F443499

General Info

Members Datasets Scaffolds Average Seq Length
436 228 872 223

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100010670|Ga0070696_1000106702
Length 204
Sequence MKVLLVEDDVELTEILRQGFAEHGIRTTCAATFDEGQSRAALGTYDVIILDVLLPGGDGFQLCGNIRKRQIATPILMLTALDALNDRVRGLDAGADDYVVKPFAFRELLARVRAVARRPPALASERVVVADLDVDEFALLEFFALHRDRVVDRGAITAHVWDENHDPFTNVLEVLIRRLRRKIDDGFHPKLIHTLRGAGYRFGV

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
146 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
157 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
180 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
191 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
192 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
193 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
194 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0.46
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.92
Rhizosphere 98.85
Stem 0
Stem Tuber 0
Unclassified 0.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100010670 3300005546 Bacteria 6153
2 MBSR1b_contig_509051 2162886012 Bacteria 2225
3 Ga0058863_10068824 3300004799 Bacteria 1345
4 Ga0065712_10200252 3300005290 Unclassified 1111
5 Ga0065715_10000932 3300005293 Bacteria 11360
6 Ga0065715_10136517 3300005293 Bacteria 1921
7 Ga0065715_10383611 3300005293 Bacteria 904
8 Ga0070658_10019462 3300005327 Bacteria 5435
9 Ga0070676_10004793 3300005328 Bacteria 7156
10 Ga0070683_100000243 3300005329 Bacteria 37375
11 Ga0070683_100103159 3300005329 Bacteria 2687
12 Ga0070683_100202811 3300005329 Bacteria 1883
13 Ga0070683_100466845 3300005329 Bacteria 1205
14 Ga0070683_100534017 3300005329 Bacteria 1121
15 Ga0070683_100677975 3300005329 Bacteria 987
16 Ga0068869_100200034 3300005334 Bacteria 1575
17 Ga0070666_10073817 3300005335 Bacteria 2324
18 Ga0070680_100000418 3300005336 Bacteria 29001
19 Ga0070680_100004491 3300005336 Bacteria 10512
20 Ga0070680_100004823 3300005336 Bacteria 10149
21 Ga0070680_100028253 3300005336 Bacteria 4497
22 Ga0070680_100038070 3300005336 Bacteria 3888
23 Ga0070680_100075504 3300005336 Bacteria 2774
24 Ga0070680_100129033 3300005336 Bacteria 2114
25 Ga0070680_100195028 3300005336 Bacteria 1707
26 Ga0070680_100549685 3300005336 Bacteria 990
27 Ga0070682_100001685 3300005337 Bacteria 12266
28 Ga0070682_100007416 3300005337 Bacteria 6186
29 Ga0070682_100050577 3300005337 Bacteria 2595
30 Ga0070682_100269628 3300005337 Bacteria 1236
31 Ga0068868_100015264 3300005338 Bacteria 5678
32 Ga0068868_100030211 3300005338 Bacteria 4154
33 Ga0070660_100318081 3300005339 Bacteria 1278
34 Ga0070689_100136689 3300005340 Bacteria 1968
35 Ga0070691_10055157 3300005341 Bacteria 1903
36 Ga0070687_100051988 3300005343 Bacteria 2124
37 Ga0070661_100012226 3300005344 Bacteria 6003
38 Ga0070661_100164364 3300005344 Bacteria 1682
39 Ga0070661_100376759 3300005344 Bacteria 1118
40 Ga0070692_10014835 3300005345 Bacteria 3670
41 Ga0070668_100033899 3300005347 Bacteria 3890
42 Ga0070668_100361421 3300005347 Bacteria 1231
43 Ga0070669_100069875 3300005353 Bacteria 2594
44 Ga0070675_100066319 3300005354 Bacteria 2985
45 Ga0070675_100423034 3300005354 Bacteria 1191
46 Ga0070671_100002277 3300005355 Bacteria 14817
47 Ga0070671_100130827 3300005355 Bacteria 2114
48 Ga0070671_100366126 3300005355 Bacteria 1231
49 Ga0070674_100026462 3300005356 Bacteria 3790
50 Ga0070674_100526697 3300005356 Bacteria 988
51 Ga0070673_100160328 3300005364 Bacteria 1912
52 Ga0070688_100027312 3300005365 Bacteria 3399
53 Ga0070667_100247971 3300005367 Bacteria 1591
54 Ga0070667_100381964 3300005367 Bacteria 1279
55 Ga0070709_10008797 3300005434 Bacteria 5556
56 Ga0070709_10360253 3300005434 Bacteria 1077
57 Ga0070714_100017850 3300005435 Bacteria 5753
58 Ga0070713_100021940 3300005436 Bacteria 4925
59 Ga0070713_100279925 3300005436 Bacteria 1530
60 Ga0070701_10242254 3300005438 Bacteria 1085
61 Ga0070711_100008891 3300005439 Bacteria 6163
62 Ga0070711_100180459 3300005439 Bacteria 1616
63 Ga0070700_100022627 3300005441 Bacteria 3669
64 Ga0070708_100000035 3300005445 Bacteria 86305
65 Ga0070708_100000043 3300005445 Bacteria 82036
66 Ga0070708_100174903 3300005445 Bacteria 2005
67 Ga0070708_100192518 3300005445 Bacteria 1907
