F443506

General Info

Members Datasets Scaffolds Average Seq Length
436 236 436 131

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10028013|Ga0081455_100280134
Length 139
Sequence MAAEHMIDVEVLTPEGEVFEGEARMVSTRTEVGEIGILANHAPVLAALRPTELRLKISDSDGDTKRYAQAHGWLQVFGNRARLLIEEAIPPENLDAGTLKEQLSDAEQRLGESDEESAEYARAKKDKDRAEAFLAIAQG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
134 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
135 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
136 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
137 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
151 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
154 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
159 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
163 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
164 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
186 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
187 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
188 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
211 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
212 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
229 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
230 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
231 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
232 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
233 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
234 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
235 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
236 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.92
Nodule 0
Rhizoplane 9.63
Rhizosphere 86.24
Stem 0
Stem Tuber 0
Unclassified 3.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001166 3300001979 Bacteria 11866
2 JGI24750J21931_1011699 3300002070 Bacteria 1156
3 JGI25406J46586_10052908 3300003203 Bacteria 1351
4 JGI25404J52841_10015487 3300003659 Bacteria 1654
5 Ga0065707_10294271 3300005295 Bacteria 1018
6 Ga0070676_11596212 3300005328 Unclassified 504
7 Ga0070683_100014631 3300005329 Bacteria 6870
8 Ga0070683_100014719 3300005329 Bacteria 6852
9 Ga0070683_100082677 3300005329 Bacteria 3007
10 Ga0070683_100095631 3300005329 Bacteria 2793
11 Ga0070690_100064663 3300005330 Bacteria 2364
12 Ga0068869_101057597 3300005334 Bacteria 709
13 Ga0070666_10084154 3300005335 Bacteria 2177
14 Ga0070666_10085298 3300005335 Bacteria 2163
15 Ga0070682_100000045 3300005337 Bacteria 131960
16 Ga0068868_100000151 3300005338 Bacteria 44963
17 Ga0070660_100778651 3300005339 Bacteria 804
18 Ga0070689_100454757 3300005340 Bacteria 1090
19 Ga0070691_10527114 3300005341 Bacteria 687
20 Ga0070661_101108042 3300005344 Bacteria 660
21 Ga0070661_101194180 3300005344 Bacteria 636
22 Ga0070668_100007876 3300005347 Bacteria 7911
23 Ga0070668_102114926 3300005347 Bacteria 520
24 Ga0070669_102027761 3300005353 Unclassified 503
25 Ga0070675_100000053 3300005354 Bacteria 70601
26 Ga0070671_100232413 3300005355 Bacteria 1565
27 Ga0070688_100000300 3300005365 Bacteria 25290
28 Ga0070688_100026227 3300005365 Bacteria 3460
29 Ga0070688_100249340 3300005365 Bacteria 1264
30 Ga0070688_100385631 3300005365 Bacteria 1034
31 Ga0070659_100029340 3300005366 Bacteria 4251
32 Ga0070659_100047450 3300005366 Bacteria 3369
33 Ga0070667_100000695 3300005367 Bacteria 32405
34 Ga0070667_100160383 3300005367 Bacteria 1980
35 Ga0070709_11114166 3300005434 Unclassified 632
36 Ga0070714_101836318 3300005435 Bacteria 592
37 Ga0070713_100000009 3300005436 Bacteria 153056
38 Ga0070713_100098504 3300005436 Bacteria 2528
39 Ga0070701_10356692 3300005438 Bacteria 915
40 Ga0070711_100030128 3300005439 Bacteria 3590
41 Ga0070711_100046597 3300005439 Bacteria 2954
42 Ga0070663_100000733 3300005455 Bacteria 17691
43 Ga0070663_101398771 3300005455 Bacteria 620
44 Ga0070678_100651671 3300005456 Bacteria 945
45 Ga0070662_100000016 3300005457 Bacteria 105820
46 Ga0070681_10561009 3300005458 Bacteria 1056
47 Ga0068867_100001857 3300005459 Bacteria 14683
48 Ga0070685_10000320 3300005466 Bacteria 29816
49 Ga0070685_10074371 3300005466 Bacteria 2021
50 Ga0070679_100001032 3300005530 Bacteria 24307
51 Ga0070684_100004338 3300005535 Bacteria 10779
52 Ga0070684_100069441 3300005535 Bacteria 3098
53 Ga0070684_100074903 3300005535 Bacteria 2984
54 Ga0070684_100153456 3300005535 Bacteria 2087
55 Ga0068853_100041088 3300005539 Bacteria 3949
56 Ga0070686_101140730 3300005544 Bacteria 645
57 Ga0070693_100030569 3300005547 Bacteria 2945
58 Ga0070665_100000244 3300005548 Bacteria 90284
59 Ga0070665_100101307 3300005548 Bacteria 2884
60 Ga0070665_100181529 3300005548 Bacteria 2105
61 Ga0070704_101009150 3300005549 Bacteria 753
62 Ga0070664_100330991 3300005564 Bacteria 1382
63 Ga0068854_100000031 3300005578 Bacteria 107298
64 Ga0068854_100124925 3300005578 Unclassified 1958
65 Ga0068854_101148616 3300005578 Unclassified 694
66 Ga0068856_100029863 3300005614 Bacteria 5327
67 Ga0068856_100085723 3300005614 Bacteria 3129
68 Ga0068856_100665929 3300005614 Bacteria 1061
69 Ga0068856_100821960 3300005614 Bacteria 949
70 Ga0068856_101728836 3300005614 Bacteria 638
71 Ga0068852_100000296 3300005616 Bacteria 33429
72 Ga0068859_101225111 3300005617 Bacteria 827
73 Ga0068866_10007339 3300005718 Bacteria 4616
74 Ga0068861_101081279 3300005719 Bacteria 770
75 Ga0068870_10276414 3300005840 Bacteria 1051
76 Ga0068863_100126717 3300005841 Bacteria 2436
77 Ga0068863_100764203 3300005841 Bacteria 963
78 Ga0068858_100001207 3300005842 Bacteria 26780
79 Ga0068858_100757266 3300005842 Bacteria 946
80 Ga0068858_101115132 3300005842 Bacteria 775
81 Ga0068860_100118668 3300005843 Bacteria 2532
82 Ga0068862_100011108 3300005844 Bacteria 7437
83 Ga0081455_10028013 3300005937 Bacteria 5152
84 Ga0081455_10756302 3300005937 Bacteria 614
85 Ga0081540_1000006 3300005983 Bacteria 208724
86 Ga0081539_10003705 3300005985 Bacteria 18213
87 Ga0070715_10102783 3300006163 Bacteria 1336
88 Ga0070712_100132863 3300006175 Bacteria 1888
89 Ga0075430_100097487 3300006846 Bacteria 2457
90 Ga0075430_100285362 3300006846 Bacteria 1366
91 Ga0075431_100124971 3300006847 Bacteria 2655
92 Ga0075434_100704813 3300006871 Bacteria 1027
93 Ga0075434_102132290 3300006871 Bacteria 565
94 Ga0097620_101224991 3300006931 Bacteria 827
95 Ga0105240_10610955 3300009093 Bacteria 1199
96 Ga0105245_10126157 3300009098 Bacteria 2396
97 Ga0105245_10825863 3300009098 Bacteria 966
