_85337_c1 3300050507 Bacteria 3890
401 nmdc:mga09592_18103_c1 3300050508 Bacteria 5776
402 nmdc:mga09592_376434_c1 3300050508 Bacteria 1228
403 nmdc:mga09592_40758_c1 3300050508 Bacteria 3902
404 nmdc:mga0qj67_18817_c1 3300050509 Bacteria 5267
405 nmdc:mga0qj67_49867_c1 3300050509 Bacteria 3309
406 nmdc:mga06r32_11495_c1 3300050510 Bacteria 7974
407 nmdc:mga06r32_18426_c1 3300050510 Bacteria 6392
408 nmdc:mga06r32_28730_c1 3300050510 Bacteria 5206
409 nmdc:mga06r32_86334_c1 3300050510 Bacteria 3060
410 nmdc:mga08y16_1346_c1 3300050511 Bacteria 24536
411 nmdc:mga0n895_116920_c1 3300050512 Bacteria 2686
412 nmdc:mga0n895_198204_c1 3300050512 Bacteria 2039
413 nmdc:mga0n895_38837_c1 3300050512 Bacteria 4614
414 nmdc:mga0n895_48190_c1 3300050512 Bacteria 4169
415 nmdc:mga0n895_49695_c1 3300050512 Bacteria 4110
416 nmdc:mga0n895_60327_c1 3300050512 Bacteria 3743
417 nmdc:mga0rr50_11928_c1 3300050513 Bacteria 5589
418 nmdc:mga0rr50_136836_c1 3300050513 Bacteria 1967
419 nmdc:mga0rr50_144282_c1 3300050513 Bacteria 1918
420 nmdc:mga0rr50_162_c1 3300050513 Bacteria 36242
421 nmdc:mga0rr50_27281_c1 3300050513 Bacteria 3996
422 nmdc:mga08x19_294_c1 3300050514 Bacteria 36798
423 nmdc:mga08x19_37816_c1 3300050514 Bacteria 3064
424 nmdc:mga08x19_70_c1 3300050514 Bacteria 98848
425 nmdc:mga0a205_4034_c1 3300050515 Bacteria 13132
426 Ga0495601_0002637 3300053077 Bacteria 10179
427 Ga0495655_0012946 3300053083 Bacteria 1712
428 Ga0495619_0003551 3300053085 Bacteria 10060
429 Ga0500616_0009568 3300053153 Bacteria 5886
430 Ga0501084_0055859 3300054114 Bacteria 3304
431 Ga0501082_0019148 3300060353 Bacteria 5897
432 Ga0501082_0086515 3300060353 Bacteria 2704
433 Ga0501082_0150093 3300060353 Bacteria 2024
434 Ga0466962_0000770 3300061719 Bacteria 14385
435 Ga0466962_0035271 3300061719 Bacteria 2395
436 Ga0530510_0069934 3300061734 Bacteria 2547
437 Ga0105239_10025067
438 JGI24748J21848_1000024
439 JGI24738J21930_10002435
440 JGI24749J21850_1005094
441 JGI24744J21845_10004165
442 Ga0065715_10158483
443 Ga0070683_100000066
444 Ga0070683_100071424
445 Ga0070690_100061070
446 Ga0068869_100018545
447 Ga0068869_100117934
448 Ga0070680_100018465
449 Ga0070680_100029478
450 Ga0068868_100002664
451 Ga0070691_10034149
452 Ga0070692_10000635
453 Ga0070692_10007791
454 Ga0070675_100026100
455 Ga0070674_100072226
456 Ga0070688_100146628
457 Ga0070659_100023133
458 Ga0070703_10000245
459 Ga0070703_10033529
460 Ga0070709_10006725
461 Ga0070713_100032184
462 Ga0070711_100062750
463 Ga0070705_100049244
464 Ga0070705_100079286
465 Ga0070700_100014986
466 Ga0070694_100002600
467 Ga0070694_100004366
468 Ga0070694_100008367
469 Ga0070694_100011141
470 Ga0070708_100000059
471 Ga0070708_100001136
472 Ga0070708_100015216
473 Ga0070708_100031152