68 Ga0070708_100719414 3300005445 Bacteria 939
69 Ga0070662_100046644 3300005457 Bacteria 3114
70 Ga0070681_10001646 3300005458 Bacteria 19945
71 Ga0070681_10004670 3300005458 Bacteria 13095
72 Ga0070681_10018810 3300005458 Bacteria 6913
73 Ga0070681_10094554 3300005458 Bacteria 2937
74 Ga0070681_10098659 3300005458 Bacteria 2867
75 Ga0070681_10153925 3300005458 Bacteria 2225
76 Ga0070681_10175626 3300005458 Bacteria 2064
77 Ga0070681_10275146 3300005458 Bacteria 1595
78 Ga0070681_10506939 3300005458 Bacteria 1120
79 Ga0068867_100098479 3300005459 Bacteria 2230
80 Ga0070706_100044615 3300005467 Bacteria 4095
81 Ga0070706_100459625 3300005467 Bacteria 1184
82 Ga0070707_100003740 3300005468 Bacteria 14358
83 Ga0070707_100106125 3300005468 Bacteria 2724
84 Ga0070707_100212610 3300005468 Bacteria 1885
85 Ga0070698_100106688 3300005471 Bacteria 2769
86 Ga0070698_100571823 3300005471 Bacteria 1070
87 Ga0070699_100235023 3300005518 Bacteria 1635
88 Ga0070699_100258885 3300005518 Bacteria 1556
89 Ga0070699_100272790 3300005518 Bacteria 1514
90 Ga0070679_100001586 3300005530 Bacteria 20395
91 Ga0070679_100004110 3300005530 Bacteria 13414
92 Ga0070679_100009464 3300005530 Bacteria 9214
93 Ga0070679_100014995 3300005530 Bacteria 7447
94 Ga0070679_100028021 3300005530 Bacteria 5550
95 Ga0070679_100054358 3300005530 Bacteria 3986
96 Ga0070679_100073622 3300005530 Bacteria 3407
97 Ga0070679_100089046 3300005530 Bacteria 3073
98 Ga0070679_100132293 3300005530 Bacteria 2476
99 Ga0070679_100136203 3300005530 Bacteria 2436
100 Ga0070679_100276275 3300005530 Bacteria 1633
101 Ga0070684_100004442 3300005535 Bacteria 10678
102 Ga0070684_100045341 3300005535 Bacteria 3808
103 Ga0070684_100051912 3300005535 Bacteria 3563
104 Ga0070684_100074750 3300005535 Bacteria 2987
105 Ga0070684_100077739 3300005535 Bacteria 2931
106 Ga0070684_100095278 3300005535 Bacteria 2652
107 Ga0070684_100113758 3300005535 Bacteria 2429
108 Ga0070684_100161060 3300005535 Bacteria 2036
109 Ga0070684_100333063 3300005535 Bacteria 1395
110 Ga0070684_100454308 3300005535 Bacteria 1184
111 Ga0070697_100029761 3300005536 Bacteria 4381
112 Ga0070697_100273359 3300005536 Bacteria 1449
113 Ga0068853_100008866 3300005539 Bacteria 8093
114 Ga0068853_100017615 3300005539 Bacteria 5896
115 Ga0070686_100075240 3300005544 Bacteria 2221
116 Ga0070686_100210621 3300005544 Bacteria 1399
117 Ga0070686_100545352 3300005544 Bacteria 906
118 Ga0070695_100002984 3300005545 Bacteria 9860
119 Ga0070696_100005206 3300005546 Bacteria 8695
120 Ga0070696_100161732 3300005546 Bacteria 1650
121 Ga0070693_100005467 3300005547 Bacteria 6111
122 Ga0070693_100030225 3300005547 Bacteria 2960
123 Ga0070693_100289327 3300005547 Bacteria 1100
124 Ga0070665_100294269 3300005548 Bacteria 1626
125 Ga0070704_100051174 3300005549 Bacteria 2908
126 Ga0068855_100003869 3300005563 Bacteria 18295
127 Ga0068855_100016273 3300005563 Bacteria 8944
128 Ga0068855_100050975 3300005563 Bacteria 4876
129 Ga0068855_100371866 3300005563 Bacteria 1571
130 Ga0070664_100007590 3300005564 Bacteria 8756
131 Ga0070664_100076033 3300005564 Bacteria 2885
132 Ga0070664_100147449 3300005564 Bacteria 2076
133 Ga0068857_100272636 3300005577 Bacteria 1555
134 Ga0068857_100500073 3300005577 Bacteria 1141
135 Ga0068854_100031649 3300005578 Bacteria 3677
136 Ga0068854_100038850 3300005578 Bacteria 3350
137 Ga0068854_100117589 3300005578 Bacteria 2013
138 Ga0068854_100451329 3300005578 Bacteria 1074
139 Ga0068856_100005223 3300005614 Bacteria 12814
140 Ga0068856_100110374 3300005614 Bacteria 2747
141 Ga0068859_100647833 3300005617 Bacteria 1148
142 Ga0068859_100658701 3300005617 Bacteria 1139
143 Ga0068864_100284238 3300005618 Bacteria 1545
144 Ga0068866_10075307 3300005718 Bacteria 1797
145 Ga0068863_100122764 3300005841 Bacteria 2478
146 Ga0068858_100221278 3300005842 Bacteria 1793
147 Ga0068862_100184372 3300005844 Bacteria 1875
148 Ga0081455_10044407 3300005937 Bacteria 3877
149 Ga0070716_100003407 3300006173 Bacteria 7479
150 Ga0070712_100220574 3300006175 Unclassified 1501
151 Ga0070712_100799774 3300006175 Bacteria 809
152 Ga0097621_100112958 3300006237 Bacteria 2297
153 Ga0068871_100752791 3300006358 Bacteria 895
154 Ga0075431_100087571 3300006847 Bacteria 3213