98 Ga0105245_12511221 3300009098 Bacteria 569
99 Ga0105247_10000322 3300009101 Bacteria 42918
100 Ga0105247_11159404 3300009101 Bacteria 613
101 Ga0114129_11034546 3300009147 Bacteria 1032
102 Ga0105243_10214663 3300009148 Bacteria 1696
103 Ga0105241_11020936 3300009174 Bacteria 775
104 Ga0105242_10000194 3300009176 Bacteria 47231
105 Ga0105242_10000819 3300009176 Bacteria 24165
106 Ga0105242_10011158 3300009176 Bacteria 6905
107 Ga0105248_10000118 3300009177 Bacteria 90018
108 Ga0105237_10156576 3300009545 Bacteria 2275
109 Ga0105238_10101068 3300009551 Bacteria 2866
110 Ga0105249_10022982 3300009553 Bacteria 5590
111 Ga0105239_10290845 3300010375 Bacteria 1840
112 Ga0105239_10545647 3300010375 Bacteria 1320
113 Ga0157342_1065384 3300012507 Bacteria 542
114 Ga0157369_10222650 3300013105 Bacteria 1974
115 Ga0157374_10002990 3300013296 Bacteria 14146
116 Ga0157374_10027456 3300013296 Bacteria 5136
117 Ga0157378_10034101 3300013297 Bacteria 4502
118 Ga0157372_11238473 3300013307 Bacteria 862
119 Ga0157372_12125008 3300013307 Bacteria 645
120 Ga0157372_13456031 3300013307 Unclassified 502
121 Ga0157375_10049542 3300013308 Bacteria 4116
122 Ga0157375_10953394 3300013308 Bacteria 1000
123 Ga0157375_11548868 3300013308 Bacteria 783
124 Ga0157375_11657936 3300013308 Bacteria 757
125 Ga0163163_10253003 3300014325 Bacteria 1812
126 Ga0163163_10491047 3300014325 Bacteria 1289
127 Ga0157380_10004918 3300014326 Bacteria 9315
128 Ga0157379_10069272 3300014968 Bacteria 3155
129 Ga0157376_10279143 3300014969 Bacteria 1573
130 Ga0157376_10926249 3300014969 Bacteria 891
131 Ga0157376_13140800 3300014969 Bacteria 500
132 Ga0163161_10588585 3300017792 Bacteria 916
133 Ga0163161_10601004 3300017792 Bacteria 907
134 Ga0207642_10000222 3300025899 Bacteria 16787
135 Ga0207642_10188388 3300025899 Bacteria 1130
136 Ga0207710_10000158 3300025900 Bacteria 72527
137 Ga0207680_10048960 3300025903 Bacteria 2513
138 Ga0207680_10051529 3300025903 Bacteria 2462
139 Ga0207647_10453445 3300025904 Bacteria 719
140 Ga0207643_10215442 3300025908 Bacteria 1173
141 Ga0207707_10197850 3300025912 Bacteria 1752
142 Ga0207671_10719258 3300025914 Bacteria 794
143 Ga0207693_10027373 3300025915 Bacteria 4508
144 Ga0207663_10023250 3300025916 Bacteria 3554
145 Ga0207663_10045560 3300025916 Bacteria 2698
146 Ga0207649_10632247 3300025920 Bacteria 826
147 Ga0207652_10004210 3300025921 Bacteria 11747
148 Ga0207694_10398944 3300025924 Bacteria 1143
149 Ga0207650_11093265 3300025925 Unclassified 679
150 Ga0207659_10000010 3300025926 Bacteria 286639
151 Ga0207687_10062230 3300025927 Bacteria 2638
152 Ga0207700_10000025 3300025928 Bacteria 147429
153 Ga0207700_10077057 3300025928 Bacteria 2589
154 Ga0207664_10396176 3300025929 Bacteria 1227
155 Ga0207664_11056118 3300025929 Bacteria 727
156 Ga0207644_10191026 3300025931 Bacteria 1610
157 Ga0207690_10010287 3300025932 Bacteria 5554
158 Ga0207706_10000068 3300025933 Bacteria 105795
159 Ga0207686_10000033 3300025934 Bacteria 143602
160 Ga0207686_10000428 3300025934 Bacteria 28669
161 Ga0207686_10065250 3300025934 Bacteria 2321
162 Ga0207686_10111897 3300025934 Bacteria 1843
163 Ga0207709_10207945 3300025935 Bacteria 1402
164 Ga0207669_10000004 3300025937 Bacteria 196828
165 Ga0207669_10706682 3300025937 Bacteria 829
166 Ga0207711_10000020 3300025941 Bacteria 363325
167 Ga0207661_10000492 3300025944 Bacteria 25390
168 Ga0207661_10003810 3300025944 Bacteria 10514
169 Ga0207661_10059556 3300025944 Bacteria 3077
170 Ga0207661_10110791 3300025944 Bacteria 2321
171 Ga0207661_10525716 3300025944 Bacteria 1082
172 Ga0207679_10550695 3300025945 Bacteria 1035
173 Ga0207679_11581934 3300025945 Bacteria 601
174 Ga0207712_10012842 3300025961 Bacteria 5358
175 Ga0207668_10002301 3300025972 Bacteria 11150
176 Ga0207668_10644640 3300025972 Bacteria 927
177 Ga0207668_10664988 3300025972 Bacteria 913
178 Ga0207640_10000015 3300025981 Bacteria 215411
179 Ga0207640_10108244 3300025981 Unclassified 1964
180 Ga0207658_10002223 3300025986 Bacteria 14411
181 Ga0207658_10163100 3300025986 Bacteria 1828
182 Ga0207677_10000372 3300026023 Bacteria 31162
183 Ga0207703_10000322 3300026035 Bacteria 52048
184 Ga0207703_10726636 3300026035 Bacteria 945
185 Ga0207703_10894558 3300026035 Unclassified 850
186 Ga0207639_10004255 3300026041 Bacteria 9652
187 Ga0207639_11595901 3300026041 Bacteria 612
188 Ga0207678_10000834 3300026067 Bacteria 28248
189 Ga0207702_10000607 3300026078 Bacteria 39638
190 Ga0207702_10011070 3300026078 Bacteria 7530
191 Ga0207702_10034330 3300026078 Bacteria 4240
192 Ga0207702_10383946 3300026078 Bacteria 1351
193 Ga0207641_10005415 3300026088 Bacteria 10899
194 Ga0207641_10516540 3300026088 Bacteria 1161
195 Ga0207648_10004376 3300026089 Bacteria 14522
196 Ga0207674_10316510 3300026116 Bacteria 1510
197 Ga0207675_100366960 3300026118 Bacteria 1414
198 Ga0207683_10543149 3300026121 Bacteria 1074
199 Ga0207698_10000012 3300026142 Bacteria 260061
200 Ga0268266_10000020 3300028379 Bacteria 527065
201 Ga0268266_10189681 3300028379 Bacteria 1876
202 Ga0268265_10000555 3300028380 Bacteria 38092
203 Ga0268264_10273527 3300028381 Bacteria 1579
204 Ga0268264_10827050 3300028381 Unclassified 926
205 Ga0268264_11330961 3300028381 Bacteria 728
206 Ga0265338_11039851 3300028800 Unclassified 553
207 Ga0373955_0410017 3300035172 Bacteria 824
208 Ga0373937_0067454 3300036401 Bacteria 3296
209 Ga0373937_0573873 3300036401 Bacteria 1071
210 Ga0373937_0663929 3300036401 Bacteria 988
211 Ga0316581_0030368 3300037588 Bacteria 1627
212 Ga0451800_0178548 3300041459 Bacteria 813
213 Ga0451833_0877887 3300041491 Bacteria 980
214 Ga0451849_0726868 3300041505 Bacteria 743
215 Ga0451853_1910385 3300041512 Bacteria 1524
216 Ga0466963_0000023 3300044694 Bacteria 52546
217 Ga0466963_0018584 3300044694 Bacteria 4348
218 Ga0466957_0009547 3300044842 Bacteria 5540
219 Ga0466957_0156298 3300044842 Bacteria 1478
220 Ga0466967_0039088 3300045976 Bacteria 4076
221 Ga0466967_0897786 3300045976 Bacteria 881
222 Ga0495592_0000036 3300046454 Bacteria 125461
223 Ga0495592_0085377 3300046454 Bacteria 2276
224 Ga0495592_0161413 3300046454 Bacteria 1542
225 Ga0495592_0205104 3300046454 Bacteria 1328
226 Ga0495592_0518170 3300046454 Bacteria 737
227 Ga0495603_0002329 3300046455 Bacteria 11149
228 Ga0495629_0005717 3300046459 Bacteria 9284
229 Ga0495629_0043027 3300046459 Bacteria 3172
230 Ga0495629_0219311 3300046459 Bacteria 1312
