F443478
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 436 | 264 | 436 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300005344|Ga0070661_101022279|Ga0070661_1010222792 |
| Length | 179 |
| Sequence | LLGRSLAREISASATPLVQETRQISSTVRDDTLPFEIRPSPMQGLGAFATRPIGAGVRLIEYAGERLTPAQADARYPDVEGERHHTFLFAIDDDVVIDAAVNGNDARFINHSCDPNCDAIVEDGRIWIETIRAVAAGEELAYDYAYVLEERHTPAAKKRYPCSCGAPGCRGTILAKKRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 86 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 132 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 133 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 134 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 135 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 136 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 141 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 142 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 143 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 144 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 145 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 146 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 148 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 149 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 150 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 151 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 152 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 153 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 154 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 156 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 157 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 158 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 159 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 160 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 161 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 162 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 163 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 164 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 205 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 206 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 209 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 210 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 211 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 212 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 213 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049650 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought | Metagenome | Rhizosphere |
| 221 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 222 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 223 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 224 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 225 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 226 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 227 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 228 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 229 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 230 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 231 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 232 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 233 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 234 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 235 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 236 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 237 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 238 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 239 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 240 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 241 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 242 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 243 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 244 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 245 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 246 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 247 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 248 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 249 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 250 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 251 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 252 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 253 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 256 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 3.21 |
| Rhizosphere | 95.41 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10030564 | 3300001990 | Unclassified | 1685 |
| 2 | Ga0070658_10033793 | 3300005327 | Bacteria | 4115 |
| 3 | Ga0070658_10314731 | 3300005327 | Bacteria | 1336 |
| 4 | Ga0070676_10225920 | 3300005328 | Bacteria | 1239 |
| 5 | Ga0070683_100044709 | 3300005329 | Bacteria | 4085 |
| 6 | Ga0070683_100051517 | 3300005329 | Bacteria | 3812 |
| 7 | Ga0070683_100076695 | 3300005329 | Bacteria | 3125 |
| 8 | Ga0070683_100126293 | 3300005329 | Bacteria | 2418 |
| 9 | Ga0070683_100190604 | 3300005329 | Bacteria | 1946 |
| 10 | Ga0070683_100278573 | 3300005329 | Bacteria | 1591 |
| 11 | Ga0070690_100053447 | 3300005330 | Bacteria | 2584 |
| 12 | Ga0070670_100155917 | 3300005331 | Bacteria | 1977 |
| 13 | Ga0070666_10112680 | 3300005335 | Bacteria | 1882 |
| 14 | Ga0070666_10452639 | 3300005335 | Bacteria | 927 |
| 15 | Ga0070680_100001474 | 3300005336 | Bacteria | 17096 |
| 16 | Ga0070680_100018397 | 3300005336 | Bacteria | 5519 |
| 17 | Ga0068868_100217064 | 3300005338 | Bacteria | 1600 |
| 18 | Ga0070689_100015116 | 3300005340 | Bacteria | 5622 |
| 19 | Ga0070687_100031366 | 3300005343 | Bacteria | 2607 |
| 20 | Ga0070687_100049095 | 3300005343 | Bacteria | 2173 |
| 21 | Ga0070661_100178988 | 3300005344 | Bacteria | 1612 |
| 22 | Ga0070661_100707960 | 3300005344 | Unclassified | 821 |
| 23 | Ga0070661_101022279 | 3300005344 | Bacteria | 686 |
| 24 | Ga0070692_10452105 | 3300005345 | Unclassified | 822 |
| 25 | Ga0070692_10597278 | 3300005345 | Unclassified | 730 |
| 26 | Ga0070668_100022240 | 3300005347 | Bacteria | 4792 |
| 27 | Ga0070668_100339529 | 3300005347 | Bacteria | 1269 |
| 28 | Ga0070669_100005797 | 3300005353 | Bacteria | 8904 |
| 29 | Ga0070669_100359374 | 3300005353 | Bacteria | 1184 |
| 30 | Ga0070675_100011944 | 3300005354 | Bacteria | 6805 |
| 31 | Ga0070675_100071158 | 3300005354 | Bacteria | 2885 |
| 32 | Ga0070675_100855953 | 3300005354 | Bacteria | 832 |
| 33 | Ga0070671_100079536 | 3300005355 | Bacteria | 2740 |
| 34 | Ga0070673_100155549 | 3300005364 | Bacteria | 1940 |
| 35 | Ga0070688_100034287 | 3300005365 | Bacteria | 3074 |
| 36 | Ga0070688_100040698 | 3300005365 | Bacteria | 2849 |
| 37 | Ga0070659_100006133 | 3300005366 | Bacteria | 8677 |
| 38 | Ga0070659_100663512 | 3300005366 | Bacteria | 900 |
| 39 | Ga0070659_101275923 | 3300005366 | Bacteria | 651 |
| 40 | Ga0070667_100333035 | 3300005367 | Bacteria | 1372 |
| 41 | Ga0070714_100035350 | 3300005435 | Bacteria | 4187 |
| 42 | Ga0070713_100000627 | 3300005436 | Bacteria | 22531 |