155 Ga0075433_10062516 3300006852 Bacteria 3261
156 Ga0075433_10275657 3300006852 Bacteria 1491
157 Ga0075433_10347782 3300006852 Bacteria 1310
158 Ga0075434_100035428 3300006871 Bacteria 4934
159 Ga0075434_100243927 3300006871 Bacteria 1816
160 Ga0075434_100301374 3300006871 Bacteria 1623
161 Ga0075434_100741176 3300006871 Bacteria 999
162 Ga0068865_100188255 3300006881 Bacteria 1594
163 Ga0075436_100010112 3300006914 Bacteria 6458
164 Ga0097620_100647857 3300006931 Bacteria 1148
165 Ga0097620_100658715 3300006931 Bacteria 1139
166 Ga0075435_100147001 3300007076 Bacteria 1980
167 Ga0075435_100163647 3300007076 Bacteria 1875
168 Ga0099795_10007740 3300007788 Bacteria 3021
169 Ga0105240_10032870 3300009093 Bacteria 6709
170 Ga0105240_10066838 3300009093 Bacteria 4458
171 Ga0105240_10409487 3300009093 Bacteria 1525
172 Ga0111539_10085120 3300009094 Bacteria 3716
173 Ga0105245_10040728 3300009098 Bacteria 4140
174 Ga0105245_10174648 3300009098 Bacteria 2048
175 Ga0105245_10416465 3300009098 Bacteria 1346
176 Ga0114129_10009749 3300009147 Bacteria 13697
177 Ga0105241_10000048 3300009174 Bacteria 96112
178 Ga0105241_10620361 3300009174 Bacteria 979
179 Ga0105242_10453372 3300009176 Bacteria 1210
180 Ga0105248_10063086 3300009177 Bacteria 4159
181 Ga0105248_11234500 3300009177 Bacteria 845
182 Ga0105237_10206261 3300009545 Bacteria 1966
183 Ga0105237_10246097 3300009545 Bacteria 1790
184 Ga0105238_10031318 3300009551 Bacteria 5413
185 Ga0105249_10000130 3300009553 Bacteria 99880
186 Ga0157371_10396647 3300013102 Bacteria 1009
187 Ga0157370_10003669 3300013104 Bacteria 17925
188 Ga0157370_10029439 3300013104 Bacteria 5388
189 Ga0157370_10246452 3300013104 Bacteria 1653
190 Ga0157369_10023540 3300013105 Bacteria 6860
191 Ga0157369_10102145 3300013105 Bacteria 3056
192 Ga0157369_10322658 3300013105 Bacteria 1605
193 Ga0157369_10331041 3300013105 Bacteria 1582
194 Ga0157374_10143547 3300013296 Bacteria 2318
195 Ga0157374_10353969 3300013296 Bacteria 1459
196 Ga0157378_10007962 3300013297 Bacteria 9250
197 Ga0157378_10015337 3300013297 Bacteria 6711
198 Ga0157378_10083256 3300013297 Bacteria 2895
199 Ga0157378_10287087 3300013297 Bacteria 1588
200 Ga0163162_11588588 3300013306 Bacteria 746
201 Ga0157372_10004541 3300013307 Bacteria 14780
202 Ga0157372_10056292 3300013307 Bacteria 4393
203 Ga0157372_10216263 3300013307 Bacteria 2221
204 Ga0157372_10339780 3300013307 Bacteria 1749
205 Ga0157372_10442106 3300013307 Bacteria 1516
206 Ga0157375_10036917 3300013308 Bacteria 4677
207 Ga0157375_10202713 3300013308 Bacteria 2140
208 Ga0157375_10359292 3300013308 Bacteria 1622
209 Ga0182008_10002244 3300014497 Bacteria 12226
210 Ga0206353_10727187 3300020082 Bacteria 1026
211 Ga0207692_10271242 3300025898 Bacteria 1023
212 Ga0207699_10038773 3300025906 Unclassified 2733
213 Ga0207645_10092956 3300025907 Bacteria 1940
214 Ga0207705_10014738 3300025909 Bacteria 5621
215 Ga0207705_10817140 3300025909 Bacteria 723
216 Ga0207654_10000076 3300025911 Bacteria 64358
217 Ga0207707_10004489 3300025912 Bacteria 12280
218 Ga0207707_10005846 3300025912 Bacteria 10750
219 Ga0207707_10011846 3300025912 Bacteria 7585
220 Ga0207707_10013626 3300025912 Bacteria 7090
221 Ga0207707_10073932 3300025912 Bacteria 2973
222 Ga0207707_10102501 3300025912 Bacteria 2502
223 Ga0207707_10126240 3300025912 Bacteria 2237
224 Ga0207707_10215115 3300025912 Bacteria 1673
225 Ga0207707_10249733 3300025912 Bacteria 1541
226 Ga0207695_10632968 3300025913 Bacteria 951
227 Ga0207693_10052879 3300025915 Bacteria 3186
228 Ga0207663_10046465 3300025916 Bacteria 2675
229 Ga0207663_10152265 3300025916 Bacteria 1624
230 Ga0207660_10002944 3300025917 Bacteria 11129
231 Ga0207660_10018380 3300025917 Bacteria 4658
232 Ga0207660_10021447 3300025917 Bacteria 4343
233 Ga0207660_10036879 3300025917 Bacteria 3401
234 Ga0207660_10103768 3300025917 Bacteria 2127
235 Ga0207660_10619588 3300025917 Bacteria 882
236 Ga0207662_10026165 3300025918 Bacteria 3365
237 Ga0207662_10098002 3300025918 Bacteria 1813
238 Ga0207657_10159312 3300025919 Bacteria 1834
239 Ga0207652_10003007 3300025921 Bacteria 14076
240 Ga0207652_10010107 3300025921 Bacteria 7601
241 Ga0207652_10037668 3300025921 Bacteria 4093