231 Ga0495629_0239110 3300046459 Bacteria 1251
232 Ga0495629_0694333 3300046459 Bacteria 676
233 Ga0495641_0000003 3300046461 Bacteria 242879
234 Ga0495641_0348200 3300046461 Bacteria 670
235 Ga0495651_0243423 3300046462 Bacteria 1232
236 Ga0495651_0663183 3300046462 Bacteria 653
237 Ga0495653_0110641 3300046463 Bacteria 1974
238 Ga0495653_0139882 3300046463 Bacteria 1704
239 Ga0495653_0144466 3300046463 Bacteria 1669
240 Ga0495653_0637180 3300046463 Unclassified 652
241 Ga0495653_0765501 3300046463 Bacteria 582
242 Ga0495582_0000029 3300046473 Bacteria 77919
243 Ga0495662_0009006 3300046476 Bacteria 4901
244 Ga0495662_0042482 3300046476 Bacteria 2194
245 Ga0495662_0681780 3300046476 Bacteria 501
246 Ga0495585_0271212 3300046492 Bacteria 841
247 Ga0495594_0000003 3300046499 Bacteria 199267
248 Ga0495608_0000031 3300046511 Bacteria 145255
249 Ga0495608_0000204 3300046511 Bacteria 42513
250 Ga0495608_0197009 3300046511 Bacteria 1270
251 Ga0495608_0888409 3300046511 Bacteria 522
252 Ga0495618_0314870 3300046514 Bacteria 970
253 Ga0495628_0000924 3300046516 Bacteria 26910
254 Ga0495628_0014361 3300046516 Bacteria 6639
255 Ga0495628_0055146 3300046516 Bacteria 3131
256 Ga0495628_0075988 3300046516 Bacteria 2615
257 Ga0495628_0089843 3300046516 Bacteria 2378
258 Ga0495628_0436138 3300046516 Bacteria 953
259 Ga0495630_0000018 3300046517 Bacteria 186064
260 Ga0495630_0003066 3300046517 Bacteria 11586
261 Ga0495630_0083662 3300046517 Bacteria 2409
262 Ga0495630_0547242 3300046517 Bacteria 887
263 Ga0495631_0207331 3300046518 Unclassified 838
264 Ga0495644_0000832 3300046523 Bacteria 12716
265 Ga0495652_0000019 3300046529 Bacteria 190248
266 Ga0495652_0331252 3300046529 Bacteria 1097
267 Ga0495652_0886521 3300046529 Bacteria 589
268 Ga0495640_0045726 3300046533 Bacteria 3037
269 Ga0495640_0156433 3300046533 Bacteria 1463
270 Ga0495586_0008444 3300046535 Bacteria 5480
271 Ga0495586_0551983 3300046535 Bacteria 665
272 Ga0495587_0094193 3300046536 Bacteria 1729
273 Ga0495587_0109159 3300046536 Bacteria 1590
274 Ga0495598_0074837 3300046537 Bacteria 1074
275 Ga0495621_0001642 3300046539 Bacteria 5852
276 Ga0495645_0010791 3300046543 Bacteria 6418
277 Ga0495645_0034019 3300046543 Bacteria 3718
278 Ga0495645_0339575 3300046543 Bacteria 970
279 Ga0495622_0000014 3300046557 Bacteria 182142
280 Ga0495667_0000032 3300046559 Bacteria 143493
281 Ga0495668_0203108 3300046616 Bacteria 1085
282 Ga0495634_0000401 3300046642 Bacteria 42619
283 Ga0495634_0002056 3300046642 Bacteria 17049
284 Ga0495634_0009982 3300046642 Bacteria 6973
285 Ga0495634_0205860 3300046642 Bacteria 1220
286 Ga0495625_0000122 3300046660 Bacteria 121146
287 Ga0495625_0209494 3300046660 Bacteria 1282
288 Ga0495635_0000016 3300046663 Bacteria 214088
289 Ga0495635_0035390 3300046663 Bacteria 3462
290 Ga0495657_0000024 3300046675 Bacteria 145255
291 Ga0495657_0015704 3300046675 Bacteria 5534
292 Ga0495599_0243117 3300046678 Bacteria 1097
293 Ga0495599_0863998 3300046678 Bacteria 514
294 Ga0495623_0526843 3300046679 Bacteria 621
295 Ga0495646_0240961 3300046680 Bacteria 972
296 Ga0495647_0000025 3300046681 Bacteria 65184
297 Ga0495647_0000655 3300046681 Bacteria 10254
298 Ga0495647_0074304 3300046681 Bacteria 1366
299 Ga0495658_0000026 3300046683 Bacteria 77681
300 Ga0495658_0042534 3300046683 Bacteria 2537
301 Ga0495669_0343375 3300046684 Bacteria 721
302 Ga0495613_0000073 3300046689 Bacteria 98688
303 Ga0495613_0000152 3300046689 Bacteria 68384
304 Ga0495613_0284123 3300046689 Bacteria 1148
305 Ga0495624_0000009 3300046690 Bacteria 145026
306 Ga0495624_0006346 3300046690 Bacteria 8398
307 Ga0495670_0024598 3300046691 Bacteria 2977
308 Ga0495670_0789809 3300046691 Bacteria 518
309 Ga0495649_0071875 3300046694 Bacteria 1854
310 Ga0495600_0002157 3300046809 Bacteria 11156
311 Ga0495600_0003562 3300046809 Bacteria 9162
312 Ga0495600_0047885 3300046809 Bacteria 2789
313 Ga0495600_0241179 3300046809 Bacteria 1152
314 Ga0495604_0000985 3300047317 Bacteria 23770
315 Ga0495604_0898344 3300047317 Bacteria 553
316 Ga0495674_0000731 3300047319 Bacteria 31001
317 Ga0495674_0275268 3300047319 Bacteria 1380
318 Ga0495674_0487918 3300047319 Bacteria 987
319 Ga0495676_0001652 3300047321 Bacteria 19468
320 Ga0495676_0008238 3300047321 Bacteria 9561
321 Ga0495676_0659962 3300047321 Bacteria 678
322 Ga0495680_0000061 3300047322 Bacteria 90676
323 Ga0495680_0008134 3300047322 Bacteria 9559
324 Ga0495680_0048281 3300047322 Bacteria 3343
325 Ga0495680_0055271 3300047322 Bacteria 3080
326 Ga0495680_0093965 3300047322 Bacteria 2244
327 Ga0495675_0000428 3300047444 Bacteria 28143
328 Ga0495675_0253399 3300047444 Bacteria 1056
329 Ga0495679_008608 3300047446 Bacteria 4135
330 Ga0495685_003311 3300047447 Bacteria 5131
331 Ga0495684_0229041 3300047471 Bacteria 1360
332 Ga0495684_0607407 3300047471 Bacteria 737
333 Ga0495686_0087393 3300047472 Bacteria 1896
334 Ga0495686_0176890 3300047472 Bacteria 1238
335 Ga0495593_0021701 3300047673 Bacteria 3583
336 Ga0495593_0072010 3300047673 Bacteria 1795
337 Ga0495593_0144583 3300047673 Bacteria 1204
338 Ga0495602_0000021 3300048088 Bacteria 168585
339 Ga0495602_0001790 3300048088 Bacteria 21477
340 Ga0495602_0075988 3300048088 Bacteria 2849
341 Ga0495602_0207508 3300048088 Bacteria 1490
342 Ga0495602_0332059 3300048088 Bacteria 1102
343 Ga0495602_0450845 3300048088 Bacteria 908
344 Ga0496100_0000002 3300048903 Bacteria 489057
345 Ga0496100_0000018 3300048903 Bacteria 162451
346 Ga0496100_0958401 3300048903 Bacteria 673
347 Ga0496101_0000001 3300048904 Bacteria 489057
348 Ga0496101_0000221 3300048904 Bacteria 42499
349 Ga0496102_0400702 3300048905 Bacteria 1290
350 Ga0496102_0457374 3300048905 Bacteria 1197
351 Ga0496102_1368826 3300048905 Bacteria 627
352 Ga0496103_0298427 3300048906 Bacteria 1036
353 Ga0496103_0670243 3300048906 Bacteria 658
354 Ga0496104_0000004 3300048907 Bacteria 641830
355 Ga0496104_0001485 3300048907 Bacteria 20235
356 Ga0496104_0041622 3300048907 Bacteria 4309
357 Ga0496105_0000001 3300048908 Bacteria 1328178
358 Ga0496105_0041031 3300048908 Bacteria 3814
359 Ga0496106_0000018 3300048909 Bacteria 175028
360 Ga0496106_0000955 3300048909 Bacteria 21074
361 Ga0496106_1414034 3300048909 Bacteria 537
362 Ga0496107_0000006 3300048910 Bacteria 258746
363 Ga0496107_0000013 3300048910 Bacteria 178284
364 Ga0496108_0008881 3300048911 Bacteria 8146
365 Ga0496108_0017390 3300048911 Bacteria 5884