| 43 | Ga0070713_101508815 | 3300005436 | Bacteria | 652 |
| 44 | Ga0070710_10542337 | 3300005437 | Bacteria | 802 |
| 45 | Ga0070701_10234187 | 3300005438 | Bacteria | 1101 |
| 46 | Ga0070711_100252674 | 3300005439 | Bacteria | 1384 |
| 47 | Ga0070705_100461561 | 3300005440 | Bacteria | 955 |
| 48 | Ga0070700_100457804 | 3300005441 | Bacteria | 972 |
| 49 | Ga0070700_101250016 | 3300005441 | Bacteria | 622 |
| 50 | Ga0070681_10000886 | 3300005458 | Bacteria | 25274 |
| 51 | Ga0070681_10316182 | 3300005458 | Bacteria | 1471 |
| 52 | Ga0070681_10878226 | 3300005458 | Unclassified | 815 |
| 53 | Ga0068867_100011835 | 3300005459 | Bacteria | 6162 |
| 54 | Ga0070685_10010038 | 3300005466 | Bacteria | 4912 |
| 55 | Ga0070706_100146484 | 3300005467 | Bacteria | 2205 |
| 56 | Ga0070707_100010058 | 3300005468 | Bacteria | 8807 |
| 57 | Ga0070699_100991879 | 3300005518 | Bacteria | 770 |
| 58 | Ga0070679_100001742 | 3300005530 | Bacteria | 19603 |
| 59 | Ga0070679_100002997 | 3300005530 | Bacteria | 15417 |
| 60 | Ga0070679_100031927 | 3300005530 | Bacteria | 5207 |
| 61 | Ga0070679_100731964 | 3300005530 | Bacteria | 932 |
| 62 | Ga0070684_100001158 | 3300005535 | Bacteria | 18934 |
| 63 | Ga0070684_100006390 | 3300005535 | Bacteria | 9115 |
| 64 | Ga0070684_100019923 | 3300005535 | Bacteria | 5559 |
| 65 | Ga0070684_100026279 | 3300005535 | Bacteria | 4903 |
| 66 | Ga0070684_100043008 | 3300005535 | Bacteria | 3901 |
| 67 | Ga0070684_100198984 | 3300005535 | Bacteria | 1825 |
| 68 | Ga0070684_100840772 | 3300005535 | Bacteria | 859 |
| 69 | Ga0070684_100902311 | 3300005535 | Bacteria | 828 |
| 70 | Ga0070697_101252333 | 3300005536 | Bacteria | 661 |
| 71 | Ga0068853_100317831 | 3300005539 | Bacteria | 1443 |
| 72 | Ga0070672_100050885 | 3300005543 | Bacteria | 3228 |
| 73 | Ga0070672_100485167 | 3300005543 | Bacteria | 1068 |
| 74 | Ga0070686_100066152 | 3300005544 | Bacteria | 2350 |
| 75 | Ga0070686_100541819 | 3300005544 | Bacteria | 909 |
| 76 | Ga0070696_100000496 | 3300005546 | Bacteria | 24798 |
| 77 | Ga0070665_100379411 | 3300005548 | Bacteria | 1421 |
| 78 | Ga0068855_100185724 | 3300005563 | Bacteria | 2348 |
| 79 | Ga0070664_100026888 | 3300005564 | Bacteria | 4778 |
| 80 | Ga0070664_100051865 | 3300005564 | Bacteria | 3473 |
| 81 | Ga0070664_100178699 | 3300005564 | Bacteria | 1886 |
| 82 | Ga0070664_100486073 | 3300005564 | Bacteria | 1136 |
| 83 | Ga0068854_100458453 | 3300005578 | Bacteria | 1066 |
| 84 | Ga0068856_100115052 | 3300005614 | Bacteria | 2689 |
| 85 | Ga0070702_101534515 | 3300005615 | Bacteria | 549 |
| 86 | Ga0068852_100160004 | 3300005616 | Bacteria | 2102 |
| 87 | Ga0068852_100486770 | 3300005616 | Bacteria | 1227 |
| 88 | Ga0068852_100691090 | 3300005616 | Bacteria | 1030 |
| 89 | Ga0068859_100040042 | 3300005617 | Bacteria | 4703 |
| 90 | Ga0068859_100048149 | 3300005617 | Bacteria | 4282 |
| 91 | Ga0068859_101112997 | 3300005617 | Bacteria | 869 |
| 92 | Ga0068851_10016209 | 3300005834 | Bacteria | 3563 |
| 93 | Ga0068870_10011280 | 3300005840 | Bacteria | 4138 |
| 94 | Ga0068863_100625602 | 3300005841 | Bacteria | 1067 |
| 95 | Ga0068858_101705123 | 3300005842 | Bacteria | 622 |
| 96 | Ga0068860_100520259 | 3300005843 | Bacteria | 1190 |
| 97 | Ga0081539_10218039 | 3300005985 | Bacteria | 870 |
| 98 | Ga0097621_100560617 | 3300006237 | Bacteria | 1041 |
| 99 | Ga0068871_100356404 | 3300006358 | Bacteria | 1295 |
| 100 | Ga0075428_100746630 | 3300006844 | Unclassified | 1041 |
| 101 | Ga0075434_100092140 | 3300006871 | Bacteria | 3032 |
| 102 | Ga0075434_100593893 | 3300006871 | Unclassified | 1126 |
| 103 | Ga0068865_100013784 | 3300006881 | Bacteria | 5122 |
| 104 | Ga0075436_100543883 | 3300006914 | Bacteria | 852 |
| 105 | Ga0097620_100040044 | 3300006931 | Bacteria | 4703 |
| 106 | Ga0097620_100048148 | 3300006931 | Bacteria | 4282 |
| 107 | Ga0097620_101113050 | 3300006931 | Bacteria | 869 |
| 108 | Ga0097620_101734714 | 3300006931 | Bacteria | 690 |
| 109 | Ga0105240_12225167 | 3300009093 | Bacteria | 568 |
| 110 | Ga0111539_10234403 | 3300009094 | Bacteria | 2137 |
| 111 | Ga0111539_10947665 | 3300009094 | Bacteria | 1001 |
| 112 | Ga0105245_10551553 | 3300009098 | Bacteria | 1174 |
| 113 | Ga0105245_10826512 | 3300009098 | Bacteria | 965 |
| 114 | Ga0114129_10011564 | 3300009147 | Bacteria | 12568 |
| 115 | Ga0105243_10471590 | 3300009148 | Bacteria | 1182 |
| 116 | Ga0105242_10006413 | 3300009176 | Bacteria | 9059 |
| 117 | Ga0105242_10233433 | 3300009176 | Bacteria | 1650 |
| 118 | Ga0105242_10958388 | 3300009176 | Unclassified | 860 |
| 119 | Ga0105248_10058339 | 3300009177 | Bacteria | 4335 |
| 120 | Ga0105248_10160381 | 3300009177 | Bacteria | 2537 |
| 121 | Ga0105248_10170750 | 3300009177 | Bacteria | 2451 |
| 122 | Ga0105248_10380923 | 3300009177 | Bacteria | 1588 |
| 123 | Ga0105248_10515167 | 3300009177 | Bacteria | 1349 |
| 124 | Ga0105248_10659199 | 3300009177 | Bacteria | 1181 |
| 125 | Ga0105237_10047956 | 3300009545 | Bacteria | 4295 |
| 126 | Ga0105237_10068050 | 3300009545 | Bacteria | 3555 |
| 127 | Ga0105238_10040602 | 3300009551 | Bacteria | 4714 |
| 128 | Ga0105239_11407849 | 3300010375 | Unclassified | 805 |
| 129 | Ga0157373_10012829 | 3300013100 | Bacteria | 6154 |
| 130 | Ga0157373_10035820 | 3300013100 | Bacteria | 3562 |
| 131 | Ga0157373_10118821 | 3300013100 | Bacteria | 1858 |
| 132 | Ga0157370_10001672 | 3300013104 | Bacteria | 27320 |
| 133 | Ga0157369_10087018 | 3300013105 | Bacteria | 3337 |
| 134 | Ga0157369_10487739 | 3300013105 | Bacteria | 1275 |
| 135 | Ga0157374_10774005 | 3300013296 | Bacteria | 975 |
| 136 | Ga0163162_10088268 | 3300013306 | Bacteria | 3180 |
| 137 | Ga0163162_10234845 | 3300013306 | Bacteria | 1964 |
| 138 | Ga0163162_10589466 | 3300013306 | Bacteria | 1238 |
| 139 | Ga0163162_10761712 | 3300013306 | Bacteria | 1087 |
| 140 | Ga0157372_10008083 | 3300013307 | Bacteria | 11186 |
| 141 | Ga0157372_10009123 | 3300013307 | Bacteria | 10537 |
| 142 | Ga0157372_10306962 | 3300013307 | Bacteria | 1846 |
| 143 | Ga0157372_10450378 | 3300013307 | Bacteria | 1500 |
| 144 | Ga0157372_10627934 | 3300013307 | Bacteria | 1252 |
| 145 | Ga0157375_10011305 | 3300013308 | Bacteria | 7883 |
| 146 | Ga0157375_10035348 | 3300013308 | Bacteria | 4768 |
| 147 | Ga0157375_10110332 | 3300013308 | Bacteria | 2848 |
| 148 | Ga0157375_10933396 | 3300013308 | Bacteria | 1010 |
| 149 | Ga0163163_10332263 | 3300014325 | Unclassified | 1574 |
| 150 | Ga0157377_10007299 | 3300014745 | Bacteria | 5329 |
| 151 | Ga0157377_10106645 | 3300014745 | Bacteria | 1678 |
| 152 | Ga0157376_10330451 | 3300014969 | Bacteria | 1452 |
| 153 | Ga0182005_1080332 | 3300015265 | Bacteria | 900 |
| 154 | Ga0163161_10379980 | 3300017792 | Bacteria | 1129 |
| 155 | Ga0213876_10112853 | 3300021384 | Bacteria | 1442 |
| 156 | Ga0207697_10148008 | 3300025315 | Bacteria | 1021 |
| 157 | Ga0207642_10077958 | 3300025899 | Bacteria | 1600 |
| 158 | Ga0207699_10196256 | 3300025906 | Bacteria | 1365 |
| 159 | Ga0207643_10014105 | 3300025908 | Bacteria | 4338 |
| 160 | Ga0207707_10011781 | 3300025912 | Bacteria | 7607 |
| 161 | Ga0207707_10266300 | 3300025912 | Bacteria | 1486 |