242 Ga0207652_10039892 3300025921 Bacteria 3986
243 Ga0207652_10043480 3300025921 Bacteria 3825
244 Ga0207652_10056607 3300025921 Bacteria 3376
245 Ga0207652_10075317 3300025921 Bacteria 2941
246 Ga0207652_10081317 3300025921 Bacteria 2834
247 Ga0207652_10155269 3300025921 Bacteria 2050
248 Ga0207652_10299201 3300025921 Bacteria 1452
249 Ga0207646_10002584 3300025922 Bacteria 21375
250 Ga0207646_10047833 3300025922 Bacteria 3835
251 Ga0207646_10085558 3300025922 Bacteria 2820
252 Ga0207681_10060490 3300025923 Bacteria 2600
253 Ga0207681_10263669 3300025923 Bacteria 1350
254 Ga0207659_10261755 3300025926 Bacteria 1407
255 Ga0207687_10076141 3300025927 Bacteria 2409
256 Ga0207700_10027421 3300025928 Bacteria 3988
257 Ga0207644_10002453 3300025931 Bacteria 11966
258 Ga0207644_10366840 3300025931 Bacteria 1172
259 Ga0207690_10150848 3300025932 Bacteria 1723
260 Ga0207706_10009007 3300025933 Bacteria 9185
261 Ga0207686_10069743 3300025934 Bacteria 2256
262 Ga0207670_10238033 3300025936 Bacteria 1401
263 Ga0207669_10078595 3300025937 Bacteria 2103
264 Ga0207704_10418021 3300025938 Bacteria 1062
265 Ga0207665_10006949 3300025939 Bacteria 7490
266 Ga0207665_10107997 3300025939 Bacteria 1952
267 Ga0207665_10313596 3300025939 Bacteria 1175
268 Ga0207691_10822398 3300025940 Bacteria 780
269 Ga0207661_10004512 3300025944 Bacteria 9756
270 Ga0207661_10006540 3300025944 Bacteria 8241
271 Ga0207661_10009206 3300025944 Bacteria 7076
272 Ga0207661_10332997 3300025944 Bacteria 1367
273 Ga0207661_10461386 3300025944 Bacteria 1158
274 Ga0207661_10514319 3300025944 Bacteria 1095
275 Ga0207679_10006154 3300025945 Bacteria 7579
276 Ga0207679_10150520 3300025945 Bacteria 1893
277 Ga0207679_10324938 3300025945 Bacteria 1333
278 Ga0207667_10002379 3300025949 Bacteria 23531
279 Ga0207667_10297525 3300025949 Bacteria 1649
280 Ga0207667_10407778 3300025949 Bacteria 1384
281 Ga0207651_10027883 3300025960 Bacteria 3555
282 Ga0207712_10000377 3300025961 Bacteria 39204
283 Ga0207668_10001660 3300025972 Bacteria 12991
284 Ga0207668_10129626 3300025972 Bacteria 1924
285 Ga0207640_10136618 3300025981 Bacteria 1781
286 Ga0207658_10086841 3300025986 Bacteria 2414
287 Ga0207677_10204629 3300026023 Bacteria 1572
288 Ga0207677_11014000 3300026023 Bacteria 753
289 Ga0207703_10304755 3300026035 Bacteria 1454
290 Ga0207639_10023703 3300026041 Bacteria 4433
291 Ga0207639_10186648 3300026041 Bacteria 1768
292 Ga0207639_10228316 3300026041 Bacteria 1612
293 Ga0207678_10017337 3300026067 Bacteria 6322
294 Ga0207708_10010357 3300026075 Bacteria 6921
295 Ga0207708_10091519 3300026075 Bacteria 2346
296 Ga0207702_10039376 3300026078 Bacteria 3960
297 Ga0207641_10175972 3300026088 Bacteria 1957
298 Ga0207641_10587292 3300026088 Bacteria 1089
299 Ga0207648_10062441 3300026089 Bacteria 3248
300 Ga0207648_10116650 3300026089 Bacteria 2346
301 Ga0207676_10286551 3300026095 Bacteria 1498
302 Ga0207674_10053201 3300026116 Bacteria 4127
303 Ga0207674_10190704 3300026116 Bacteria 1999
304 Ga0207683_10055046 3300026121 Bacteria 3489
305 Ga0268266_10121517 3300028379 Bacteria 2325
306 Ga0307408_100270576 3300031548 Bacteria 1410
307 Ga0307405_10269335 3300031731 Bacteria 1276
308 Ga0307413_10002000 3300031824 Bacteria 8101
309 Ga0307406_10009481 3300031901 Bacteria 5460
310 Ga0307407_10023396 3300031903 Bacteria 3223
311 Ga0307409_100016189 3300031995 Bacteria 4925
312 Ga0307416_100016384 3300032002 Bacteria 5151
313 Ga0307414_10038464 3300032004 Bacteria 3213
314 Ga0307411_10010780 3300032005 Bacteria 4892
315 Ga0307415_100022141 3300032126 Bacteria 3918
316 Ga0373934_0004308 3300035086 Bacteria 5253
317 Ga0373934_0182346 3300035086 Bacteria 863
318 Ga0373951_0008240 3300035091 Bacteria 2360
319 Ga0373941_0008999 3300035115 Bacteria 2503
320 Ga0373953_0041146 3300035117 Bacteria 1838
321 Ga0373956_0061481 3300035119 Bacteria 1702
322 Ga0373956_0110221 3300035119 Bacteria 1281
323 Ga0373957_0077758 3300035120 Bacteria 1306
324 Ga0373960_0035591 3300035121 Bacteria 1414
325 Ga0373955_0143735 3300035172 Bacteria 1400
326 Ga0373961_0012397 3300035241 Bacteria 2134
327 Ga0373935_0065621 3300035692 Bacteria 2330
328 Ga0373935_0332691 3300035692 Bacteria 1080
329 Ga0373927_0007344 3300035695 Bacteria 7460