366 Ga0496109_0000028 3300048912 Bacteria 168138
367 Ga0496109_0009763 3300048912 Bacteria 8191
368 Ga0496109_0297664 3300048912 Bacteria 1521
369 Ga0496109_1387072 3300048912 Bacteria 638
370 Ga0496110_0007855 3300048913 Bacteria 8546
371 Ga0496110_0024424 3300048913 Bacteria 5151
372 Ga0496110_0027983 3300048913 Bacteria 4837
373 Ga0496111_0005935 3300048914 Bacteria 7879
374 Ga0496112_0000003 3300048915 Bacteria 660147
375 Ga0496112_0269127 3300048915 Bacteria 1652
376 Ga0496112_0313066 3300048915 Bacteria 1515
377 Ga0496112_1015333 3300048915 Bacteria 749
378 Ga0496113_0315175 3300048916 Bacteria 1253
379 Ga0496113_0474249 3300048916 Unclassified 1005
380 Ga0496114_0000014 3300048917 Bacteria 297902
381 Ga0496114_0621816 3300048917 Bacteria 951
382 Ga0496115_0000003 3300048918 Bacteria 354994
383 Ga0496115_0000989 3300048918 Bacteria 20585
384 Ga0496115_0623410 3300048918 Bacteria 855
385 Ga0496116_0001188 3300048919 Bacteria 30564
386 Ga0496118_0287949 3300048921 Bacteria 910
387 Ga0496118_0356340 3300048921 Bacteria 777
388 Ga0496119_0008937 3300048922 Bacteria 8702
389 Ga0496119_0027787 3300048922 Bacteria 3877
390 Ga0496120_0223653 3300048923 Bacteria 898
391 Ga0496120_0264015 3300048923 Bacteria 802
392 Ga0496121_0244442 3300048924 Bacteria 1248
393 Ga0496126_0012897 3300048929 Bacteria 8535
394 Ga0496126_0092924 3300048929 Bacteria 2649
395 Ga0496126_0189855 3300048929 Bacteria 1741
396 Ga0501032_0567754 3300049569 Bacteria 723
397 Ga0501041_0340156 3300049577 Bacteria 948
398 Ga0501042_0040173 3300049578 Bacteria 3326
399 Ga0501042_0122140 3300049578 Bacteria 1875
400 Ga0501042_0229840 3300049578 Bacteria 1338
401 Ga0501043_0933235 3300049579 Bacteria 621
402 Ga0501048_0754021 3300049582 Bacteria 699
403 Ga0501070_0370778 3300049586 Bacteria 1160
404 Ga0501072_0066421 3300049588 Bacteria 2845
405 Ga0501072_0655142 3300049588 Bacteria 826
406 Ga0501075_0002587 3300049591 Bacteria 12072
407 Ga0501076_0109780 3300049592 Bacteria 2229
408 nmdc:mga05p37_684622_c1 3300050507 Bacteria 1142
409 nmdc:mga06r32_791923_c1 3300050510 Bacteria 909
410 nmdc:mga0n895_1426208_c1 3300050512 Bacteria 660
411 Ga0495601_0000039 3300053077 Bacteria 79594
412 Ga0495601_0003202 3300053077 Bacteria 9364
413 Ga0495601_0005132 3300053077 Bacteria 7610
414 Ga0495601_0085110 3300053077 Bacteria 2031
415 Ga0495601_0298171 3300053077 Bacteria 1050
416 Ga0495601_0353713 3300053077 Bacteria 955
417 Ga0495601_0362736 3300053077 Bacteria 941
418 Ga0495601_0649817 3300053077 Bacteria 675
419 Ga0495612_0000098 3300053078 Bacteria 37601
420 Ga0495612_0045894 3300053078 Bacteria 1789
421 Ga0495612_0051682 3300053078 Bacteria 1689
422 Ga0495612_0321120 3300053078 Bacteria 696
423 Ga0495655_0129245 3300053083 Bacteria 776
424 Ga0495595_0000014 3300053084 Bacteria 145255
425 Ga0495595_0000278 3300053084 Bacteria 20258
426 Ga0495595_0654087 3300053084 Unclassified 538
427 Ga0495619_0000147 3300053085 Bacteria 51947
428 Ga0495619_0001794 3300053085 Bacteria 14259
429 Ga0495619_0002546 3300053085 Bacteria 11934
430 Ga0495619_0033241 3300053085 Bacteria 3350
431 Ga0495619_0288670 3300053085 Bacteria 1136
432 Ga0500566_0002905 3300053094 Bacteria 10219
433 Ga0500641_0001950 3300053096 Bacteria 7329
434 Ga0500595_039084 3300053119 Bacteria 1538
435 Ga0500614_000026 3300053123 Bacteria 35584
436 Ga0587111_0030681 3300060346 Bacteria 1096

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0067454 Ga0373937_0067454_222_638 107
2 3300049592 Ga0501076_0109780 Ga0501076_0109780_818_1234 109
3 3300006871 Ga0075434_102132290 Ga0075434_1021322901 111
4 3300050512 nmdc:mga0n895_1426208_c1 nmdc:mga0n895_1426208_c1_175_594 111
5 3300046455 Ga0495603_0002329 Ga0495603_0002329_1315_1713 113
6 3300048903 Ga0496100_0958401 Ga0496100_0958401_11_421 113
7 3300005339 Ga0070660_100778651 Ga0070660_1007786512 115
8 3300005366 Ga0070659_100047450 Ga0070659_1000474501 115
9 3300005436 Ga0070713_100000009 Ga0070713_10000000964 115
10 3300009098 Ga0105245_10126157 Ga0105245_101261573 115
11 3300025928 Ga0207700_10000025 Ga0207700_1000002564 115
12 3300046681 Ga0495647_0000025 Ga0495647_0000025_32923_33336 115
13 3300047317 Ga0495604_0898344 Ga0495604_0898344_96_509 115
14 3300005544 Ga0070686_101140730 Ga0070686_1011407301 116
15 3300005578 Ga0068854_100124925 Ga0068854_1001249255 116
16 3300013296 Ga0157374_10027456 Ga0157374_100274562 116
17 3300013308 Ga0157375_10953394 Ga0157375_109533942 116
18 3300025904 Ga0207647_10453445 Ga0207647_104534452 116
19 3300025927 Ga0207687_10062230 Ga0207687_100622303 116
20 3300025934 Ga0207686_10111897 Ga0207686_101118973 116
21 3300025981 Ga0207640_10108244 Ga0207640_101082442 116
22 3300026041 Ga0207639_11595901 Ga0207639_115959011 116
23 3300047322 Ga0495680_0000061 Ga0495680_0000061_78799_79212 116
24 3300005329 Ga0070683_100014719 Ga0070683_1000147196 117
25 3300006175 Ga0070712_100132863 Ga0070712_1001328632 117
26 3300006846 Ga0075430_100285362 Ga0075430_1002853622 117
27 3300012507 Ga0157342_1065384 Ga0157342_10653841 117
28 3300013296 Ga0157374_10002990 Ga0157374_1000299011 117
29 3300014326 Ga0157380_10004918 Ga0157380_100049184 117
30 3300025944 Ga0207661_10059556 Ga0207661_100595563 117
31 3300044694 Ga0466963_0000023 Ga0466963_0000023_37447_37860 117
32 3300046463 Ga0495653_0110641 Ga0495653_0110641_224_637 117
33 3300046535 Ga0495586_0008444 Ga0495586_0008444_1602_2015 117
34 3300046691 Ga0495670_0024598 Ga0495670_0024598_1242_1655 117
35 3300047321 Ga0495676_0001652 Ga0495676_0001652_2474_2890 117
36 3300053077 Ga0495601_0003202 Ga0495601_0003202_312_728 117
37 3300053077 Ga0495601_0353713 Ga0495601_0353713_121_534 117
38 3300053078 Ga0495612_0051682 Ga0495612_0051682_663_1076 117
39 3300053084 Ga0495595_0000278 Ga0495595_0000278_8616_9029 117
40 3300005354 Ga0070675_100000053 Ga0070675_10000005353 118
41 3300005539 Ga0068853_100041088 Ga0068853_1000410882 118
42 3300013297 Ga0157378_10034101 Ga0157378_100341012 118
43 3300013308 Ga0157375_11548868 Ga0157375_115488682 118
44 3300025915 Ga0207693_10027373 Ga0207693_100273734 118
45 3300025926 Ga0207659_10000010 Ga0207659_10000010246 118
46 3300026041 Ga0207639_10004255 Ga0207639_100042552 118
47 3300046454 Ga0495592_0085377 Ga0495592_0085377_393_806 118
48 3300046529 Ga0495652_0331252 Ga0495652_0331252_140_553 118
49 3300046536 Ga0495587_0109159 Ga0495587_0109159_1101_1514 118
50 3300046543 Ga0495645_0339575 Ga0495645_0339575_435_848 118