| 162 | Ga0207693_10089758 | 3300025915 | Bacteria | 2409 |
| 163 | Ga0207660_10005128 | 3300025917 | Bacteria | 8523 |
| 164 | Ga0207660_10008755 | 3300025917 | Bacteria | 6542 |
| 165 | Ga0207660_10009482 | 3300025917 | Bacteria | 6301 |
| 166 | Ga0207660_10252284 | 3300025917 | Bacteria | 1393 |
| 167 | Ga0207660_10563046 | 3300025917 | Bacteria | 927 |
| 168 | Ga0207662_10018764 | 3300025918 | Bacteria | 3928 |
| 169 | Ga0207662_10044806 | 3300025918 | Bacteria | 2613 |
| 170 | Ga0207649_10298195 | 3300025920 | Bacteria | 1178 |
| 171 | Ga0207649_10552516 | 3300025920 | Bacteria | 881 |
| 172 | Ga0207649_10887728 | 3300025920 | Unclassified | 699 |
| 173 | Ga0207649_11050955 | 3300025920 | Bacteria | 642 |
| 174 | Ga0207652_10015239 | 3300025921 | Bacteria | 6238 |
| 175 | Ga0207652_10059241 | 3300025921 | Bacteria | 3300 |
| 176 | Ga0207652_10062354 | 3300025921 | Unclassified | 3221 |
| 177 | Ga0207652_10163193 | 3300025921 | Bacteria | 1997 |
| 178 | Ga0207652_10830258 | 3300025921 | Bacteria | 819 |
| 179 | Ga0207681_10130392 | 3300025923 | Bacteria | 1858 |
| 180 | Ga0207650_10141767 | 3300025925 | Bacteria | 1890 |
| 181 | Ga0207650_10212791 | 3300025925 | Bacteria | 1553 |
| 182 | Ga0207650_11260745 | 3300025925 | Bacteria | 629 |
| 183 | Ga0207659_10008335 | 3300025926 | Bacteria | 6428 |
| 184 | Ga0207659_10030642 | 3300025926 | Bacteria | 3677 |
| 185 | Ga0207659_10046367 | 3300025926 | Bacteria | 3069 |
| 186 | Ga0207687_10316399 | 3300025927 | Bacteria | 1262 |
| 187 | Ga0207687_10687235 | 3300025927 | Bacteria | 868 |
| 188 | Ga0207700_10003191 | 3300025928 | Bacteria | 9466 |
| 189 | Ga0207644_10164500 | 3300025931 | Bacteria | 1727 |
| 190 | Ga0207706_10116177 | 3300025933 | Bacteria | 2353 |
| 191 | Ga0207709_10290984 | 3300025935 | Bacteria | 1211 |
| 192 | Ga0207670_10009562 | 3300025936 | Bacteria | 5538 |
| 193 | Ga0207704_10019472 | 3300025938 | Bacteria | 3566 |
| 194 | Ga0207704_10099373 | 3300025938 | Bacteria | 1935 |
| 195 | Ga0207665_10251091 | 3300025939 | Bacteria | 1307 |
| 196 | Ga0207691_10026739 | 3300025940 | Bacteria | 5414 |
| 197 | Ga0207691_10047433 | 3300025940 | Bacteria | 3942 |
| 198 | Ga0207711_10270984 | 3300025941 | Bacteria | 1562 |
| 199 | Ga0207711_10408719 | 3300025941 | Bacteria | 1261 |
| 200 | Ga0207711_10431304 | 3300025941 | Bacteria | 1226 |
| 201 | Ga0207689_10437194 | 3300025942 | Bacteria | 1093 |
| 202 | Ga0207661_10021145 | 3300025944 | Bacteria | 4875 |
| 203 | Ga0207661_10033842 | 3300025944 | Bacteria | 3969 |
| 204 | Ga0207661_10035788 | 3300025944 | Bacteria | 3872 |
| 205 | Ga0207661_10040061 | 3300025944 | Bacteria | 3681 |
| 206 | Ga0207661_10061688 | 3300025944 | Bacteria | 3030 |
| 207 | Ga0207661_10191268 | 3300025944 | Bacteria | 1794 |
| 208 | Ga0207661_10330814 | 3300025944 | Bacteria | 1371 |
| 209 | Ga0207661_10361840 | 3300025944 | Bacteria | 1310 |
| 210 | Ga0207661_10485572 | 3300025944 | Bacteria | 1128 |
| 211 | Ga0207661_11666852 | 3300025944 | Bacteria | 583 |
| 212 | Ga0207661_12025903 | 3300025944 | Bacteria | 522 |
| 213 | Ga0207679_10016318 | 3300025945 | Bacteria | 4930 |
| 214 | Ga0207679_10061628 | 3300025945 | Bacteria | 2793 |
| 215 | Ga0207679_10095411 | 3300025945 | Bacteria | 2312 |
| 216 | Ga0207679_10261914 | 3300025945 | Bacteria | 1475 |
| 217 | Ga0207679_10486696 | 3300025945 | Bacteria | 1099 |
| 218 | Ga0207679_10773664 | 3300025945 | Bacteria | 874 |
| 219 | Ga0207667_10023560 | 3300025949 | Bacteria | 6778 |
| 220 | Ga0207651_10146569 | 3300025960 | Bacteria | 1831 |
| 221 | Ga0207651_10431489 | 3300025960 | Bacteria | 1127 |
| 222 | Ga0207640_10623084 | 3300025981 | Bacteria | 916 |
| 223 | Ga0207658_10475518 | 3300025986 | Unclassified | 1110 |
| 224 | Ga0207677_10099073 | 3300026023 | Bacteria | 2139 |
| 225 | Ga0207677_10206723 | 3300026023 | Bacteria | 1564 |
| 226 | Ga0207703_10155014 | 3300026035 | Bacteria | 2001 |
| 227 | Ga0207703_11389969 | 3300026035 | Bacteria | 675 |
| 228 | Ga0207703_11503873 | 3300026035 | Bacteria | 648 |
| 229 | Ga0207639_10296920 | 3300026041 | Bacteria | 1427 |
| 230 | Ga0207702_10089127 | 3300026078 | Bacteria | 2697 |
| 231 | Ga0207641_11275541 | 3300026088 | Bacteria | 735 |
| 232 | Ga0207648_10120102 | 3300026089 | Bacteria | 2311 |
| 233 | Ga0207648_10296374 | 3300026089 | Bacteria | 1449 |
| 234 | Ga0207648_10548744 | 3300026089 | Bacteria | 1061 |
| 235 | Ga0207676_10551860 | 3300026095 | Bacteria | 1101 |
| 236 | Ga0207676_10597680 | 3300026095 | Unclassified | 1059 |
| 237 | Ga0207674_10034462 | 3300026116 | Bacteria | 5291 |
| 238 | Ga0207674_10161706 | 3300026116 | Bacteria | 2193 |
| 239 | Ga0207683_10101973 | 3300026121 | Bacteria | 2562 |
| 240 | Ga0207683_10734760 | 3300026121 | Bacteria | 916 |
| 241 | Ga0207698_10180151 | 3300026142 | Bacteria | 1871 |
| 242 | Ga0207698_10576428 | 3300026142 | Bacteria | 1106 |
| 243 | Ga0207698_10878980 | 3300026142 | Bacteria | 902 |
| 244 | Ga0207698_11156334 | 3300026142 | Bacteria | 787 |
| 245 | Ga0209966_1000835 | 3300027695 | Bacteria | 6021 |
| 246 | Ga0209998_10001531 | 3300027717 | Bacteria | 5557 |
| 247 | Ga0268265_10089060 | 3300028380 | Bacteria | 2460 |
| 248 | Ga0268265_11923232 | 3300028380 | Unclassified | 598 |
| 249 | Ga0268264_10222550 | 3300028381 | Bacteria | 1738 |
| 250 | Ga0268264_12069199 | 3300028381 | Bacteria | 578 |
| 251 | Ga0307408_100063499 | 3300031548 | Bacteria | 2702 |
| 252 | Ga0307408_100240934 | 3300031548 | Bacteria | 1486 |
| 253 | Ga0307408_100645161 | 3300031548 | Unclassified | 946 |
| 254 | Ga0307408_100833522 | 3300031548 | Bacteria | 839 |
| 255 | Ga0307405_10162701 | 3300031731 | Bacteria | 1583 |
| 256 | Ga0307405_10539989 | 3300031731 | Bacteria | 941 |
| 257 | Ga0307405_10626122 | 3300031731 | Bacteria | 881 |
| 258 | Ga0307413_10423155 | 3300031824 | Bacteria | 1049 |
| 259 | Ga0307413_10823902 | 3300031824 | Bacteria | 782 |
| 260 | Ga0307410_10114407 | 3300031852 | Bacteria | 1957 |
| 261 | Ga0307410_10441015 | 3300031852 | Bacteria | 1060 |
| 262 | Ga0307410_10567202 | 3300031852 | Bacteria | 943 |
| 263 | Ga0307410_10796726 | 3300031852 | Bacteria | 803 |
| 264 | Ga0307406_10492510 | 3300031901 | Bacteria | 992 |
| 265 | Ga0307406_10596832 | 3300031901 | Unclassified | 910 |
| 266 | Ga0307406_10772445 | 3300031901 | Unclassified | 808 |
| 267 | Ga0307406_10953578 | 3300031901 | Bacteria | 733 |
| 268 | Ga0307407_10026723 | 3300031903 | Bacteria | 3061 |
| 269 | Ga0307407_10079794 | 3300031903 | Bacteria | 1975 |
| 270 | Ga0307407_10656442 | 3300031903 | Bacteria | 786 |
| 271 | Ga0307412_10141121 | 3300031911 | Bacteria | 1765 |
| 272 | Ga0307409_100034873 | 3300031995 | Bacteria | 3681 |
| 273 | Ga0307409_100051382 | 3300031995 | Bacteria | 3154 |
| 274 | Ga0307409_100059363 | 3300031995 | Bacteria | 2976 |
| 275 | Ga0307409_100570351 | 3300031995 | Bacteria | 1114 |
| 276 | Ga0307409_100994486 | 3300031995 | Bacteria | 856 |
| 277 | Ga0307409_102071671 | 3300031995 | Unclassified | 599 |
| 278 | Ga0307416_100045725 | 3300032002 | Bacteria | 3449 |
| 279 | Ga0307416_100072597 | 3300032002 | Bacteria | 2865 |
| 280 | Ga0307416_100200290 | 3300032002 | Bacteria | 1894 |