474 Ga0070708_100035117
475 Ga0070708_100113530
476 Ga0070708_100127475
477 Ga0070678_100155112
478 Ga0068867_100000784
479 Ga0068867_100052002
480 Ga0070706_100001301
481 Ga0070706_100034068
482 Ga0070706_100039873
483 Ga0070706_100159923
484 Ga0070707_100004132
485 Ga0070707_100018138
486 Ga0070707_100087427
487 Ga0070707_100087688
488 Ga0070707_100206693
489 Ga0070698_100002304
490 Ga0070698_100006061
491 Ga0070698_100011888
492 Ga0070698_100210214
493 Ga0070699_100009117
494 Ga0070699_100030045
495 Ga0070699_100035225
496 Ga0070699_100184045
497 Ga0070699_100196742
498 Ga0070699_100239659
499 Ga0070684_100000489
500 Ga0070697_100000360
501 Ga0070697_100002425
502 Ga0070697_100006301
503 Ga0070697_100060634
504 Ga0070697_100100450
505 Ga0070697_100212376
506 Ga0070672_100021433
507 Ga0070686_100052310
508 Ga0070695_100000394
509 Ga0070695_100001017
510 Ga0070695_100006765
511 Ga0070695_100054159
512 Ga0070695_100105521
513 Ga0070696_100002887
514 Ga0070696_100003699
515 Ga0070696_100005306
516 Ga0070696_100088197
517 Ga0070693_100000292
518 Ga0070665_100017932
519 Ga0070704_100002158
520 Ga0070704_100167126
521 Ga0068855_100180499
522 Ga0068854_100007997
523 Ga0068854_100015899
524 Ga0070702_100000960
525 Ga0068859_100118666
526 Ga0068864_100000037
527 Ga0068861_100003392
528 Ga0068861_100123516
529 Ga0068870_10024590
530 Ga0068858_100115434
531 Ga0068860_100001782
532 Ga0070717_10000048
533 Ga0075365_10001013
534 Ga0075368_10005432
535 Ga0075363_100027460
536 Ga0075363_100071838
537 Ga0075364_10001388
538 Ga0070715_10009561
539 Ga0070716_100000601
540 Ga0070716_100001083
541 Ga0070712_100024973
542 Ga0070712_100027762
543 Ga0070712_100054874
544 Ga0075362_10024471
545 Ga0097621_100031510
546 Ga0068871_100162413
547 Ga0075428_100002102
548 Ga0075428_100010389
549 Ga0075428_100098409
550 Ga0075428_100296913
551 Ga0075430_100008529
552 Ga0075430_100010337
553 Ga0075431_100005877
554 Ga0075431_100013476
555 Ga0075431_100106975
556 Ga0075431_100188334
557 Ga0075433_10136850
558 Ga0075434_100025351
559 Ga0075429_100067378
560 Ga0075429_100257301
561 Ga0068865_100012655
562 Ga0075436_100000007
563 Ga0075436_100000439
564 Ga0075436_100137141
565 Ga0097620_100118664
566 Ga0075435_100000276
567 Ga0075435_100015792
568 Ga0075435_100091044
569 Ga0099794_10000219
570 Ga0099794_10002643
571 Ga0099794_10016221
572 Ga0099794_10047779
573 Ga0105240_10004568
574 Ga0105240_10035882
575 Ga0111539_10000159
576 Ga0111539_10145078
577 Ga0105245_10000006
578 Ga0105245_10000119
579 Ga0114129_10000519
580 Ga0114129_10008257
581 Ga0114129_10038946
582 Ga0114129_10049430
583 Ga0114129_10396964
584 Ga0105243_10005983
585 Ga0105242_10020611
586 Ga0105248_10011888
587 Ga0105248_10123536
588 Ga0105248_10202854