330 Ga0373927_0079639 3300035695 Bacteria 2123
331 Ga0373933_0023842 3300035724 Bacteria 3500
332 Ga0373933_0027805 3300035724 Bacteria 3260
333 Ga0373933_0146285 3300035724 Bacteria 1494
334 Ga0373947_0260859 3300035725 Bacteria 1148
335 Ga0373947_0379569 3300035725 Bacteria 951
336 Ga0373947_0427344 3300035725 Bacteria 896
337 Ga0373937_0004785 3300036401 Bacteria 11498
338 Ga0373937_0010707 3300036401 Bacteria 8022
339 Ga0373937_0020713 3300036401 Bacteria 5897
340 Ga0373937_0671597 3300036401 Bacteria 982
341 Ga0373925_0097751 3300037068 Bacteria 2252
342 Ga0436365_1515189 3300039437 Bacteria 3382
343 Ga0466961_0102464 3300044693 Bacteria 1803
344 Ga0466963_0119510 3300044694 Bacteria 1813
345 Ga0451576_0069648 3300045051 Bacteria 3661
346 Ga0451576_0520698 3300045051 Bacteria 1249
347 Ga0466967_0459446 3300045976 Bacteria 1245
348 Ga0495592_0238614 3300046454 Bacteria 1207
349 Ga0495629_0200900 3300046459 Bacteria 1378
350 Ga0495651_0094223 3300046462 Bacteria 2241
351 Ga0495651_0184381 3300046462 Bacteria 1474
352 Ga0495651_0228397 3300046462 Bacteria 1283
353 Ga0495653_0316789 3300046463 Bacteria 1012
354 Ga0495580_0032828 3300046472 Bacteria 3742
355 Ga0495580_0041697 3300046472 Bacteria 3272
356 Ga0495580_0364690 3300046472 Bacteria 977
357 Ga0495582_0017381 3300046473 Bacteria 3936
358 Ga0495639_0021989 3300046475 Bacteria 2795
359 Ga0495639_0123042 3300046475 Bacteria 1238
360 Ga0495594_0004660 3300046499 Bacteria 7068
361 Ga0495594_0016662 3300046499 Bacteria 3874
362 Ga0495594_0055411 3300046499 Bacteria 2186
363 Ga0495594_0078826 3300046499 Bacteria 1838
364 Ga0495608_0027867 3300046511 Bacteria 3841
365 Ga0495628_0040471 3300046516 Bacteria 3724
366 Ga0495628_0056628 3300046516 Bacteria 3085
367 Ga0495628_0369527 3300046516 Bacteria 1052
368 Ga0495630_0111270 3300046517 Bacteria 2074
369 Ga0495666_0056659 3300046526 Bacteria 1877
370 Ga0495652_0020183 3300046529 Bacteria 5923
371 Ga0495652_0195569 3300046529 Bacteria 1539
372 Ga0495652_0519092 3300046529 Bacteria 823
373 Ga0495665_0001063 3300046531 Bacteria 14584
374 Ga0495586_0073156 3300046535 Bacteria 1875
375 Ga0495587_0030824 3300046536 Bacteria 3251
376 Ga0495645_0005015 3300046543 Bacteria 9074
377 Ga0495645_0053166 3300046543 Bacteria 2944
378 Ga0495645_0184114 3300046543 Bacteria 1428
379 Ga0495667_0015721 3300046559 Bacteria 5116
380 Ga0495667_0024943 3300046559 Bacteria 4028
381 Ga0495667_0065771 3300046559 Bacteria 2371
382 Ga0495635_0231705 3300046663 Bacteria 1248
383 Ga0495588_0247410 3300046674 Bacteria 940
384 Ga0495657_0164688 3300046675 Bacteria 1369
385 Ga0495599_0014204 3300046678 Bacteria 4930
386 Ga0495599_0021947 3300046678 Bacteria 3984
387 Ga0495599_0093696 3300046678 Bacteria 1873
388 Ga0495623_0010008 3300046679 Bacteria 6140
389 Ga0495623_0029365 3300046679 Bacteria 3538
390 Ga0495658_0266669 3300046683 Bacteria 1079
391 Ga0495613_0225635 3300046689 Bacteria 1314
392 Ga0495581_0016110 3300047315 Bacteria 4345
393 Ga0495604_0102644 3300047317 Bacteria 2099
394 Ga0495674_0019053 3300047319 Bacteria 6380
395 Ga0495674_0566375 3300047319 Bacteria 903
396 Ga0495672_0002024 3300047320 Bacteria 19110
397 Ga0495680_0267432 3300047322 Bacteria 1208
398 Ga0495675_0013250 3300047444 Bacteria 5204
399 Ga0495675_0034967 3300047444 Bacteria 3209
400 Ga0495675_0162911 3300047444 Bacteria 1372
401 Ga0495684_0048682 3300047471 Bacteria 3240
402 Ga0495602_0144949 3300048088 Bacteria 1875
403 Ga0496101_0521547 3300048904 Bacteria 939
404 Ga0496112_0022693 3300048915 Bacteria 5986
405 Ga0496114_0557988 3300048917 Bacteria 1012
406 Ga0496115_0014548 3300048918 Bacteria 5957
407 Ga0501033_0346603 3300049570 Bacteria 1041
408 Ga0501034_0237713 3300049571 Bacteria 1769
409 Ga0501040_0086320 3300049576 Bacteria 2179
410 Ga0501042_0255786 3300049578 Bacteria 1264
411 Ga0501047_0157651 3300049581 Bacteria 2143
412 Ga0501047_0164344 3300049581 Bacteria 2091
413 Ga0501075_0499145 3300049591 Bacteria 928
414 Ga0501035_0151387 3300049822 Bacteria 2013
415 Ga0501045_0238408 3300049824 Bacteria 1354
416 Ga0501045_0333959 3300049824 Bacteria 1128
417 nmdc:mga05p37_32903_c1 3300050507 Bacteria 6347
418 nmdc:mga05p37_49138_c1 3300050507 Bacteria 5188