| 281 | Ga0307416_100505687 | 3300032002 | Bacteria | 1274 |
| 282 | Ga0307416_100816152 | 3300032002 | Bacteria | 1029 |
| 283 | Ga0307416_101628727 | 3300032002 | Bacteria | 751 |
| 284 | Ga0307414_10931956 | 3300032004 | Bacteria | 797 |
| 285 | Ga0307411_10141866 | 3300032005 | Bacteria | 1772 |
| 286 | Ga0307415_100022134 | 3300032126 | Bacteria | 3919 |
| 287 | Ga0307415_100489928 | 3300032126 | Bacteria | 1072 |
| 288 | Ga0307415_101871724 | 3300032126 | Bacteria | 582 |
| 289 | Ga0373934_0000293 | 3300035086 | Bacteria | 17846 |
| 290 | Ga0373934_0210043 | 3300035086 | Bacteria | 802 |
| 291 | Ga0373923_0088089 | 3300035111 | Bacteria | 1355 |
| 292 | Ga0373945_0227418 | 3300035116 | Bacteria | 782 |
| 293 | Ga0373953_0073300 | 3300035117 | Bacteria | 1415 |
| 294 | Ga0373954_0031471 | 3300035118 | Unclassified | 2450 |
| 295 | Ga0373957_0153798 | 3300035120 | Unclassified | 945 |
| 296 | Ga0373955_0058485 | 3300035172 | Unclassified | 2121 |
| 297 | Ga0373931_0141728 | 3300035691 | Bacteria | 1393 |
| 298 | Ga0373927_0134849 | 3300035695 | Unclassified | 1613 |
| 299 | Ga0373933_0073401 | 3300035724 | Unclassified | 2084 |
| 300 | Ga0373947_0773221 | 3300035725 | Bacteria | 655 |
| 301 | Ga0373937_0066447 | 3300036401 | Bacteria | 3321 |
| 302 | Ga0373937_0159082 | 3300036401 | Unclassified | 2117 |
| 303 | Ga0373937_0688196 | 3300036401 | Bacteria | 969 |
| 304 | Ga0373925_0093739 | 3300037068 | Bacteria | 2299 |
| 305 | Ga0436365_0021122 | 3300039437 | Bacteria | 671 |
| 306 | Ga0436365_0885495 | 3300039437 | Bacteria | 1488 |
| 307 | Ga0436365_1470567 | 3300039437 | Unclassified | 628 |
| 308 | Ga0436365_1604064 | 3300039437 | Bacteria | 1233 |
| 309 | Ga0451843_0085456 | 3300041509 | Unclassified | 636 |
| 310 | Ga0439448_0343824 | 3300042005 | Bacteria | 532 |
| 311 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 312 | Ga0451577_0296306 | 3300042876 | Bacteria | 1466 |
| 313 | Ga0451577_0373686 | 3300042876 | Bacteria | 1293 |
| 314 | Ga0453683_0463882 | 3300044673 | Bacteria | 820 |
| 315 | Ga0453684_1043521 | 3300044712 | Bacteria | 867 |
| 316 | Ga0466957_0490301 | 3300044842 | Bacteria | 851 |
| 317 | Ga0451576_1401698 | 3300045051 | Bacteria | 727 |
| 318 | Ga0466967_0206982 | 3300045976 | Bacteria | 1860 |
| 319 | Ga0495592_0116481 | 3300046454 | Bacteria | 1885 |
| 320 | Ga0495603_0837274 | 3300046455 | Bacteria | 524 |
| 321 | Ga0495629_0151434 | 3300046459 | Bacteria | 1612 |
| 322 | Ga0495651_0017248 | 3300046462 | Bacteria | 5594 |
| 323 | Ga0495651_0635881 | 3300046462 | Bacteria | 670 |
| 324 | Ga0495653_0006579 | 3300046463 | Bacteria | 9541 |
| 325 | Ga0495653_0540856 | 3300046463 | Bacteria | 722 |
| 326 | Ga0495580_0034672 | 3300046472 | Bacteria | 3632 |
| 327 | Ga0495580_0270256 | 3300046472 | Unclassified | 1161 |
| 328 | Ga0495582_0158199 | 3300046473 | Bacteria | 1288 |
| 329 | Ga0495639_0068120 | 3300046475 | Bacteria | 1640 |
| 330 | Ga0495664_0002444 | 3300046477 | Bacteria | 9992 |
| 331 | Ga0495594_0041900 | 3300046499 | Bacteria | 2507 |
| 332 | Ga0495594_0725342 | 3300046499 | Bacteria | 561 |
| 333 | Ga0495596_0084661 | 3300046500 | Bacteria | 1231 |
| 334 | Ga0495618_0219225 | 3300046514 | Bacteria | 1200 |
| 335 | Ga0495628_0251966 | 3300046516 | Unclassified | 1318 |
| 336 | Ga0495630_0190732 | 3300046517 | Bacteria | 1564 |
| 337 | Ga0495630_0508147 | 3300046517 | Bacteria | 924 |
| 338 | Ga0495663_0023683 | 3300046525 | Bacteria | 1780 |
| 339 | Ga0495666_0026233 | 3300046526 | Bacteria | 2875 |
| 340 | Ga0495652_0015481 | 3300046529 | Bacteria | 6828 |
| 341 | Ga0495665_0032734 | 3300046531 | Bacteria | 2781 |
| 342 | Ga0495640_0278403 | 3300046533 | Bacteria | 1042 |
| 343 | Ga0495587_0005246 | 3300046536 | Bacteria | 8470 |
| 344 | Ga0495598_0100400 | 3300046537 | Unclassified | 957 |
| 345 | Ga0495645_0015420 | 3300046543 | Bacteria | 5435 |
| 346 | Ga0495667_0037599 | 3300046559 | Bacteria | 3225 |
| 347 | Ga0495634_0147107 | 3300046642 | Bacteria | 1492 |
| 348 | Ga0495635_0059591 | 3300046663 | Unclassified | 2625 |
| 349 | Ga0495657_0015443 | 3300046675 | Bacteria | 5589 |
| 350 | Ga0495599_0000601 | 3300046678 | Bacteria | 20506 |
| 351 | Ga0495623_0218254 | 3300046679 | Bacteria | 1088 |
| 352 | Ga0495646_0120610 | 3300046680 | Unclassified | 1484 |
| 353 | Ga0495669_0111947 | 3300046684 | Bacteria | 1275 |
| 354 | Ga0495604_0019728 | 3300047317 | Bacteria | 5393 |
| 355 | Ga0495604_0325505 | 3300047317 | Bacteria | 1026 |
| 356 | Ga0495674_0115057 | 3300047319 | Bacteria | 2277 |
| 357 | Ga0495680_0495512 | 3300047322 | Unclassified | 830 |
| 358 | Ga0495675_0073422 | 3300047444 | Unclassified | 2157 |
| 359 | Ga0495684_0004376 | 3300047471 | Bacteria | 11039 |
| 360 | Ga0495684_0140551 | 3300047471 | Bacteria | 1810 |
| 361 | Ga0495593_0040619 | 3300047673 | Bacteria | 2504 |
| 362 | Ga0495593_0428591 | 3300047673 | Bacteria | 662 |
| 363 | Ga0495602_0106159 | 3300048088 | Bacteria | 2293 |
| 364 | Ga0495602_0107033 | 3300048088 | Unclassified | 2280 |
| 365 | Ga0495614_0280431 | 3300048089 | Bacteria | 767 |
| 366 | Ga0496100_0760465 | 3300048903 | Bacteria | 758 |
| 367 | Ga0496101_0300825 | 3300048904 | Bacteria | 1256 |
| 368 | Ga0496104_0153824 | 3300048907 | Bacteria | 2208 |
| 369 | Ga0496104_0535484 | 3300048907 | Bacteria | 1082 |
| 370 | Ga0496105_0829957 | 3300048908 | Unclassified | 701 |
| 371 | Ga0496105_0843242 | 3300048908 | Bacteria | 694 |
| 372 | Ga0496108_0202274 | 3300048911 | Bacteria | 1724 |
| 373 | Ga0496109_0071184 | 3300048912 | Bacteria | 3192 |
| 374 | Ga0496111_0744889 | 3300048914 | Bacteria | 711 |
| 375 | Ga0496112_0001391 | 3300048915 | Bacteria | 18471 |
| 376 | Ga0496112_0739655 | 3300048915 | Bacteria | 910 |
| 377 | Ga0496113_0053691 | 3300048916 | Bacteria | 3013 |
| 378 | Ga0496113_0387117 | 3300048916 | Bacteria | 1122 |
| 379 | Ga0496115_0205628 | 3300048918 | Bacteria | 1626 |
| 380 | Ga0501292_058929 | 3300049515 | Bacteria | 693 |
| 381 | Ga0501034_0132447 | 3300049571 | Bacteria | 2476 |
| 382 | Ga0501036_0124263 | 3300049572 | Bacteria | 2179 |
| 383 | Ga0501036_0238135 | 3300049572 | Bacteria | 1527 |
| 384 | Ga0501038_0025795 | 3300049574 | Bacteria | 5237 |
| 385 | Ga0501043_0053837 | 3300049579 | Bacteria | 3160 |
| 386 | Ga0501043_0250074 | 3300049579 | Bacteria | 1366 |
| 387 | Ga0501047_0253845 | 3300049581 | Bacteria | 1607 |
| 388 | Ga0501070_0209975 | 3300049586 | Bacteria | 1598 |
| 389 | Ga0501073_0100042 | 3300049589 | Bacteria | 2013 |
| 390 | Ga0501199_008483 | 3300049650 | Bacteria | 1076 |
| 391 | Ga0501201_001905 | 3300049651 | Bacteria | 1933 |
| 392 | Ga0501202_005390 | 3300049652 | Bacteria | 2266 |
| 393 | Ga0501207_005832 | 3300049654 | Bacteria | 1714 |
| 394 | Ga0501208_008582 | 3300049655 | Bacteria | 1384 |
| 395 | Ga0501209_030389 | 3300049656 | Bacteria | 1365 |
| 396 | Ga0501216_002554 | 3300049660 | Bacteria | 2596 |
| 397 | Ga0501217_028328 | 3300049661 | Bacteria | 1364 |
| 398 | Ga0501223_046661 | 3300049663 | Bacteria | 840 |
| 399 | Ga0501227_004975 | 3300049665 | Bacteria | 2854 |
| 400 | Ga0501228_002271 | 3300049666 | Bacteria | 1491 |