589 Ga0105248_10225985
590 Ga0105238_10000115
591 Ga0105249_10006314
592 Ga0099796_10006054
593 Ga0105246_10104872
594 Ga0157371_10045659
595 Ga0157369_10000335
596 Ga0157374_10000006
597 Ga0157378_10000441
598 Ga0157378_10001287
599 Ga0157378_10007066
600 Ga0157378_10007527
601 Ga0157378_10010478
602 Ga0157378_10075338
603 Ga0163162_10297643
604 Ga0163162_10400930
605 Ga0157372_10067008
606 Ga0157372_10097076
607 Ga0157375_10000022
608 Ga0157375_10000671
609 Ga0157375_10134807
610 Ga0163163_10216863
611 Ga0157377_10000003
612 Ga0157377_10000046
613 Ga0157377_10021593
614 Ga0157379_10009902
615 Ga0157376_10000005
616 Ga0157376_10000009
617 Ga0157376_10002721
618 Ga0213876_10000028
619 Ga0213876_10064865
620 Ga0207653_10000024
621 Ga0207653_10002364
622 Ga0207653_10009100
623 Ga0207642_10003527
624 Ga0207710_10051626
625 Ga0207699_10004025
626 Ga0207699_10074670
627 Ga0207643_10001725
628 Ga0207643_10054755
629 Ga0207684_10003935
630 Ga0207684_10026375
631 Ga0207684_10047855
632 Ga0207684_10056937
633 Ga0207684_10149722
634 Ga0207695_10108946
635 Ga0207693_10012936
636 Ga0207693_10083335
637 Ga0207693_10110004
638 Ga0207663_10023467
639 Ga0207660_10008422
640 Ga0207660_10083675
641 Ga0207662_10016217
642 Ga0207646_10004491
643 Ga0207646_10048046
644 Ga0207646_10200834
645 Ga0207694_10000001
646 Ga0207650_10000070
647 Ga0207650_10023758
648 Ga0207659_10000025
649 Ga0207687_10000006
650 Ga0207687_10000276
651 Ga0207700_10019122
652 Ga0207700_10156125
653 Ga0207690_10014465
654 Ga0207686_10035345
655 Ga0207709_10012343
656 Ga0207704_10007836
657 Ga0207665_10000020
658 Ga0207665_10004335
659 Ga0207665_10006519
660 Ga0207665_10034367
661 Ga0207665_10037375
662 Ga0207665_10044591
663 Ga0207665_10047220
664 Ga0207691_10008019
665 Ga0207711_10085481
666 Ga0207689_10007349
667 Ga0207661_10000006
668 Ga0207661_10157796
669 Ga0207667_10181359
670 Ga0207651_10123694
671 Ga0207712_10018625
672 Ga0207640_10011652
673 Ga0207677_10000180
674 Ga0207708_10001069
675 Ga0207702_10028895
676 Ga0207641_10001507
677 Ga0207648_10015087
678 Ga0207648_10060021
679 Ga0207676_10000067
680 Ga0207675_100030904
681 Ga0209588_1000444
682 Ga0209588_1004019
683 Ga0209588_1010948
684 Ga0209588_1014286
685 Ga0209588_1014483
686 Ga0209588_1023200
687 Ga0207428_10014492
688 Ga0265354_1000136
689 Ga0268266_10000529
690 Ga0268264_10009050
691 Ga0268264_10009267
692 Ga0268264_10136830
693 Ga0307511_10002163
694 Ga0265770_1000862
695 Ga0265765_1001762
696 Ga0265760_10011702
697 Ga0265325_10008980
698 Ga0265331_10004382
699 Ga0307408_100064853
700 Ga0265342_10044579
701 Ga0316576_10003613
702 Ga0316576_10004029
703 Ga0316576_10049102
704 Ga0316576_10057254
705 Ga0316576_10073018
706 Ga0316578_10057273
707 Ga0307405_10079901