51 3300048913 Ga0496110_0024424 Ga0496110_0024424_2595_3008 118
52 3300005438 Ga0070701_10356692 Ga0070701_103566921 119
53 3300005547 Ga0070693_100030569 Ga0070693_1000305692 119
54 3300005614 Ga0068856_100085723 Ga0068856_1000857232 119
55 3300005614 Ga0068856_100665929 Ga0068856_1006659292 119
56 3300005719 Ga0068861_101081279 Ga0068861_1010812791 119
57 3300026078 Ga0207702_10011070 Ga0207702_100110702 119
58 3300026118 Ga0207675_100366960 Ga0207675_1003669602 119
59 3300046511 Ga0495608_0000204 Ga0495608_0000204_35775_36185 119
60 3300046690 Ga0495624_0000009 Ga0495624_0000009_123599_124012 119
61 3300048088 Ga0495602_0207508 Ga0495602_0207508_156_569 119
62 3300005367 Ga0070667_100160383 Ga0070667_1001603832 120
63 3300017792 Ga0163161_10601004 Ga0163161_106010041 120
64 3300025986 Ga0207658_10163100 Ga0207658_101631002 120
65 3300048088 Ga0495602_0001790 Ga0495602_0001790_3083_3496 120
66 3300053077 Ga0495601_0362736 Ga0495601_0362736_247_645 120
67 3300005329 Ga0070683_100095631 Ga0070683_1000956313 121
68 3300005344 Ga0070661_101194180 Ga0070661_1011941802 121
69 3300005455 Ga0070663_101398771 Ga0070663_1013987711 121
70 3300005564 Ga0070664_100330991 Ga0070664_1003309912 121
71 3300005614 Ga0068856_101728836 Ga0068856_1017288362 121
72 3300009098 Ga0105245_10825863 Ga0105245_108258632 121
73 3300025920 Ga0207649_10632247 Ga0207649_106322472 121
74 3300025944 Ga0207661_10110791 Ga0207661_101107912 121
75 3300025945 Ga0207679_10550695 Ga0207679_105506952 121
76 3300026078 Ga0207702_10383946 Ga0207702_103839462 121
77 3300046463 Ga0495653_0144466 Ga0495653_0144466_19_429 121
78 3300046517 Ga0495630_0083662 Ga0495630_0083662_1868_2281 121
79 3300046559 Ga0495667_0000032 Ga0495667_0000032_94375_94785 121
80 3300047322 Ga0495680_0048281 Ga0495680_0048281_1299_1709 121
81 3300048912 Ga0496109_0297664 Ga0496109_0297664_458_871 121
82 3300048913 Ga0496110_0027983 Ga0496110_0027983_1268_1681 121
83 3300048915 Ga0496112_0269127 Ga0496112_0269127_297_710 121
84 3300005549 Ga0070704_101009150 Ga0070704_1010091501 122
85 3300046454 Ga0495592_0205104 Ga0495592_0205104_364_777 122
86 3300046463 Ga0495653_0765501 Ga0495653_0765501_45_458 122
87 3300046476 Ga0495662_0681780 Ga0495662_0681780_41_454 122
88 3300046514 Ga0495618_0314870 Ga0495618_0314870_165_578 122
89 3300046516 Ga0495628_0075988 Ga0495628_0075988_1884_2297 122
90 3300046529 Ga0495652_0886521 Ga0495652_0886521_106_519 122
91 3300046533 Ga0495640_0156433 Ga0495640_0156433_11_424 122
92 3300046642 Ga0495634_0000401 Ga0495634_0000401_10253_10666 122
93 3300046680 Ga0495646_0240961 Ga0495646_0240961_369_782 122
94 3300047319 Ga0495674_0275268 Ga0495674_0275268_351_764 122
95 3300053078 Ga0495612_0000098 Ga0495612_0000098_28457_28870 122
96 3300053085 Ga0495619_0001794 Ga0495619_0001794_5668_6078 122
97 3300003659 JGI25404J52841_10015487 JGI25404J52841_100154872 123
98 3300005983 Ga0081540_1000006 Ga0081540_1000006190 123
99 3300046660 Ga0495625_0000122 Ga0495625_0000122_23460_23870 123
100 3300046809 Ga0495600_0047885 Ga0495600_0047885_1544_1957 123
101 3300048915 Ga0496112_0000003 Ga0496112_0000003_146649_147059 123
102 3300005334 Ga0068869_101057597 Ga0068869_1010575972 124
103 3300005365 Ga0070688_100385631 Ga0070688_1003856312 124
104 3300046529 Ga0495652_0000019 Ga0495652_0000019_121113_121526 124
105 3300046536 Ga0495587_0094193 Ga0495587_0094193_1093_1506 124
106 3300047471 Ga0495684_0229041 Ga0495684_0229041_128_523 124
107 3300046462 Ga0495651_0243423 Ga0495651_0243423_796_1209 125
108 3300046675 Ga0495657_0015704 Ga0495657_0015704_1996_2391 125
109 3300046516 Ga0495628_0436138 Ga0495628_0436138_342_746 126
110 3300047447 Ga0495685_003311 Ga0495685_003311_4343_4738 126
111 3300048088 Ga0495602_0075988 Ga0495602_0075988_481_891 126
112 3300013307 Ga0157372_13456031 Ga0157372_134560311 127
113 3300046543 Ga0495645_0034019 Ga0495645_0034019_2931_3344 127
114 3300046642 Ga0495634_0205860 Ga0495634_0205860_409_807 127
115 3300048088 Ga0495602_0332059 Ga0495602_0332059_321_734 127
116 3300035172 Ga0373955_0410017 Ga0373955_0410017_311_721 128
117 3300036401 Ga0373937_0573873 Ga0373937_0573873_333_743 128
118 3300047322 Ga0495680_0055271 Ga0495680_0055271_519_929 128
119 3300053085 Ga0495619_0002546 Ga0495619_0002546_7869_8279 128
120 3300046557 Ga0495622_0000014 Ga0495622_0000014_8232_8642 129
121 3300046642 Ga0495634_0009982 Ga0495634_0009982_2952_3365 129
122 3300047322 Ga0495680_0008134 Ga0495680_0008134_3121_3531 129
123 3300046461 Ga0495641_0000003 Ga0495641_0000003_208230_208643 130
124 3300046678 Ga0495599_0863998 Ga0495599_0863998_55_468 130
125 3300053123 Ga0500614_000026 Ga0500614_000026_26208_26621 130
126 3300005295 Ga0065707_10294271 Ga0065707_102942711 131
127 3300005338 Ga0068868_100000151 Ga0068868_10000015133 131
128 3300005347 Ga0070668_102114926 Ga0070668_1021149261 131
129 3300005355 Ga0070671_100232413 Ga0070671_1002324132 131
130 3300005841 Ga0068863_100764203 Ga0068863_1007642032 131
131 3300005842 Ga0068858_100757266 Ga0068858_1007572661 131
132 3300025931 Ga0207644_10191026 Ga0207644_101910262 131
133 3300026023 Ga0207677_10000372 Ga0207677_1000037229 131
134 3300026035 Ga0207703_10726636 Ga0207703_107266361 131
135 3300026088 Ga0207641_10516540 Ga0207641_105165402 131
136 3300028381 Ga0268264_11330961 Ga0268264_113309611 131
137 3300036401 Ga0373937_0663929 Ga0373937_0663929_321_731 131
138 3300046454 Ga0495592_0000036 Ga0495592_0000036_41106_41501 131
139 3300046463 Ga0495653_0139882 Ga0495653_0139882_1084_1479 131
140 3300046663 Ga0495635_0000016 Ga0495635_0000016_40826_41236 131
141 3300046681 Ga0495647_0074304 Ga0495647_0074304_851_1246 131
142 3300046690 Ga0495624_0006346 Ga0495624_0006346_7326_7721 131
143 3300046809 Ga0495600_0002157 Ga0495600_0002157_7586_7981 131
144 3300047322 Ga0495680_0093965 Ga0495680_0093965_1456_1851 131
145 3300047444 Ga0495675_0253399 Ga0495675_0253399_610_1005 131
146 3300047446 Ga0495679_008608 Ga0495679_008608_107_520 131
147 3300048907 Ga0496104_0001485 Ga0496104_0001485_2045_2440 131
148 3300048908 Ga0496105_0041031 Ga0496105_0041031_3162_3557 131
149 3300049578 Ga0501042_0040173 Ga0501042_0040173_352_765 131
150 3300053077 Ga0495601_0085110 Ga0495601_0085110_463_858 131
151 3300005329 Ga0070683_100014631 Ga0070683_1000146312 132
152 3300005330 Ga0070690_100064663 Ga0070690_1000646632 132
153 3300005335 Ga0070666_10084154 Ga0070666_100841542 132
154 3300005365 Ga0070688_100249340 Ga0070688_1002493401 132