| 401 | Ga0501233_141486 | 3300049668 | Bacteria | 665 |
| 402 | Ga0501235_032152 | 3300049669 | Bacteria | 1186 |
| 403 | Ga0501239_065061 | 3300049672 | Bacteria | 556 |
| 404 | Ga0501242_006750 | 3300049674 | Bacteria | 1315 |
| 405 | Ga0501243_003821 | 3300049675 | Bacteria | 2247 |
| 406 | Ga0501247_005060 | 3300049677 | Bacteria | 1459 |
| 407 | Ga0501249_095455 | 3300049679 | Bacteria | 708 |
| 408 | Ga0501253_005469 | 3300049683 | Bacteria | 1669 |
| 409 | Ga0501258_002299 | 3300049687 | Bacteria | 1665 |
| 410 | Ga0501221_007663 | 3300049704 | Bacteria | 1857 |
| 411 | Ga0501225_0002161 | 3300049705 | Bacteria | 6090 |
| 412 | Ga0501245_002914 | 3300049708 | Bacteria | 2302 |
| 413 | Ga0501263_019240 | 3300049760 | Bacteria | 908 |
| 414 | Ga0501265_009097 | 3300049762 | Bacteria | 1195 |
| 415 | Ga0501266_002054 | 3300049763 | Bacteria | 2535 |
| 416 | Ga0501267_002335 | 3300049764 | Bacteria | 1693 |
| 417 | Ga0501268_097509 | 3300049765 | Bacteria | 626 |
| 418 | Ga0501270_004461 | 3300049767 | Bacteria | 1573 |
| 419 | Ga0501272_005504 | 3300049769 | Bacteria | 1335 |
| 420 | Ga0501274_012633 | 3300049771 | Bacteria | 802 |
| 421 | Ga0501276_003162 | 3300049773 | Bacteria | 1187 |
| 422 | Ga0501283_006406 | 3300049779 | Bacteria | 1648 |
| 423 | Ga0501035_0063241 | 3300049822 | Bacteria | 3292 |
| 424 | Ga0501044_0108041 | 3300049823 | Bacteria | 2793 |
| 425 | Ga0501204_011863 | 3300049850 | Bacteria | 1039 |
| 426 | nmdc:mga05p37_40950_c1 | 3300050507 | Bacteria | 5689 |
| 427 | nmdc:mga06r32_751810_c1 | 3300050510 | Unclassified | 938 |
| 428 | nmdc:mga08y16_305515_c1 | 3300050511 | Bacteria | 1639 |
| 429 | nmdc:mga08y16_679477_c1 | 3300050511 | Unclassified | 1031 |
| 430 | nmdc:mga0n895_243691_c1 | 3300050512 | Archaea | 1824 |
| 431 | nmdc:mga0n895_46848_c1 | 3300050512 | Bacteria | 4225 |
| 432 | Ga0495601_0171417 | 3300053077 | Bacteria | 1418 |
| 433 | Ga0495612_0095624 | 3300053078 | Bacteria | 1261 |
| 434 | Ga0495595_0019267 | 3300053084 | Unclassified | 2960 |
| 435 | Ga0495619_0027527 | 3300053085 | Unclassified | 3662 |
| 436 | Ga0501082_0953368 | 3300060353 | Bacteria | 750 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005345 | Ga0070692_10452105 | Ga0070692_104521051 | 134 |
| 2 | 3300005535 | Ga0070684_100840772 | Ga0070684_1008407722 | 137 |
| 3 | 3300042005 | Ga0439448_0343824 | Ga0439448_0343824_81_506 | 137 |
| 4 | 3300031548 | Ga0307408_100063499 | Ga0307408_1000634992 | 144 |
| 5 | 3300005530 | Ga0070679_100031927 | Ga0070679_1000319272 | 145 |
| 6 | 3300025921 | Ga0207652_10015239 | Ga0207652_100152392 | 145 |
| 7 | 3300025949 | Ga0207667_10023560 | Ga0207667_100235607 | 145 |
| 8 | 3300031548 | Ga0307408_100240934 | Ga0307408_1002409342 | 145 |
| 9 | 3300031903 | Ga0307407_10026723 | Ga0307407_100267234 | 145 |
| 10 | 3300031911 | Ga0307412_10141121 | Ga0307412_101411213 | 145 |
| 11 | 3300031995 | Ga0307409_100051382 | Ga0307409_1000513824 | 145 |
| 12 | 3300032126 | Ga0307415_100489928 | Ga0307415_1004899282 | 145 |
| 13 | 3300041509 | Ga0451843_0085456 | Ga0451843_0085456_122_559 | 145 |
| 14 | 3300049515 | Ga0501292_058929 | Ga0501292_058929_235_672 | 145 |
| 15 | 3300049650 | Ga0501199_008483 | Ga0501199_008483_584_1021 | 145 |
| 16 | 3300049651 | Ga0501201_001905 | Ga0501201_001905_733_1170 | 145 |
| 17 | 3300049652 | Ga0501202_005390 | Ga0501202_005390_174_611 | 145 |
| 18 | 3300049654 | Ga0501207_005832 | Ga0501207_005832_1209_1646 | 145 |
| 19 | 3300049655 | Ga0501208_008582 | Ga0501208_008582_52_489 | 145 |
| 20 | 3300049656 | Ga0501209_030389 | Ga0501209_030389_214_651 | 145 |
| 21 | 3300049660 | Ga0501216_002554 | Ga0501216_002554_951_1388 | 145 |
| 22 | 3300049661 | Ga0501217_028328 | Ga0501217_028328_173_610 | 145 |
| 23 | 3300049663 | Ga0501223_046661 | Ga0501223_046661_76_513 | 145 |
| 24 | 3300049665 | Ga0501227_004975 | Ga0501227_004975_2168_2605 | 145 |
| 25 | 3300049666 | Ga0501228_002271 | Ga0501228_002271_924_1361 | 145 |
| 26 | 3300049668 | Ga0501233_141486 | Ga0501233_141486_91_528 | 145 |
| 27 | 3300049669 | Ga0501235_032152 | Ga0501235_032152_173_610 | 145 |
| 28 | 3300049672 | Ga0501239_065061 | Ga0501239_065061_41_478 | 145 |
| 29 | 3300049674 | Ga0501242_006750 | Ga0501242_006750_70_507 | 145 |
| 30 | 3300049675 | Ga0501243_003821 | Ga0501243_003821_824_1261 | 145 |
| 31 | 3300049677 | Ga0501247_005060 | Ga0501247_005060_705_1142 | 145 |
| 32 | 3300049679 | Ga0501249_095455 | Ga0501249_095455_223_660 | 145 |
| 33 | 3300049683 | Ga0501253_005469 | Ga0501253_005469_814_1251 | 145 |
| 34 | 3300049687 | Ga0501258_002299 | Ga0501258_002299_20_457 | 145 |
| 35 | 3300049704 | Ga0501221_007663 | Ga0501221_007663_1210_1647 | 145 |
| 36 | 3300049705 | Ga0501225_0002161 | Ga0501225_0002161_5416_5853 | 145 |
| 37 | 3300049708 | Ga0501245_002914 | Ga0501245_002914_516_953 | 145 |
| 38 | 3300049760 | Ga0501263_019240 | Ga0501263_019240_253_690 | 145 |
| 39 | 3300049762 | Ga0501265_009097 | Ga0501265_009097_705_1142 | 145 |
| 40 | 3300049763 | Ga0501266_002054 | Ga0501266_002054_807_1244 | 145 |
| 41 | 3300049764 | Ga0501267_002335 | Ga0501267_002335_1068_1505 | 145 |
| 42 | 3300049767 | Ga0501270_004461 | Ga0501270_004461_866_1303 | 145 |
| 43 | 3300049769 | Ga0501272_005504 | Ga0501272_005504_236_673 | 145 |
| 44 | 3300049771 | Ga0501274_012633 | Ga0501274_012633_231_668 | 145 |
| 45 | 3300049773 | Ga0501276_003162 | Ga0501276_003162_657_1094 | 145 |
| 46 | 3300049779 | Ga0501283_006406 | Ga0501283_006406_17_454 | 145 |
| 47 | 3300049850 | Ga0501204_011863 | Ga0501204_011863_76_513 | 145 |
| 48 | 3300005329 | Ga0070683_100076695 | Ga0070683_1000766954 | 146 |
| 49 | 3300005439 | Ga0070711_100252674 | Ga0070711_1002526742 | 146 |
| 50 | 3300005535 | Ga0070684_100026279 | Ga0070684_1000262794 | 146 |
| 51 | 3300005564 | Ga0070664_100026888 | Ga0070664_1000268883 | 146 |
| 52 | 3300025944 | Ga0207661_10061688 | Ga0207661_100616884 | 146 |
| 53 | 3300025945 | Ga0207679_10261914 | Ga0207679_102619141 | 146 |
| 54 | 3300036401 | Ga0373937_0688196 | Ga0373937_0688196_386_841 | 146 |
| 55 | 3300046475 | Ga0495639_0068120 | Ga0495639_0068120_420_875 | 146 |
| 56 | 3300005467 | Ga0070706_100146484 | Ga0070706_1001464842 | 147 |
| 57 | 3300005468 | Ga0070707_100010058 | Ga0070707_1000100588 | 147 |
| 58 | 3300005535 | Ga0070684_100902311 | Ga0070684_1009023112 | 147 |
| 59 | 3300005536 | Ga0070697_101252333 | Ga0070697_1012523332 | 147 |
| 60 | 3300005544 | Ga0070686_100541819 | Ga0070686_1005418191 | 147 |
| 61 | 3300005564 | Ga0070664_100051865 | Ga0070664_1000518653 | 147 |
| 62 | 3300006844 | Ga0075428_100746630 | Ga0075428_1007466302 | 147 |
| 63 | 3300006871 | Ga0075434_100593893 | Ga0075434_1005938931 | 147 |
| 64 | 3300009147 | Ga0114129_10011564 | Ga0114129_100115645 | 147 |
| 65 | 3300021384 | Ga0213876_10112853 | Ga0213876_101128532 | 147 |
| 66 | 3300025925 | Ga0207650_10212791 | Ga0207650_102127912 | 147 |
| 67 | 3300025944 | Ga0207661_10330814 | Ga0207661_103308142 | 147 |
| 68 | 3300025945 | Ga0207679_10095411 | Ga0207679_100954112 | 147 |
| 69 | 3300026121 | Ga0207683_10734760 | Ga0207683_107347602 | 147 |
| 70 | 3300039437 | Ga0436365_0885495 | Ga0436365_0885495_422_865 | 147 |