708 Ga0307412_10009164
709 Ga0307409_100043236
710 Ga0307416_100014383
711 Ga0316580_10034708
712 Ga0373926_0004150
713 Ga0373932_0000914
714 Ga0373953_0000856
715 Ga0373954_0006881
716 Ga0373956_0009663
717 Ga0373955_0006764
718 Ga0316574_0058711
719 Ga0373931_0141254
720 Ga0373935_0166529
721 Ga0373927_0063635
722 Ga0373927_0166695
723 Ga0373933_0017881
724 Ga0373937_0004783
725 Ga0373937_0013795
726 Ga0373937_0027764
727 Ga0373937_0236122
728 Ga0316582_0053582
729 Ga0316584_0006800
730 Ga0316584_0031038
731 Ga0400489_86979
732 Ga0436365_0043200
733 Ga0436365_0414850
734 Ga0436362_0210496
735 Ga0439435_0001156
736 Ga0451577_0004268
737 Ga0451577_0022732
738 Ga0451577_0091094
739 Ga0453683_0073527
740 Ga0466966_0003226
741 Ga0466961_0038606
742 Ga0466963_0107792
743 Ga0453684_0008851
744 Ga0453684_0151217
745 Ga0466971_0017800
746 Ga0466957_0028898
747 Ga0466957_0041203
748 Ga0466959_0026435
749 Ga0451576_0004464
750 Ga0451576_0007334
751 Ga0451576_0029684
752 Ga0451576_0034841
753 Ga0466958_0009328
754 Ga0466967_0059981
755 Ga0466967_0184496
756 Ga0495629_0020283
757 Ga0495651_0034684
758 Ga0495650_0000053
759 Ga0495580_0001699
760 Ga0495580_0007644
761 Ga0495580_0057322
762 Ga0495580_0156000
763 Ga0495582_0002917
764 Ga0495582_0044211
765 Ga0495639_0001506
766 Ga0495662_0058832
767 Ga0495594_0011328
768 Ga0495628_0033342
769 Ga0495666_0057328
770 Ga0495665_0036627
771 Ga0495640_0005329
772 Ga0495587_0006028
773 Ga0495587_0006805
774 Ga0495634_0147210
775 Ga0495623_0026737
776 Ga0495658_0014987
777 Ga0495613_0081584
778 Ga0495581_0008243
779 Ga0495604_0000609
780 Ga0495674_0090315
781 Ga0495684_0114131
782 Ga0495602_0022181
783 Ga0495602_0280096
784 Ga0496100_0030141
785 Ga0496101_0075585
786 Ga0496102_0000946
787 Ga0496104_0041955
788 Ga0496105_0094836
789 Ga0496105_0121245
790 Ga0496106_0059670
791 Ga0496108_0016525
792 Ga0496108_0041425
793 Ga0496108_0256135
794 Ga0496109_0092698
795 Ga0496110_0003040
796 Ga0496111_0002619
797 Ga0496111_0045737
798 Ga0496111_0094891
799 Ga0496112_0006423
800 Ga0496112_0076685
801 Ga0496112_0102698
802 Ga0496114_0022228
803 Ga0496114_0057845
804 Ga0496114_0157811
805 Ga0496115_0007202
806 Ga0501031_0161487
807 Ga0501033_0259150
808 Ga0501036_0007069
809 Ga0501038_0092392
810 Ga0501041_0051155
811 Ga0501048_0048661
812 Ga0501067_0028238
813 Ga0501067_0031605
814 Ga0501071_0033514
815 Ga0501074_0112078
816 Ga0501075_0031282
817 Ga0501075_0031983
818 Ga0501076_0084297
819 Ga0501249_031986
820 Ga0501079_0073420
821 Ga0501081_0039481
822 Ga0501081_0100604
823 Ga0501045_0033091
824 Ga0501045_0077303
825 nmdc:mga03683_22151_c1
826 nmdc:mga03683_47152_c1
827 nmdc:mga03n38_61151_c1
828 nmdc:mga00v17_171758_c1
829 nmdc:mga00v17_2828_c1
830 nmdc:mga05p37_115_c1