419 nmdc:mga05p37_555078_c1 3300050507 Bacteria 1306
420 nmdc:mga09592_734917_c1 3300050508 Bacteria 838
421 nmdc:mga06r32_45876_c1 3300050510 Bacteria 4168
422 nmdc:mga08y16_460239_c1 3300050511 Bacteria 1296
423 nmdc:mga0n895_13756_c1 3300050512 Bacteria 7318
424 nmdc:mga0n895_305219_c1 3300050512 Bacteria 1613
425 nmdc:mga0n895_625432_c1 3300050512 Bacteria 1077
426 nmdc:mga0n895_633258_c1 3300050512 Bacteria 1069
427 nmdc:mga0n895_8241_c1 3300050512 Bacteria 9011
428 nmdc:mga0rr50_92700_c1 3300050513 Bacteria 2355
429 nmdc:mga08x19_29160_c1 3300050514 Bacteria 3460
430 nmdc:mga08x19_48968_c1 3300050514 Bacteria 2709
431 nmdc:mga0a205_190044_c1 3300050515 Bacteria 1946
432 nmdc:mga0a205_195355_c1 3300050515 Bacteria 1914
433 Ga0495601_0125695 3300053077 Bacteria 1668
434 Ga0495612_0040002 3300053078 Bacteria 1909
435 Ga0495619_0152452 3300053085 Bacteria 1594
436 Ga0501084_0407213 3300054114 Bacteria 1149
437 Ga0070696_100010670
438 MBSR1b_contig_509051
439 Ga0058863_10068824
440 Ga0065712_10200252
441 Ga0065715_10000932
442 Ga0065715_10136517
443 Ga0065715_10383611
444 Ga0070658_10019462
445 Ga0070676_10004793
446 Ga0070683_100000243
447 Ga0070683_100103159
448 Ga0070683_100202811
449 Ga0070683_100466845
450 Ga0070683_100534017
451 Ga0070683_100677975
452 Ga0068869_100200034
453 Ga0070666_10073817
454 Ga0070680_100000418
455 Ga0070680_100004491
456 Ga0070680_100004823
457 Ga0070680_100028253
458 Ga0070680_100038070
459 Ga0070680_100075504
460 Ga0070680_100129033
461 Ga0070680_100195028
462 Ga0070680_100549685
463 Ga0070682_100001685
464 Ga0070682_100007416
465 Ga0070682_100050577
466 Ga0070682_100269628
467 Ga0068868_100015264
468 Ga0068868_100030211
469 Ga0070660_100318081
470 Ga0070689_100136689
471 Ga0070691_10055157
472 Ga0070687_100051988
473 Ga0070661_100012226
474 Ga0070661_100164364
475 Ga0070661_100376759
476 Ga0070692_10014835
477 Ga0070668_100033899
478 Ga0070668_100361421
479 Ga0070669_100069875
480 Ga0070675_100066319
481 Ga0070675_100423034
482 Ga0070671_100002277
483 Ga0070671_100130827
484 Ga0070671_100366126
485 Ga0070674_100026462
486 Ga0070674_100526697
487 Ga0070673_100160328
488 Ga0070688_100027312
489 Ga0070667_100247971
490 Ga0070667_100381964
491 Ga0070709_10008797
492 Ga0070709_10360253
493 Ga0070714_100017850
494 Ga0070713_100021940
495 Ga0070713_100279925
496 Ga0070701_10242254
497 Ga0070711_100008891
498 Ga0070711_100180459
499 Ga0070700_100022627
500 Ga0070708_100000035
501 Ga0070708_100000043
502 Ga0070708_100174903
503 Ga0070708_100192518
504 Ga0070708_100719414
505 Ga0070662_100046644
506 Ga0070681_10001646
507 Ga0070681_10004670
508 Ga0070681_10018810
509 Ga0070681_10094554
510 Ga0070681_10098659
511 Ga0070681_10153925
512 Ga0070681_10175626
513 Ga0070681_10275146
514 Ga0070681_10506939
515 Ga0068867_100098479
516 Ga0070706_100044615
517 Ga0070706_100459625
518 Ga0070707_100003740
519 Ga0070707_100106125
520 Ga0070707_100212610
521 Ga0070698_100106688
522 Ga0070698_100571823
523 Ga0070699_100235023
524 Ga0070699_100258885
525 Ga0070699_100272790
526 Ga0070679_100001586
527 Ga0070679_100004110
528 Ga0070679_100009464
529 Ga0070679_100014995
530 Ga0070679_100028021
531 Ga0070679_100054358
532 Ga0070679_100073622
533 Ga0070679_100089046
534 Ga0070679_100132293
535 Ga0070679_100136203
536 Ga0070679_100276275
537 Ga0070684_100004442
538 Ga0070684_100045341
539 Ga0070684_100051912
540 Ga0070684_100074750
541 Ga0070684_100077739
542 Ga0070684_100095278
543 Ga0070684_100113758
544 Ga0070684_100161060
545 Ga0070684_100333063
546 Ga0070684_100454308
547 Ga0070697_100029761
548 Ga0070697_100273359
549 Ga0068853_100008866
550 Ga0068853_100017615
551 Ga0070686_100075240
552 Ga0070686_100210621
553 Ga0070686_100545352
554 Ga0070695_100002984
555 Ga0070696_100005206
556 Ga0070696_100161732
557 Ga0070693_100005467
558 Ga0070693_100030225
559 Ga0070693_100289327
560 Ga0070665_100294269
561 Ga0070704_100051174
562 Ga0068855_100003869
563 Ga0068855_100016273
564 Ga0068855_100050975
565 Ga0068855_100371866
566 Ga0070664_100007590
567 Ga0070664_100076033
568 Ga0070664_100147449
569 Ga0068857_100272636
570 Ga0068857_100500073
571 Ga0068854_100031649
572 Ga0068854_100038850
573 Ga0068854_100117589
574 Ga0068854_100451329
575 Ga0068856_100005223