| 71 | 3300050507 | nmdc:mga05p37_40950_c1 | nmdc:mga05p37_40950_c1_2899_3354 | 147 |
| 72 | 3300050510 | nmdc:mga06r32_751810_c1 | nmdc:mga06r32_751810_c1_24_479 | 147 |
| 73 | 3300050512 | nmdc:mga0n895_243691_c1 | nmdc:mga0n895_243691_c1_717_1172 | 147 |
| 74 | 3300005518 | Ga0070699_100991879 | Ga0070699_1009918792 | 148 |
| 75 | 3300005546 | Ga0070696_100000496 | Ga0070696_1000004969 | 148 |
| 76 | 3300009094 | Ga0111539_10234403 | Ga0111539_102344032 | 148 |
| 77 | 3300025944 | Ga0207661_10040061 | Ga0207661_100400612 | 148 |
| 78 | 3300031852 | Ga0307410_10114407 | Ga0307410_101144072 | 148 |
| 79 | 3300031901 | Ga0307406_10772445 | Ga0307406_107724451 | 148 |
| 80 | 3300031903 | Ga0307407_10079794 | Ga0307407_100797944 | 148 |
| 81 | 3300031995 | Ga0307409_100059363 | Ga0307409_1000593632 | 148 |
| 82 | 3300032002 | Ga0307416_100072597 | Ga0307416_1000725972 | 148 |
| 83 | 3300044712 | Ga0453684_1043521 | Ga0453684_1043521_115_561 | 148 |
| 84 | 3300046516 | Ga0495628_0251966 | Ga0495628_0251966_197_655 | 148 |
| 85 | 3300048918 | Ga0496115_0205628 | Ga0496115_0205628_1047_1493 | 148 |
| 86 | 3300049572 | Ga0501036_0124263 | Ga0501036_0124263_244_690 | 148 |
| 87 | 3300049574 | Ga0501038_0025795 | Ga0501038_0025795_3186_3632 | 148 |
| 88 | 3300049579 | Ga0501043_0250074 | Ga0501043_0250074_348_794 | 148 |
| 89 | 3300049822 | Ga0501035_0063241 | Ga0501035_0063241_1005_1451 | 148 |
| 90 | 3300050511 | nmdc:mga08y16_679477_c1 | nmdc:mga08y16_679477_c1_445_894 | 148 |
| 91 | 3300005354 | Ga0070675_100855953 | Ga0070675_1008559532 | 149 |
| 92 | 3300005440 | Ga0070705_100461561 | Ga0070705_1004615611 | 149 |
| 93 | 3300005441 | Ga0070700_101250016 | Ga0070700_1012500161 | 149 |
| 94 | 3300005614 | Ga0068856_100115052 | Ga0068856_1001150522 | 149 |
| 95 | 3300006871 | Ga0075434_100092140 | Ga0075434_1000921403 | 149 |
| 96 | 3300025926 | Ga0207659_10046367 | Ga0207659_100463672 | 149 |
| 97 | 3300026078 | Ga0207702_10089127 | Ga0207702_100891272 | 149 |
| 98 | 3300031852 | Ga0307410_10796726 | Ga0307410_107967261 | 149 |
| 99 | 3300031995 | Ga0307409_100570351 | Ga0307409_1005703512 | 149 |
| 100 | 3300032002 | Ga0307416_101628727 | Ga0307416_1016287272 | 149 |
| 101 | 3300045051 | Ga0451576_1401698 | Ga0451576_1401698_218_667 | 149 |
| 102 | 3300050512 | nmdc:mga0n895_46848_c1 | nmdc:mga0n895_46848_c1_1112_1561 | 149 |
| 103 | 3300005329 | Ga0070683_100190604 | Ga0070683_1001906043 | 150 |
| 104 | 3300005335 | Ga0070666_10112680 | Ga0070666_101126802 | 150 |
| 105 | 3300005343 | Ga0070687_100049095 | Ga0070687_1000490952 | 150 |
| 106 | 3300005347 | Ga0070668_100339529 | Ga0070668_1003395291 | 150 |
| 107 | 3300005353 | Ga0070669_100359374 | Ga0070669_1003593741 | 150 |
| 108 | 3300005354 | Ga0070675_100071158 | Ga0070675_1000711584 | 150 |
| 109 | 3300005364 | Ga0070673_100155549 | Ga0070673_1001555493 | 150 |
| 110 | 3300005365 | Ga0070688_100040698 | Ga0070688_1000406982 | 150 |
| 111 | 3300005366 | Ga0070659_101275923 | Ga0070659_1012759231 | 150 |
| 112 | 3300005438 | Ga0070701_10234187 | Ga0070701_102341872 | 150 |
| 113 | 3300005441 | Ga0070700_100457804 | Ga0070700_1004578042 | 150 |
| 114 | 3300005458 | Ga0070681_10316182 | Ga0070681_103161822 | 150 |
| 115 | 3300005458 | Ga0070681_10878226 | Ga0070681_108782261 | 150 |
| 116 | 3300005544 | Ga0070686_100066152 | Ga0070686_1000661523 | 150 |
| 117 | 3300005548 | Ga0070665_100379411 | Ga0070665_1003794112 | 150 |
| 118 | 3300005617 | Ga0068859_100040042 | Ga0068859_1000400423 | 150 |
| 119 | 3300005617 | Ga0068859_101112997 | Ga0068859_1011129971 | 150 |
| 120 | 3300005842 | Ga0068858_101705123 | Ga0068858_1017051231 | 150 |
| 121 | 3300006237 | Ga0097621_100560617 | Ga0097621_1005606172 | 150 |
| 122 | 3300006931 | Ga0097620_100040044 | Ga0097620_1000400443 | 150 |
| 123 | 3300006931 | Ga0097620_101113050 | Ga0097620_1011130501 | 150 |
| 124 | 3300006931 | Ga0097620_101734714 | Ga0097620_1017347141 | 150 |
| 125 | 3300009093 | Ga0105240_12225167 | Ga0105240_122251671 | 150 |
| 126 | 3300009098 | Ga0105245_10826512 | Ga0105245_108265121 | 150 |
| 127 | 3300009176 | Ga0105242_10233433 | Ga0105242_102334332 | 150 |
| 128 | 3300009176 | Ga0105242_10958388 | Ga0105242_109583882 | 150 |
| 129 | 3300009177 | Ga0105248_10058339 | Ga0105248_100583394 | 150 |
| 130 | 3300009177 | Ga0105248_10515167 | Ga0105248_105151672 | 150 |
| 131 | 3300009545 | Ga0105237_10047956 | Ga0105237_100479563 | 150 |
| 132 | 3300009551 | Ga0105238_10040602 | Ga0105238_100406025 | 150 |
| 133 | 3300013105 | Ga0157369_10087018 | Ga0157369_100870183 | 150 |
| 134 | 3300013306 | Ga0163162_10088268 | Ga0163162_100882682 | 150 |
| 135 | 3300013307 | Ga0157372_10009123 | Ga0157372_100091234 | 150 |
| 136 | 3300013308 | Ga0157375_10110332 | Ga0157375_101103324 | 150 |
| 137 | 3300017792 | Ga0163161_10379980 | Ga0163161_103799802 | 150 |
| 138 | 3300025906 | Ga0207699_10196256 | Ga0207699_101962561 | 150 |
| 139 | 3300025917 | Ga0207660_10563046 | Ga0207660_105630462 | 150 |
| 140 | 3300025918 | Ga0207662_10018764 | Ga0207662_100187644 | 150 |
| 141 | 3300025923 | Ga0207681_10130392 | Ga0207681_101303921 | 150 |
| 142 | 3300025926 | Ga0207659_10030642 | Ga0207659_100306422 | 150 |
| 143 | 3300025927 | Ga0207687_10687235 | Ga0207687_106872352 | 150 |
| 144 | 3300025938 | Ga0207704_10099373 | Ga0207704_100993731 | 150 |
| 145 | 3300025941 | Ga0207711_10270984 | Ga0207711_102709842 | 150 |
| 146 | 3300025942 | Ga0207689_10437194 | Ga0207689_104371941 | 150 |
| 147 | 3300025960 | Ga0207651_10431489 | Ga0207651_104314892 | 150 |
| 148 | 3300025986 | Ga0207658_10475518 | Ga0207658_104755182 | 150 |
| 149 | 3300026035 | Ga0207703_10155014 | Ga0207703_101550142 | 150 |
| 150 | 3300026089 | Ga0207648_10548744 | Ga0207648_105487442 | 150 |
| 151 | 3300026121 | Ga0207683_10101973 | Ga0207683_101019732 | 150 |
| 152 | 3300028380 | Ga0268265_10089060 | Ga0268265_100890601 | 150 |
| 153 | 3300031852 | Ga0307410_10567202 | Ga0307410_105672021 | 150 |
| 154 | 3300031901 | Ga0307406_10953578 | Ga0307406_109535782 | 150 |
| 155 | 3300032002 | Ga0307416_100045725 | Ga0307416_1000457253 | 150 |
| 156 | 3300032126 | Ga0307415_101871724 | Ga0307415_1018717241 | 150 |
| 157 | 3300005435 | Ga0070714_100035350 | Ga0070714_1000353504 | 151 |
| 158 | 3300005436 | Ga0070713_100000627 | Ga0070713_1000006274 | 151 |
| 159 | 3300005436 | Ga0070713_101508815 | Ga0070713_1015088151 | 151 |
| 160 | 3300005530 | Ga0070679_100731964 | Ga0070679_1007319641 | 151 |
| 161 | 3300005535 | Ga0070684_100006390 | Ga0070684_1000063907 | 151 |
| 162 | 3300005985 | Ga0081539_10218039 | Ga0081539_102180392 | 151 |
| 163 | 3300006914 | Ga0075436_100543883 | Ga0075436_1005438832 | 151 |
| 164 | 3300009545 | Ga0105237_10068050 | Ga0105237_100680503 | 151 |
| 165 | 3300013100 | Ga0157373_10118821 | Ga0157373_101188212 | 151 |
| 166 | 3300013307 | Ga0157372_10306962 | Ga0157372_103069621 | 151 |
| 167 | 3300015265 | Ga0182005_1080332 | Ga0182005_10803322 | 151 |
| 168 | 3300025917 | Ga0207660_10005128 | Ga0207660_100051288 | 151 |
| 169 | 3300025921 | Ga0207652_10830258 | Ga0207652_108302582 | 151 |