831 nmdc:mga05p37_259042_c1
832 nmdc:mga05p37_29144_c1
833 nmdc:mga05p37_3248_c1
834 nmdc:mga05p37_351950_c1
835 nmdc:mga05p37_45333_c1
836 nmdc:mga05p37_85337_c1
837 nmdc:mga09592_18103_c1
838 nmdc:mga09592_376434_c1
839 nmdc:mga09592_40758_c1
840 nmdc:mga0qj67_18817_c1
841 nmdc:mga0qj67_49867_c1
842 nmdc:mga06r32_11495_c1
843 nmdc:mga06r32_18426_c1
844 nmdc:mga06r32_28730_c1
845 nmdc:mga06r32_86334_c1
846 nmdc:mga08y16_1346_c1
847 nmdc:mga0n895_116920_c1
848 nmdc:mga0n895_198204_c1
849 nmdc:mga0n895_38837_c1
850 nmdc:mga0n895_48190_c1
851 nmdc:mga0n895_49695_c1
852 nmdc:mga0n895_60327_c1
853 nmdc:mga0rr50_11928_c1
854 nmdc:mga0rr50_136836_c1
855 nmdc:mga0rr50_144282_c1
856 nmdc:mga0rr50_162_c1
857 nmdc:mga0rr50_27281_c1
858 nmdc:mga08x19_294_c1
859 nmdc:mga08x19_37816_c1
860 nmdc:mga08x19_70_c1
861 nmdc:mga0a205_4034_c1
862 Ga0495601_0002637
863 Ga0495655_0012946
864 Ga0495619_0003551
865 Ga0500616_0009568
866 Ga0501084_0055859
867 Ga0501082_0019148
868 Ga0501082_0086515
869 Ga0501082_0150093
870 Ga0466962_0000770
871 Ga0466962_0035271
872 Ga0530510_0069934

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00285

Citrate_synt

Citrate synthase, C-terminal domain

82

445

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ixe-assembly1.cif.gz_A crystal structure of citrate synthase from thermus thermophilus hb8 0.9572 50 428
1ixe-assembly2.cif.gz_D crystal structure of citrate synthase from thermus thermophilus hb8 0.9456 52 428
1ixe-assembly1.cif.gz_A crystal structure of citrate synthase from thermus thermophilus hb8 0.9447 50 428
1ixe-assembly2.cif.gz_C crystal structure of citrate synthase from thermus thermophilus hb8 0.9429 52 428
6s87-assembly1.cif.gz_B crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in complex with oxaloacetate. 0.9407 56 428
ID Description Score Start End Superfamily
4xghA02 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.9731 54 414 1.10.580.10
4xghA02 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.9692 54 414 1.10.580.10
1ixeD01 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.956 56 408 1.10.580.10
1ixeD01 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.9522 56 408 1.10.580.10
3hwkC01 Mainly Alpha;Orthogonal Bundle;Citrate Synthase; domain 1;Citrate Synthase, domain 1 0.9504 56 408 1.10.580.10
ID Description Score Start End GO Terms
AF-A0A539DHS8-F1-model_v4 GltA 0.9894 114 246 GO:0046912
AF-A0A2S1PGY7-F1-model_v4 Citrate synthase 0.9871 73 205 GO:0046912
AF-A0A1V3YYA6-F1-model_v4 deleted 0.9867 69 191
AF-A0A7V3GTP3-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9866 185 428 GO:0006099
GO:0016020
GO:0046912
AF-A0A7W1B3Y6-F1-model_v4 citrate synthase (unknown stereospecificity) (EC 2.3.3.16) 0.9845 171 428 GO:0006099
GO:0046912

Map