576 Ga0068856_100110374
577 Ga0068859_100647833
578 Ga0068859_100658701
579 Ga0068864_100284238
580 Ga0068866_10075307
581 Ga0068863_100122764
582 Ga0068858_100221278
583 Ga0068862_100184372
584 Ga0081455_10044407
585 Ga0070716_100003407
586 Ga0070712_100220574
587 Ga0070712_100799774
588 Ga0097621_100112958
589 Ga0068871_100752791
590 Ga0075431_100087571
591 Ga0075433_10062516
592 Ga0075433_10275657
593 Ga0075433_10347782
594 Ga0075434_100035428
595 Ga0075434_100243927
596 Ga0075434_100301374
597 Ga0075434_100741176
598 Ga0068865_100188255
599 Ga0075436_100010112
600 Ga0097620_100647857
601 Ga0097620_100658715
602 Ga0075435_100147001
603 Ga0075435_100163647
604 Ga0099795_10007740
605 Ga0105240_10032870
606 Ga0105240_10066838
607 Ga0105240_10409487
608 Ga0111539_10085120
609 Ga0105245_10040728
610 Ga0105245_10174648
611 Ga0105245_10416465
612 Ga0114129_10009749
613 Ga0105241_10000048
614 Ga0105241_10620361
615 Ga0105242_10453372
616 Ga0105248_10063086
617 Ga0105248_11234500
618 Ga0105237_10206261
619 Ga0105237_10246097
620 Ga0105238_10031318
621 Ga0105249_10000130
622 Ga0157371_10396647
623 Ga0157370_10003669
624 Ga0157370_10029439
625 Ga0157370_10246452
626 Ga0157369_10023540
627 Ga0157369_10102145
628 Ga0157369_10322658
629 Ga0157369_10331041
630 Ga0157374_10143547
631 Ga0157374_10353969
632 Ga0157378_10007962
633 Ga0157378_10015337
634 Ga0157378_10083256
635 Ga0157378_10287087
636 Ga0163162_11588588
637 Ga0157372_10004541
638 Ga0157372_10056292
639 Ga0157372_10216263
640 Ga0157372_10339780
641 Ga0157372_10442106
642 Ga0157375_10036917
643 Ga0157375_10202713
644 Ga0157375_10359292
645 Ga0182008_10002244
646 Ga0206353_10727187
647 Ga0207692_10271242
648 Ga0207699_10038773
649 Ga0207645_10092956
650 Ga0207705_10014738
651 Ga0207705_10817140
652 Ga0207654_10000076
653 Ga0207707_10004489
654 Ga0207707_10005846
655 Ga0207707_10011846
656 Ga0207707_10013626
657 Ga0207707_10073932
658 Ga0207707_10102501
659 Ga0207707_10126240
660 Ga0207707_10215115
661 Ga0207707_10249733
662 Ga0207695_10632968
663 Ga0207693_10052879
664 Ga0207663_10046465
665 Ga0207663_10152265
666 Ga0207660_10002944
667 Ga0207660_10018380
668 Ga0207660_10021447
669 Ga0207660_10036879
670 Ga0207660_10103768
671 Ga0207660_10619588
672 Ga0207662_10026165
673 Ga0207662_10098002
674 Ga0207657_10159312
675 Ga0207652_10003007
676 Ga0207652_10010107
677 Ga0207652_10037668
678 Ga0207652_10039892
679 Ga0207652_10043480
680 Ga0207652_10056607
681 Ga0207652_10075317
682 Ga0207652_10081317
683 Ga0207652_10155269
684 Ga0207652_10299201
685 Ga0207646_10002584
686 Ga0207646_10047833
687 Ga0207646_10085558
688 Ga0207681_10060490
689 Ga0207681_10263669
690 Ga0207659_10261755
691 Ga0207687_10076141
692 Ga0207700_10027421
693 Ga0207644_10002453
694 Ga0207644_10366840
695 Ga0207690_10150848
696 Ga0207706_10009007
697 Ga0207686_10069743
698 Ga0207670_10238033
699 Ga0207669_10078595
700 Ga0207704_10418021
701 Ga0207665_10006949
702 Ga0207665_10107997
703 Ga0207665_10313596
704 Ga0207691_10822398
705 Ga0207661_10004512
706 Ga0207661_10006540
707 Ga0207661_10009206
708 Ga0207661_10332997
709 Ga0207661_10461386
710 Ga0207661_10514319
711 Ga0207679_10006154
712 Ga0207679_10150520
713 Ga0207679_10324938
714 Ga0207667_10002379
715 Ga0207667_10297525
716 Ga0207667_10407778
717 Ga0207651_10027883
718 Ga0207712_10000377
719 Ga0207668_10001660
720 Ga0207668_10129626
721 Ga0207640_10136618
722 Ga0207658_10086841
723 Ga0207677_10204629
724 Ga0207677_11014000
725 Ga0207703_10304755
726 Ga0207639_10023703
727 Ga0207639_10186648
728 Ga0207639_10228316
729 Ga0207678_10017337
730 Ga0207708_10010357
731 Ga0207708_10091519
732 Ga0207702_10039376
733 Ga0207641_10175972
734 Ga0207641_10587292
735 Ga0207648_10062441
736 Ga0207648_10116650
737 Ga0207676_10286551
738 Ga0207674_10053201
739 Ga0207674_10190704
740 Ga0207683_10055046
741 Ga0268266_10121517
742 Ga0307408_100270576
743 Ga0307405_10269335
744 Ga0307413_10002000
745 Ga0307406_10009481
746 Ga0307407_10023396
747 Ga0307409_100016189
748 Ga0307416_100016384
749 Ga0307414_10038464
750 Ga0307411_10010780
751 Ga0307415_100022141
752 Ga0373934_0004308
753 Ga0373934_0182346
754 Ga0373951_0008240
755 Ga0373941_0008999
756 Ga0373953_0041146
757 Ga0373956_0061481