| 170 | 3300025928 | Ga0207700_10003191 | Ga0207700_100031916 | 151 |
| 171 | 3300025939 | Ga0207665_10251091 | Ga0207665_102510912 | 151 |
| 172 | 3300025944 | Ga0207661_10361840 | Ga0207661_103618402 | 151 |
| 173 | 3300025944 | Ga0207661_11666852 | Ga0207661_116668521 | 151 |
| 174 | 3300025944 | Ga0207661_12025903 | Ga0207661_120259031 | 151 |
| 175 | 3300032004 | Ga0307414_10931956 | Ga0307414_109319561 | 151 |
| 176 | 3300035695 | Ga0373927_0134849 | Ga0373927_0134849_497_952 | 151 |
| 177 | 3300035725 | Ga0373947_0773221 | Ga0373947_0773221_79_534 | 151 |
| 178 | 3300039437 | Ga0436365_1470567 | Ga0436365_1470567_102_557 | 151 |
| 179 | 3300042876 | Ga0451577_0000001 | Ga0451577_0000001_984630_985085 | 151 |
| 180 | 3300044673 | Ga0453683_0463882 | Ga0453683_0463882_158_613 | 151 |
| 181 | 3300046455 | Ga0495603_0837274 | Ga0495603_0837274_27_482 | 151 |
| 182 | 3300046472 | Ga0495580_0270256 | Ga0495580_0270256_393_848 | 151 |
| 183 | 3300046499 | Ga0495594_0725342 | Ga0495594_0725342_75_530 | 151 |
| 184 | 3300046517 | Ga0495630_0190732 | Ga0495630_0190732_152_607 | 151 |
| 185 | 3300047673 | Ga0495593_0040619 | Ga0495593_0040619_1467_1922 | 151 |
| 186 | 3300048089 | Ga0495614_0280431 | Ga0495614_0280431_77_532 | 151 |
| 187 | 3300048915 | Ga0496112_0739655 | Ga0496112_0739655_140_595 | 151 |
| 188 | 3300049765 | Ga0501268_097509 | Ga0501268_097509_22_477 | 151 |
| 189 | 3300005327 | Ga0070658_10314731 | Ga0070658_103147312 | 152 |
| 190 | 3300005344 | Ga0070661_100707960 | Ga0070661_1007079602 | 152 |
| 191 | 3300013100 | Ga0157373_10012829 | Ga0157373_100128298 | 152 |
| 192 | 3300025920 | Ga0207649_10887728 | Ga0207649_108877281 | 152 |
| 193 | 3300031824 | Ga0307413_10823902 | Ga0307413_108239021 | 152 |
| 194 | 3300039437 | Ga0436365_0021122 | Ga0436365_0021122_34_492 | 152 |
| 195 | 3300042876 | Ga0451577_0296306 | Ga0451577_0296306_334_792 | 152 |
| 196 | 3300042876 | Ga0451577_0373686 | Ga0451577_0373686_521_979 | 152 |
| 197 | 3300044842 | Ga0466957_0490301 | Ga0466957_0490301_78_536 | 152 |
| 198 | 3300049571 | Ga0501034_0132447 | Ga0501034_0132447_73_531 | 152 |
| 199 | 3300049579 | Ga0501043_0053837 | Ga0501043_0053837_1128_1586 | 152 |
| 200 | 3300049581 | Ga0501047_0253845 | Ga0501047_0253845_212_670 | 152 |
| 201 | 3300049586 | Ga0501070_0209975 | Ga0501070_0209975_552_1010 | 152 |
| 202 | 3300049589 | Ga0501073_0100042 | Ga0501073_0100042_1004_1462 | 152 |
| 203 | 3300049823 | Ga0501044_0108041 | Ga0501044_0108041_1570_2028 | 152 |
| 204 | 3300005329 | Ga0070683_100051517 | Ga0070683_1000515174 | 153 |
| 205 | 3300005330 | Ga0070690_100053447 | Ga0070690_1000534472 | 153 |
| 206 | 3300005335 | Ga0070666_10452639 | Ga0070666_104526392 | 153 |
| 207 | 3300005336 | Ga0070680_100001474 | Ga0070680_1000014747 | 153 |
| 208 | 3300005336 | Ga0070680_100018397 | Ga0070680_1000183972 | 153 |
| 209 | 3300005338 | Ga0068868_100217064 | Ga0068868_1002170642 | 153 |
| 210 | 3300005340 | Ga0070689_100015116 | Ga0070689_1000151167 | 153 |
| 211 | 3300005343 | Ga0070687_100031366 | Ga0070687_1000313662 | 153 |
| 212 | 3300005344 | Ga0070661_100178988 | Ga0070661_1001789882 | 153 |
| 213 | 3300005345 | Ga0070692_10597278 | Ga0070692_105972781 | 153 |
| 214 | 3300005353 | Ga0070669_100005797 | Ga0070669_1000057972 | 153 |
| 215 | 3300005354 | Ga0070675_100011944 | Ga0070675_1000119446 | 153 |
| 216 | 3300005355 | Ga0070671_100079536 | Ga0070671_1000795363 | 153 |
| 217 | 3300005365 | Ga0070688_100034287 | Ga0070688_1000342873 | 153 |
| 218 | 3300005366 | Ga0070659_100663512 | Ga0070659_1006635122 | 153 |
| 219 | 3300005367 | Ga0070667_100333035 | Ga0070667_1003330353 | 153 |
| 220 | 3300005437 | Ga0070710_10542337 | Ga0070710_105423372 | 153 |
| 221 | 3300005458 | Ga0070681_10000886 | Ga0070681_100008862 | 153 |
| 222 | 3300005466 | Ga0070685_10010038 | Ga0070685_100100386 | 153 |
| 223 | 3300005530 | Ga0070679_100001742 | Ga0070679_1000017425 | 153 |
| 224 | 3300005530 | Ga0070679_100002997 | Ga0070679_1000029972 | 153 |
| 225 | 3300005535 | Ga0070684_100198984 | Ga0070684_1001989843 | 153 |
| 226 | 3300005539 | Ga0068853_100317831 | Ga0068853_1003178312 | 153 |
| 227 | 3300005543 | Ga0070672_100050885 | Ga0070672_1000508855 | 153 |
| 228 | 3300005543 | Ga0070672_100485167 | Ga0070672_1004851672 | 153 |
| 229 | 3300005563 | Ga0068855_100185724 | Ga0068855_1001857242 | 153 |
| 230 | 3300005564 | Ga0070664_100486073 | Ga0070664_1004860732 | 153 |
| 231 | 3300005578 | Ga0068854_100458453 | Ga0068854_1004584532 | 153 |
| 232 | 3300005615 | Ga0070702_101534515 | Ga0070702_1015345151 | 153 |
| 233 | 3300005616 | Ga0068852_100160004 | Ga0068852_1001600042 | 153 |
| 234 | 3300005616 | Ga0068852_100486770 | Ga0068852_1004867702 | 153 |
| 235 | 3300005616 | Ga0068852_100691090 | Ga0068852_1006910902 | 153 |
| 236 | 3300005617 | Ga0068859_100048149 | Ga0068859_1000481493 | 153 |
| 237 | 3300005834 | Ga0068851_10016209 | Ga0068851_100162092 | 153 |
| 238 | 3300005840 | Ga0068870_10011280 | Ga0068870_100112802 | 153 |
| 239 | 3300005841 | Ga0068863_100625602 | Ga0068863_1006256022 | 153 |
| 240 | 3300005843 | Ga0068860_100520259 | Ga0068860_1005202592 | 153 |
| 241 | 3300006881 | Ga0068865_100013784 | Ga0068865_1000137842 | 153 |
| 242 | 3300006931 | Ga0097620_100048148 | Ga0097620_1000481483 | 153 |
| 243 | 3300009094 | Ga0111539_10947665 | Ga0111539_109476652 | 153 |
| 244 | 3300009098 | Ga0105245_10551553 | Ga0105245_105515532 | 153 |
| 245 | 3300009148 | Ga0105243_10471590 | Ga0105243_104715901 | 153 |
| 246 | 3300009176 | Ga0105242_10006413 | Ga0105242_100064131 | 153 |
| 247 | 3300009177 | Ga0105248_10160381 | Ga0105248_101603812 | 153 |
| 248 | 3300009177 | Ga0105248_10380923 | Ga0105248_103809233 | 153 |
| 249 | 3300009177 | Ga0105248_10659199 | Ga0105248_106591992 | 153 |
| 250 | 3300010375 | Ga0105239_11407849 | Ga0105239_114078491 | 153 |
| 251 | 3300013100 | Ga0157373_10035820 | Ga0157373_100358202 | 153 |
| 252 | 3300013105 | Ga0157369_10487739 | Ga0157369_104877392 | 153 |
| 253 | 3300013296 | Ga0157374_10774005 | Ga0157374_107740052 | 153 |
| 254 | 3300013306 | Ga0163162_10234845 | Ga0163162_102348452 | 153 |
| 255 | 3300013306 | Ga0163162_10589466 | Ga0163162_105894662 | 153 |
| 256 | 3300013306 | Ga0163162_10761712 | Ga0163162_107617122 | 153 |
| 257 | 3300013307 | Ga0157372_10008083 | Ga0157372_100080839 | 153 |
| 258 | 3300013307 | Ga0157372_10627934 | Ga0157372_106279342 | 153 |
| 259 | 3300013308 | Ga0157375_10011305 | Ga0157375_100113056 | 153 |
| 260 | 3300013308 | Ga0157375_10035348 | Ga0157375_100353482 | 153 |
| 261 | 3300013308 | Ga0157375_10933396 | Ga0157375_109333961 | 153 |
| 262 | 3300014325 | Ga0163163_10332263 | Ga0163163_103322633 | 153 |
| 263 | 3300014745 | Ga0157377_10007299 | Ga0157377_100072992 | 153 |
| 264 | 3300014745 | Ga0157377_10106645 | Ga0157377_101066452 | 153 |
| 265 | 3300014969 | Ga0157376_10330451 | Ga0157376_103304511 | 153 |
| 266 | 3300025315 | Ga0207697_10148008 | Ga0207697_101480081 | 153 |
| 267 | 3300025899 | Ga0207642_10077958 | Ga0207642_100779582 | 153 |
| 268 | 3300025908 | Ga0207643_10014105 | Ga0207643_100141056 | 153 |