155 3300005366 Ga0070659_100029340 Ga0070659_1000293402 132
156 3300005455 Ga0070663_100000733 Ga0070663_10000073310 132
157 3300005458 Ga0070681_10561009 Ga0070681_105610091 132
158 3300005530 Ga0070679_100001032 Ga0070679_10000103211 132
159 3300005535 Ga0070684_100069441 Ga0070684_1000694412 132
160 3300005535 Ga0070684_100074903 Ga0070684_1000749032 132
161 3300005614 Ga0068856_100821960 Ga0068856_1008219601 132
162 3300009147 Ga0114129_11034546 Ga0114129_110345462 132
163 3300009545 Ga0105237_10156576 Ga0105237_101565762 132
164 3300009551 Ga0105238_10101068 Ga0105238_101010683 132
165 3300014969 Ga0157376_10926249 Ga0157376_109262492 132
166 3300025903 Ga0207680_10048960 Ga0207680_100489602 132
167 3300025903 Ga0207680_10051529 Ga0207680_100515293 132
168 3300025912 Ga0207707_10197850 Ga0207707_101978502 132
169 3300025921 Ga0207652_10004210 Ga0207652_100042104 132
170 3300025924 Ga0207694_10398944 Ga0207694_103989442 132
171 3300025944 Ga0207661_10525716 Ga0207661_105257162 132
172 3300026067 Ga0207678_10000834 Ga0207678_1000083410 132
173 3300044842 Ga0466957_0156298 Ga0466957_0156298_594_992 132
174 3300046476 Ga0495662_0042482 Ga0495662_0042482_976_1389 132
175 3300046492 Ga0495585_0271212 Ga0495585_0271212_201_599 132
176 3300046516 Ga0495628_0055146 Ga0495628_0055146_599_1012 132
177 3300046517 Ga0495630_0000018 Ga0495630_0000018_120411_120809 132
178 3300046660 Ga0495625_0209494 Ga0495625_0209494_105_503 132
179 3300046681 Ga0495647_0000655 Ga0495647_0000655_5322_5720 132
180 3300046684 Ga0495669_0343375 Ga0495669_0343375_159_572 132
181 3300046809 Ga0495600_0003562 Ga0495600_0003562_1370_1768 132
182 3300047471 Ga0495684_0607407 Ga0495684_0607407_231_629 132
183 3300048088 Ga0495602_0000021 Ga0495602_0000021_102045_102443 132
184 3300048911 Ga0496108_0017390 Ga0496108_0017390_2909_3307 132
185 3300048912 Ga0496109_0000028 Ga0496109_0000028_47063_47461 132
186 3300048915 Ga0496112_0313066 Ga0496112_0313066_842_1255 132
187 3300048918 Ga0496115_0623410 Ga0496115_0623410_107_505 132
188 3300048919 Ga0496116_0001188 Ga0496116_0001188_9309_9707 132
189 3300048921 Ga0496118_0356340 Ga0496118_0356340_244_642 132
190 3300048922 Ga0496119_0008937 Ga0496119_0008937_8125_8523 132
191 3300048929 Ga0496126_0189855 Ga0496126_0189855_262_660 132
192 3300049586 Ga0501070_0370778 Ga0501070_0370778_43_456 132
193 3300050507 nmdc:mga05p37_684622_c1 nmdc:mga05p37_684622_c1_581_979 132
194 3300053077 Ga0495601_0000039 Ga0495601_0000039_13756_14154 132
195 3300053119 Ga0500595_039084 Ga0500595_039084_849_1247 132
196 3300045976 Ga0466967_0039088 Ga0466967_0039088_339_743 134
197 3300046463 Ga0495653_0637180 Ga0495653_0637180_147_551 134
198 3300046517 Ga0495630_0003066 Ga0495630_0003066_6518_6922 134
199 3300053077 Ga0495601_0005132 Ga0495601_0005132_5404_5808 134
200 3300053078 Ga0495612_0045894 Ga0495612_0045894_363_767 134
201 3300053084 Ga0495595_0654087 Ga0495595_0654087_16_420 134
202 3300046459 Ga0495629_0219311 Ga0495629_0219311_608_1015 135
203 3300046511 Ga0495608_0888409 Ga0495608_0888409_14_421 135
204 3300046642 Ga0495634_0002056 Ga0495634_0002056_15467_15874 135
205 3300046809 Ga0495600_0241179 Ga0495600_0241179_206_613 135
206 3300047673 Ga0495593_0144583 Ga0495593_0144583_369_776 135
207 3300053085 Ga0495619_0288670 Ga0495619_0288670_276_683 135
208 3300053096 Ga0500641_0001950 Ga0500641_0001950_4959_5366 135
209 3300003203 JGI25406J46586_10052908 JGI25406J46586_100529082 136
210 3300005439 Ga0070711_100030128 Ga0070711_1000301283 136
211 3300005456 Ga0070678_100651671 Ga0070678_1006516711 136
212 3300005459 Ga0068867_100001857 Ga0068867_1000018578 136
213 3300005548 Ga0070665_100181529 Ga0070665_1001815293 136
214 3300005985 Ga0081539_10003705 Ga0081539_1000370511 136
215 3300006846 Ga0075430_100097487 Ga0075430_1000974872 136
216 3300014325 Ga0163163_10491047 Ga0163163_104910472 136
217 3300025916 Ga0207663_10023250 Ga0207663_100232503 136
218 3300025925 Ga0207650_11093265 Ga0207650_110932651 136
219 3300025972 Ga0207668_10664988 Ga0207668_106649881 136
220 3300026089 Ga0207648_10004376 Ga0207648_1000437611 136
221 3300026121 Ga0207683_10543149 Ga0207683_105431492 136
222 3300028379 Ga0268266_10189681 Ga0268266_101896812 136
223 3300037588 Ga0316581_0030368 Ga0316581_0030368_61_471 136
224 3300046459 Ga0495629_0694333 Ga0495629_0694333_178_588 136
225 3300046499 Ga0495594_0000003 Ga0495594_0000003_58838_59248 136
226 3300046516 Ga0495628_0014361 Ga0495628_0014361_5271_5681 136
227 3300046518 Ga0495631_0207331 Ga0495631_0207331_358_768 136
228 3300046533 Ga0495640_0045726 Ga0495640_0045726_2166_2576 136
229 3300046535 Ga0495586_0551983 Ga0495586_0551983_135_545 136
230 3300046539 Ga0495621_0001642 Ga0495621_0001642_1331_1741 136
231 3300046689 Ga0495613_0000152 Ga0495613_0000152_17804_18214 136
232 3300047319 Ga0495674_0000731 Ga0495674_0000731_18918_19328 136
233 3300047319 Ga0495674_0487918 Ga0495674_0487918_256_666 136
234 3300047472 Ga0495686_0087393 Ga0495686_0087393_407_817 136
235 3300047472 Ga0495686_0176890 Ga0495686_0176890_533_943 136
236 3300048905 Ga0496102_0400702 Ga0496102_0400702_477_887 136
237 3300048905 Ga0496102_1368826 Ga0496102_1368826_42_452 136
238 3300048906 Ga0496103_0298427 Ga0496103_0298427_306_716 136
239 3300048909 Ga0496106_1414034 Ga0496106_1414034_66_476 136
240 3300048921 Ga0496118_0287949 Ga0496118_0287949_68_478 136
241 3300049578 Ga0501042_0122140 Ga0501042_0122140_701_1111 136
242 3300049588 Ga0501072_0655142 Ga0501072_0655142_356_766 136
243 3300060346 Ga0587111_0030681 Ga0587111_0030681_50_460 136
244 3300001979 JGI24740J21852_10001166 JGI24740J21852_100011665 137
245 3300002070 JGI24750J21931_1011699 JGI24750J21931_10116992 137
246 3300005328 Ga0070676_11596212 Ga0070676_115962121 137
247 3300005329 Ga0070683_100082677 Ga0070683_1000826772 137
248 3300005335 Ga0070666_10085298 Ga0070666_100852982 137
249 3300005337 Ga0070682_100000045 Ga0070682_1000000454 137
250 3300005340 Ga0070689_100454757 Ga0070689_1004547572 137
251 3300005341 Ga0070691_10527114 Ga0070691_105271142 137
252 3300005344 Ga0070661_101108042 Ga0070661_1011080421 137
253 3300005347 Ga0070668_100007876 Ga0070668_1000078762 137
254 3300005353 Ga0070669_102027761 Ga0070669_1020277611 137
255 3300005365 Ga0070688_100000300 Ga0070688_1000003002 137
256 3300005365 Ga0070688_100026227 Ga0070688_1000262271 137
257 3300005367 Ga0070667_100000695 Ga0070667_10000069530 137