758 Ga0373956_0110221
759 Ga0373957_0077758
760 Ga0373960_0035591
761 Ga0373955_0143735
762 Ga0373961_0012397
763 Ga0373935_0065621
764 Ga0373935_0332691
765 Ga0373927_0007344
766 Ga0373927_0079639
767 Ga0373933_0023842
768 Ga0373933_0027805
769 Ga0373933_0146285
770 Ga0373947_0260859
771 Ga0373947_0379569
772 Ga0373947_0427344
773 Ga0373937_0004785
774 Ga0373937_0010707
775 Ga0373937_0020713
776 Ga0373937_0671597
777 Ga0373925_0097751
778 Ga0436365_1515189
779 Ga0466961_0102464
780 Ga0466963_0119510
781 Ga0451576_0069648
782 Ga0451576_0520698
783 Ga0466967_0459446
784 Ga0495592_0238614
785 Ga0495629_0200900
786 Ga0495651_0094223
787 Ga0495651_0184381
788 Ga0495651_0228397
789 Ga0495653_0316789
790 Ga0495580_0032828
791 Ga0495580_0041697
792 Ga0495580_0364690
793 Ga0495582_0017381
794 Ga0495639_0021989
795 Ga0495639_0123042
796 Ga0495594_0004660
797 Ga0495594_0016662
798 Ga0495594_0055411
799 Ga0495594_0078826
800 Ga0495608_0027867
801 Ga0495628_0040471
802 Ga0495628_0056628
803 Ga0495628_0369527
804 Ga0495630_0111270
805 Ga0495666_0056659
806 Ga0495652_0020183
807 Ga0495652_0195569
808 Ga0495652_0519092
809 Ga0495665_0001063
810 Ga0495586_0073156
811 Ga0495587_0030824
812 Ga0495645_0005015
813 Ga0495645_0053166
814 Ga0495645_0184114
815 Ga0495667_0015721
816 Ga0495667_0024943
817 Ga0495667_0065771
818 Ga0495635_0231705
819 Ga0495588_0247410
820 Ga0495657_0164688
821 Ga0495599_0014204
822 Ga0495599_0021947
823 Ga0495599_0093696
824 Ga0495623_0010008
825 Ga0495623_0029365
826 Ga0495658_0266669
827 Ga0495613_0225635
828 Ga0495581_0016110
829 Ga0495604_0102644
830 Ga0495674_0019053
831 Ga0495674_0566375
832 Ga0495672_0002024
833 Ga0495680_0267432
834 Ga0495675_0013250
835 Ga0495675_0034967
836 Ga0495675_0162911
837 Ga0495684_0048682
838 Ga0495602_0144949
839 Ga0496101_0521547
840 Ga0496112_0022693
841 Ga0496114_0557988
842 Ga0496115_0014548
843 Ga0501033_0346603
844 Ga0501034_0237713
845 Ga0501040_0086320
846 Ga0501042_0255786
847 Ga0501047_0157651
848 Ga0501047_0164344
849 Ga0501075_0499145
850 Ga0501035_0151387
851 Ga0501045_0238408
852 Ga0501045_0333959
853 nmdc:mga05p37_32903_c1
854 nmdc:mga05p37_49138_c1
855 nmdc:mga05p37_555078_c1
856 nmdc:mga09592_734917_c1
857 nmdc:mga06r32_45876_c1
858 nmdc:mga08y16_460239_c1
859 nmdc:mga0n895_13756_c1
860 nmdc:mga0n895_305219_c1
861 nmdc:mga0n895_625432_c1
862 nmdc:mga0n895_633258_c1
863 nmdc:mga0n895_8241_c1
864 nmdc:mga0rr50_92700_c1
865 nmdc:mga08x19_29160_c1
866 nmdc:mga08x19_48968_c1
867 nmdc:mga0a205_190044_c1
868 nmdc:mga0a205_195355_c1
869 Ga0495601_0125695
870 Ga0495612_0040002
871 Ga0495619_0152452
872 Ga0501084_0407213

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

3

113

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

128

202

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9772 1 119
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9771 2 118
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.9769 2 118
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9749 1 118
6ont-assembly1.cif.gz_A-2 structure of the francisella response regulator 1452 receiver domain 0.9744 2 118
ID Description Score Start End Superfamily
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9895 1 80 3.40.50.2300
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9784 1 77 3.40.50.2300
af_P52076_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9767 1 80 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9756 1 80 3.40.50.2300
5hm6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9743 2 118 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7W0KFM1-F1-model_v4 Response regulator transcription factor 0.9008 2 222 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A7W0KFM1-F1-model_v4 Response regulator transcription factor 0.8932 2 222 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A522QDY1-F1-model_v4 Response regulator transcription factor 0.8727 2 222 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A522QDY1-F1-model_v4 Response regulator transcription factor 0.8583 2 222 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3L7RWF6-F1-model_v4 DNA-binding response regulator 0.8571 2 222 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map