258 3300005434 Ga0070709_11114166 Ga0070709_111141662 137
259 3300005435 Ga0070714_101836318 Ga0070714_1018363182 137
260 3300005436 Ga0070713_100098504 Ga0070713_1000985043 137
261 3300005439 Ga0070711_100046597 Ga0070711_1000465971 137
262 3300005457 Ga0070662_100000016 Ga0070662_10000001650 137
263 3300005466 Ga0070685_10000320 Ga0070685_100003202 137
264 3300005466 Ga0070685_10074371 Ga0070685_100743712 137
265 3300005535 Ga0070684_100004338 Ga0070684_1000043383 137
266 3300005535 Ga0070684_100153456 Ga0070684_1001534561 137
267 3300005548 Ga0070665_100000244 Ga0070665_10000024461 137
268 3300005548 Ga0070665_100101307 Ga0070665_1001013072 137
269 3300005578 Ga0068854_100000031 Ga0068854_10000003175 137
270 3300005578 Ga0068854_101148616 Ga0068854_1011486162 137
271 3300005614 Ga0068856_100029863 Ga0068856_1000298634 137
272 3300005616 Ga0068852_100000296 Ga0068852_1000002965 137
273 3300005617 Ga0068859_101225111 Ga0068859_1012251112 137
274 3300005718 Ga0068866_10007339 Ga0068866_100073392 137
275 3300005840 Ga0068870_10276414 Ga0068870_102764142 137
276 3300005841 Ga0068863_100126717 Ga0068863_1001267172 137
277 3300005842 Ga0068858_100001207 Ga0068858_1000012074 137
278 3300005842 Ga0068858_101115132 Ga0068858_1011151321 137
279 3300005843 Ga0068860_100118668 Ga0068860_1001186682 137
280 3300005844 Ga0068862_100011108 Ga0068862_1000111082 137
281 3300005937 Ga0081455_10028013 Ga0081455_100280134 137
282 3300005937 Ga0081455_10756302 Ga0081455_107563022 137
283 3300006163 Ga0070715_10102783 Ga0070715_101027832 137
284 3300006847 Ga0075431_100124971 Ga0075431_1001249712 137
285 3300006871 Ga0075434_100704813 Ga0075434_1007048132 137
286 3300006931 Ga0097620_101224991 Ga0097620_1012249912 137
287 3300009093 Ga0105240_10610955 Ga0105240_106109552 137
288 3300009098 Ga0105245_12511221 Ga0105245_125112212 137
289 3300009101 Ga0105247_10000322 Ga0105247_1000032230 137
290 3300009101 Ga0105247_11159404 Ga0105247_111594041 137
291 3300009148 Ga0105243_10214663 Ga0105243_102146632 137
292 3300009174 Ga0105241_11020936 Ga0105241_110209362 137
293 3300009176 Ga0105242_10000194 Ga0105242_1000019447 137
294 3300009176 Ga0105242_10000819 Ga0105242_1000081921 137
295 3300009176 Ga0105242_10011158 Ga0105242_100111582 137
296 3300009177 Ga0105248_10000118 Ga0105248_1000011846 137
297 3300009553 Ga0105249_10022982 Ga0105249_100229822 137
298 3300010375 Ga0105239_10290845 Ga0105239_102908452 137
299 3300010375 Ga0105239_10545647 Ga0105239_105456471 137
300 3300013105 Ga0157369_10222650 Ga0157369_102226502 137
301 3300013307 Ga0157372_11238473 Ga0157372_112384732 137
302 3300013307 Ga0157372_12125008 Ga0157372_121250082 137
303 3300013308 Ga0157375_10049542 Ga0157375_100495423 137
304 3300013308 Ga0157375_11657936 Ga0157375_116579361 137
305 3300014325 Ga0163163_10253003 Ga0163163_102530032 137
306 3300014968 Ga0157379_10069272 Ga0157379_100692723 137
307 3300014969 Ga0157376_10279143 Ga0157376_102791432 137
308 3300014969 Ga0157376_13140800 Ga0157376_131408001 137
309 3300017792 Ga0163161_10588585 Ga0163161_105885852 137
310 3300025899 Ga0207642_10000222 Ga0207642_100002229 137
311 3300025899 Ga0207642_10188388 Ga0207642_101883882 137
312 3300025900 Ga0207710_10000158 Ga0207710_1000015850 137
313 3300025908 Ga0207643_10215442 Ga0207643_102154421 137
314 3300025914 Ga0207671_10719258 Ga0207671_107192582 137
315 3300025916 Ga0207663_10045560 Ga0207663_100455602 137
316 3300025928 Ga0207700_10077057 Ga0207700_100770573 137
317 3300025929 Ga0207664_10396176 Ga0207664_103961762 137
318 3300025929 Ga0207664_11056118 Ga0207664_110561182 137
319 3300025932 Ga0207690_10010287 Ga0207690_100102873 137
320 3300025933 Ga0207706_10000068 Ga0207706_1000006850 137
321 3300025934 Ga0207686_10000033 Ga0207686_10000033136 137
322 3300025934 Ga0207686_10000428 Ga0207686_1000042812 137
323 3300025934 Ga0207686_10065250 Ga0207686_100652503 137
324 3300025935 Ga0207709_10207945 Ga0207709_102079452 137
325 3300025937 Ga0207669_10000004 Ga0207669_1000000489 137
326 3300025937 Ga0207669_10706682 Ga0207669_107066822 137
327 3300025941 Ga0207711_10000020 Ga0207711_10000020117 137
328 3300025944 Ga0207661_10000492 Ga0207661_100004922 137
329 3300025944 Ga0207661_10003810 Ga0207661_100038109 137
330 3300025945 Ga0207679_11581934 Ga0207679_115819341 137
331 3300025961 Ga0207712_10012842 Ga0207712_100128422 137
332 3300025972 Ga0207668_10002301 Ga0207668_1000230110 137
333 3300025972 Ga0207668_10644640 Ga0207668_106446402 137
334 3300025981 Ga0207640_10000015 Ga0207640_10000015141 137
335 3300025986 Ga0207658_10002223 Ga0207658_1000222312 137
336 3300026035 Ga0207703_10000322 Ga0207703_1000032255 137
337 3300026035 Ga0207703_10894558 Ga0207703_108945581 137
338 3300026078 Ga0207702_10000607 Ga0207702_100006072 137
339 3300026078 Ga0207702_10034330 Ga0207702_100343304 137
340 3300026088 Ga0207641_10005415 Ga0207641_100054153 137
341 3300026116 Ga0207674_10316510 Ga0207674_103165102 137
342 3300026142 Ga0207698_10000012 Ga0207698_10000012117 137
343 3300028379 Ga0268266_10000020 Ga0268266_1000002059 137
344 3300028380 Ga0268265_10000555 Ga0268265_100005554 137
345 3300028381 Ga0268264_10273527 Ga0268264_102735272 137
346 3300028381 Ga0268264_10827050 Ga0268264_108270502 137
347 3300028800 Ga0265338_11039851 Ga0265338_110398511 137
348 3300041459 Ga0451800_0178548 Ga0451800_0178548_310_723 137
349 3300041491 Ga0451833_0877887 Ga0451833_0877887_194_607 137
350 3300041505 Ga0451849_0726868 Ga0451849_0726868_54_467 137
351 3300041512 Ga0451853_1910385 Ga0451853_1910385_1077_1490 137
352 3300044694 Ga0466963_0018584 Ga0466963_0018584_2441_2854 137
353 3300044842 Ga0466957_0009547 Ga0466957_0009547_982_1395 137
354 3300045976 Ga0466967_0897786 Ga0466967_0897786_135_548 137
355 3300046454 Ga0495592_0161413 Ga0495592_0161413_877_1290 137
356 3300046454 Ga0495592_0518170 Ga0495592_0518170_169_582 137
357 3300046459 Ga0495629_0005717 Ga0495629_0005717_5415_5828 137
358 3300046459 Ga0495629_0043027 Ga0495629_0043027_785_1198 137
359 3300046459 Ga0495629_0239110 Ga0495629_0239110_729_1142 137
360 3300046461 Ga0495641_0348200 Ga0495641_0348200_188_601 137
361 3300046462 Ga0495651_0663183 Ga0495651_0663183_186_599 137
362 3300046473 Ga0495582_0000029 Ga0495582_0000029_46100_46513 137
363 3300046476 Ga0495662_0009006 Ga0495662_0009006_2167_2580 137
364 3300046511 Ga0495608_0000031 Ga0495608_0000031_124163_124576 137
365 3300046511 Ga0495608_0197009 Ga0495608_0197009_810_1223 137
366 3300046516 Ga0495628_0000924 Ga0495628_0000924_16560_16973 137
367 3300046516 Ga0495628_0089843 Ga0495628_0089843_328_741 137
368 3300046517 Ga0495630_0547242 Ga0495630_0547242_389_802 137
369 3300046523 Ga0495644_0000832 Ga0495644_0000832_10880_11293 137
370 3300046537 Ga0495598_0074837 Ga0495598_0074837_96_509 137
371 3300046543 Ga0495645_0010791 Ga0495645_0010791_3602_4015 137
372 3300046616 Ga0495668_0203108 Ga0495668_0203108_605_1024 137
373 3300046663 Ga0495635_0035390 Ga0495635_0035390_2360_2773 137
374 3300046675 Ga0495657_0000024 Ga0495657_0000024_124163_124576 137
375 3300046678 Ga0495599_0243117 Ga0495599_0243117_591_1004 137
376 3300046679 Ga0495623_0526843 Ga0495623_0526843_80_493 137
377 3300046683 Ga0495658_0000026 Ga0495658_0000026_31430_31843 137
378 3300046683 Ga0495658_0042534 Ga0495658_0042534_575_988 137
379 3300046689 Ga0495613_0000073 Ga0495613_0000073_24433_24846 137
380 3300046689 Ga0495613_0284123 Ga0495613_0284123_614_1027 137
381 3300046691 Ga0495670_0789809 Ga0495670_0789809_70_489 137
382 3300046694 Ga0495649_0071875 Ga0495649_0071875_408_821 137
383 3300047317 Ga0495604_0000985 Ga0495604_0000985_3261_3674 137
384 3300047321 Ga0495676_0008238 Ga0495676_0008238_6690_7103 137
385 3300047321 Ga0495676_0659962 Ga0495676_0659962_44_457 137
386 3300047444 Ga0495675_0000428 Ga0495675_0000428_20680_21093 137
387 3300047673 Ga0495593_0021701 Ga0495593_0021701_2992_3405 137
388 3300047673 Ga0495593_0072010 Ga0495593_0072010_10_423 137
389 3300048088 Ga0495602_0450845 Ga0495602_0450845_98_511 137
390 3300048903 Ga0496100_0000002 Ga0496100_0000002_187920_188333 137
391 3300048903 Ga0496100_0000018 Ga0496100_0000018_15545_15958 137
392 3300048904 Ga0496101_0000001 Ga0496101_0000001_187920_188333 137
393 3300048904 Ga0496101_0000221 Ga0496101_0000221_25206_25619 137
394 3300048905 Ga0496102_0457374 Ga0496102_0457374_464_883 137
395 3300048906 Ga0496103_0670243 Ga0496103_0670243_115_528 137
396 3300048907 Ga0496104_0000004 Ga0496104_0000004_75467_75880 137
397 3300048907 Ga0496104_0041622 Ga0496104_0041622_187_600 137
398 3300048908 Ga0496105_0000001 Ga0496105_0000001_565951_566364 137
399 3300048909 Ga0496106_0000018 Ga0496106_0000018_157762_158175 137
400 3300048909 Ga0496106_0000955 Ga0496106_0000955_11237_11650 137
401 3300048910 Ga0496107_0000006 Ga0496107_0000006_84468_84881 137
402 3300048910 Ga0496107_0000013 Ga0496107_0000013_15642_16055 137
403 3300048911 Ga0496108_0008881 Ga0496108_0008881_6248_6661 137
404 3300048912 Ga0496109_0009763 Ga0496109_0009763_6291_6704 137
405 3300048912 Ga0496109_1387072 Ga0496109_1387072_70_489 137
406 3300048913 Ga0496110_0007855 Ga0496110_0007855_7143_7556 137
407 3300048914 Ga0496111_0005935 Ga0496111_0005935_7275_7688 137
408 3300048915 Ga0496112_1015333 Ga0496112_1015333_118_531 137
409 3300048916 Ga0496113_0315175 Ga0496113_0315175_341_754 137
410 3300048916 Ga0496113_0474249 Ga0496113_0474249_549_965 137
411 3300048917 Ga0496114_0000014 Ga0496114_0000014_136396_136809 137
412 3300048917 Ga0496114_0621816 Ga0496114_0621816_182_595 137
413 3300048918 Ga0496115_0000003 Ga0496115_0000003_302761_303174 137
414 3300048918 Ga0496115_0000989 Ga0496115_0000989_10536_10949 137
415 3300048922 Ga0496119_0027787 Ga0496119_0027787_53_466 137
416 3300048923 Ga0496120_0223653 Ga0496120_0223653_353_766 137
417 3300048923 Ga0496120_0264015 Ga0496120_0264015_321_734 137
418 3300048924 Ga0496121_0244442 Ga0496121_0244442_619_1032 137
419 3300048929 Ga0496126_0012897 Ga0496126_0012897_7839_8252 137
420 3300048929 Ga0496126_0092924 Ga0496126_0092924_284_697 137
421 3300049569 Ga0501032_0567754 Ga0501032_0567754_223_636 137
422 3300049577 Ga0501041_0340156 Ga0501041_0340156_213_626 137
423 3300049578 Ga0501042_0229840 Ga0501042_0229840_754_1167 137
424 3300049579 Ga0501043_0933235 Ga0501043_0933235_158_571 137
425 3300049582 Ga0501048_0754021 Ga0501048_0754021_132_545 137
426 3300049588 Ga0501072_0066421 Ga0501072_0066421_434_847 137
427 3300049591 Ga0501075_0002587 Ga0501075_0002587_10789_11202 137
428 3300050510 nmdc:mga06r32_791923_c1 nmdc:mga06r32_791923_c1_134_553 137
429 3300053077 Ga0495601_0298171 Ga0495601_0298171_260_673 137
430 3300053077 Ga0495601_0649817 Ga0495601_0649817_201_614 137
431 3300053078 Ga0495612_0321120 Ga0495612_0321120_53_466 137
432 3300053083 Ga0495655_0129245 Ga0495655_0129245_98_511 137
433 3300053084 Ga0495595_0000014 Ga0495595_0000014_20680_21093 137
434 3300053085 Ga0495619_0000147 Ga0495619_0000147_20680_21093 137
435 3300053085 Ga0495619_0033241 Ga0495619_0033241_20_433 137
436 3300053094 Ga0500566_0002905 Ga0500566_0002905_4556_4969 137

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

7

88

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.9466 12 84
3g7c-assembly1.cif.gz_A structure of the phosphorylation mimetic of occludin c-term tail 0.9421 94 129
1wpa-assembly1.cif.gz_A 1.5 angstrom crystal structure of human occludin fragment 413-522 0.9404 94 129
1h8e-assembly1.cif.gz_H (adp.alf4)2(adp.so4) bovine f1-atpase (all three catalytic sites occupied) 0.9312 7 92
7nk9-assembly1.cif.gz_H mycobacterium smegmatis atp synthase fo domain state 1 0.9201 23 81
ID Description Score Start End Superfamily
af_E9QIC8_1_716_1.20.900.10 Mainly Alpha;Up-down Bundle;Dbl Homology Domain; Chain A;Dbl homology (DH) domain 0.9587 94 133 1.20.900.10
af_A4I651_36_136_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9582 5 92 2.60.15.10
1aqtA01 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9553 6 92 2.60.15.10
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.955 6 92 2.60.15.10
5dn6I00 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.9466 12 84 2.60.15.10
ID Description Score Start End GO Terms
AF-A0A537XGE3-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9892 3 137 GO:0005524
GO:0005886
GO:0045261
GO:0046933
AF-A0A7C6J5G2-F1-model_v4 F0F1 ATP synthase subunit epsilon 0.9887 5 86 GO:0012505
GO:0045261
GO:0046933
AF-A0A7Y1Y0Y3-F1-model_v4 ATP synthase F1 subunit epsilon 0.987 7 84 GO:0012505
GO:0045261
GO:0046933
AF-A0A7V9PPK9-F1-model_v4 ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) 0.9852 3 137 GO:0005524
GO:0005886
GO:0045261
GO:0046933
AF-A0A7V8W9Q4-F1-model_v4 ATP synthase F1 subunit epsilon 0.9845 12 136 GO:0005524
GO:0005886
GO:0045261
GO:0046933

Feature Viewer

pLDDT pTM Quality
94.75 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map