| 269 | 3300025912 | Ga0207707_10011781 | Ga0207707_100117814 | 153 |
| 270 | 3300025912 | Ga0207707_10266300 | Ga0207707_102663002 | 153 |
| 271 | 3300025917 | Ga0207660_10008755 | Ga0207660_100087553 | 153 |
| 272 | 3300025917 | Ga0207660_10009482 | Ga0207660_100094824 | 153 |
| 273 | 3300025917 | Ga0207660_10252284 | Ga0207660_102522842 | 153 |
| 274 | 3300025918 | Ga0207662_10044806 | Ga0207662_100448062 | 153 |
| 275 | 3300025920 | Ga0207649_10552516 | Ga0207649_105525161 | 153 |
| 276 | 3300025920 | Ga0207649_11050955 | Ga0207649_110509551 | 153 |
| 277 | 3300025921 | Ga0207652_10059241 | Ga0207652_100592412 | 153 |
| 278 | 3300025921 | Ga0207652_10062354 | Ga0207652_100623542 | 153 |
| 279 | 3300025921 | Ga0207652_10163193 | Ga0207652_101631934 | 153 |
| 280 | 3300025925 | Ga0207650_10141767 | Ga0207650_101417672 | 153 |
| 281 | 3300025925 | Ga0207650_11260745 | Ga0207650_112607451 | 153 |
| 282 | 3300025926 | Ga0207659_10008335 | Ga0207659_100083353 | 153 |
| 283 | 3300025927 | Ga0207687_10316399 | Ga0207687_103163992 | 153 |
| 284 | 3300025931 | Ga0207644_10164500 | Ga0207644_101645002 | 153 |
| 285 | 3300025933 | Ga0207706_10116177 | Ga0207706_101161772 | 153 |
| 286 | 3300025935 | Ga0207709_10290984 | Ga0207709_102909842 | 153 |
| 287 | 3300025936 | Ga0207670_10009562 | Ga0207670_100095622 | 153 |
| 288 | 3300025938 | Ga0207704_10019472 | Ga0207704_100194722 | 153 |
| 289 | 3300025940 | Ga0207691_10026739 | Ga0207691_100267397 | 153 |
| 290 | 3300025940 | Ga0207691_10047433 | Ga0207691_100474332 | 153 |
| 291 | 3300025941 | Ga0207711_10408719 | Ga0207711_104087192 | 153 |
| 292 | 3300025944 | Ga0207661_10021145 | Ga0207661_100211452 | 153 |
| 293 | 3300025944 | Ga0207661_10033842 | Ga0207661_100338423 | 153 |
| 294 | 3300025944 | Ga0207661_10191268 | Ga0207661_101912683 | 153 |
| 295 | 3300025944 | Ga0207661_10485572 | Ga0207661_104855722 | 153 |
| 296 | 3300025945 | Ga0207679_10016318 | Ga0207679_100163186 | 153 |
| 297 | 3300025945 | Ga0207679_10061628 | Ga0207679_100616281 | 153 |
| 298 | 3300025945 | Ga0207679_10486696 | Ga0207679_104866961 | 153 |
| 299 | 3300025945 | Ga0207679_10773664 | Ga0207679_107736642 | 153 |
| 300 | 3300025960 | Ga0207651_10146569 | Ga0207651_101465692 | 153 |
| 301 | 3300025981 | Ga0207640_10623084 | Ga0207640_106230842 | 153 |
| 302 | 3300026023 | Ga0207677_10099073 | Ga0207677_100990732 | 153 |
| 303 | 3300026023 | Ga0207677_10206723 | Ga0207677_102067232 | 153 |
| 304 | 3300026035 | Ga0207703_11389969 | Ga0207703_113899691 | 153 |
| 305 | 3300026041 | Ga0207639_10296920 | Ga0207639_102969202 | 153 |
| 306 | 3300026089 | Ga0207648_10120102 | Ga0207648_101201022 | 153 |
| 307 | 3300026089 | Ga0207648_10296374 | Ga0207648_102963743 | 153 |
| 308 | 3300026095 | Ga0207676_10551860 | Ga0207676_105518602 | 153 |
| 309 | 3300026116 | Ga0207674_10034462 | Ga0207674_100344622 | 153 |
| 310 | 3300026116 | Ga0207674_10161706 | Ga0207674_101617064 | 153 |
| 311 | 3300026142 | Ga0207698_10180151 | Ga0207698_101801513 | 153 |
| 312 | 3300026142 | Ga0207698_10576428 | Ga0207698_105764282 | 153 |
| 313 | 3300026142 | Ga0207698_10878980 | Ga0207698_108789802 | 153 |
| 314 | 3300026142 | Ga0207698_11156334 | Ga0207698_111563342 | 153 |
| 315 | 3300028381 | Ga0268264_10222550 | Ga0268264_102225502 | 153 |
| 316 | 3300028381 | Ga0268264_12069199 | Ga0268264_120691991 | 153 |
| 317 | 3300031731 | Ga0307405_10162701 | Ga0307405_101627011 | 153 |
| 318 | 3300031824 | Ga0307413_10423155 | Ga0307413_104231552 | 153 |
| 319 | 3300031901 | Ga0307406_10492510 | Ga0307406_104925102 | 153 |
| 320 | 3300035086 | Ga0373934_0000293 | Ga0373934_0000293_6861_7325 | 153 |
| 321 | 3300035086 | Ga0373934_0210043 | Ga0373934_0210043_57_518 | 153 |
| 322 | 3300035111 | Ga0373923_0088089 | Ga0373923_0088089_670_1134 | 153 |
| 323 | 3300035116 | Ga0373945_0227418 | Ga0373945_0227418_287_751 | 153 |
| 324 | 3300035117 | Ga0373953_0073300 | Ga0373953_0073300_493_957 | 153 |
| 325 | 3300035118 | Ga0373954_0031471 | Ga0373954_0031471_1641_2105 | 153 |
| 326 | 3300035120 | Ga0373957_0153798 | Ga0373957_0153798_234_698 | 153 |
| 327 | 3300035172 | Ga0373955_0058485 | Ga0373955_0058485_617_1081 | 153 |
| 328 | 3300035724 | Ga0373933_0073401 | Ga0373933_0073401_494_958 | 153 |
| 329 | 3300036401 | Ga0373937_0066447 | Ga0373937_0066447_1895_2356 | 153 |
| 330 | 3300036401 | Ga0373937_0159082 | Ga0373937_0159082_481_945 | 153 |
| 331 | 3300037068 | Ga0373925_0093739 | Ga0373925_0093739_114_578 | 153 |
| 332 | 3300039437 | Ga0436365_1604064 | Ga0436365_1604064_267_728 | 153 |
| 333 | 3300046454 | Ga0495592_0116481 | Ga0495592_0116481_641_1105 | 153 |
| 334 | 3300046459 | Ga0495629_0151434 | Ga0495629_0151434_326_790 | 153 |
| 335 | 3300046462 | Ga0495651_0017248 | Ga0495651_0017248_1777_2241 | 153 |
| 336 | 3300046462 | Ga0495651_0635881 | Ga0495651_0635881_50_511 | 153 |
| 337 | 3300046463 | Ga0495653_0006579 | Ga0495653_0006579_8459_8923 | 153 |
| 338 | 3300046463 | Ga0495653_0540856 | Ga0495653_0540856_72_533 | 153 |
| 339 | 3300046472 | Ga0495580_0034672 | Ga0495580_0034672_1794_2258 | 153 |
| 340 | 3300046473 | Ga0495582_0158199 | Ga0495582_0158199_87_551 | 153 |
| 341 | 3300046477 | Ga0495664_0002444 | Ga0495664_0002444_126_590 | 153 |
| 342 | 3300046499 | Ga0495594_0041900 | Ga0495594_0041900_1060_1524 | 153 |
| 343 | 3300046500 | Ga0495596_0084661 | Ga0495596_0084661_734_1195 | 153 |
| 344 | 3300046514 | Ga0495618_0219225 | Ga0495618_0219225_80_544 | 153 |
| 345 | 3300046517 | Ga0495630_0508147 | Ga0495630_0508147_379_843 | 153 |
| 346 | 3300046525 | Ga0495663_0023683 | Ga0495663_0023683_816_1277 | 153 |
| 347 | 3300046526 | Ga0495666_0026233 | Ga0495666_0026233_2252_2716 | 153 |
| 348 | 3300046529 | Ga0495652_0015481 | Ga0495652_0015481_1326_1790 | 153 |
| 349 | 3300046531 | Ga0495665_0032734 | Ga0495665_0032734_2160_2624 | 153 |
| 350 | 3300046533 | Ga0495640_0278403 | Ga0495640_0278403_132_596 | 153 |
| 351 | 3300046536 | Ga0495587_0005246 | Ga0495587_0005246_1052_1516 | 153 |
| 352 | 3300046543 | Ga0495645_0015420 | Ga0495645_0015420_3134_3598 | 153 |
| 353 | 3300046559 | Ga0495667_0037599 | Ga0495667_0037599_810_1274 | 153 |
| 354 | 3300046642 | Ga0495634_0147107 | Ga0495634_0147107_91_555 | 153 |
| 355 | 3300046663 | Ga0495635_0059591 | Ga0495635_0059591_1170_1634 | 153 |
| 356 | 3300046675 | Ga0495657_0015443 | Ga0495657_0015443_2539_3003 | 153 |
| 357 | 3300046678 | Ga0495599_0000601 | Ga0495599_0000601_9267_9731 | 153 |
| 358 | 3300046679 | Ga0495623_0218254 | Ga0495623_0218254_454_915 | 153 |
| 359 | 3300046680 | Ga0495646_0120610 | Ga0495646_0120610_508_972 | 153 |
| 360 | 3300046684 | Ga0495669_0111947 | Ga0495669_0111947_654_1115 | 153 |
| 361 | 3300047317 | Ga0495604_0019728 | Ga0495604_0019728_327_791 | 153 |
| 362 | 3300047317 | Ga0495604_0325505 | Ga0495604_0325505_419_880 | 153 |
| 363 | 3300047319 | Ga0495674_0115057 | Ga0495674_0115057_884_1348 | 153 |
| 364 | 3300047322 | Ga0495680_0495512 | Ga0495680_0495512_262_726 | 153 |
| 365 | 3300047444 | Ga0495675_0073422 | Ga0495675_0073422_1064_1528 | 153 |
| 366 | 3300047471 | Ga0495684_0004376 | Ga0495684_0004376_4033_4497 | 153 |
| 367 | 3300047471 | Ga0495684_0140551 | Ga0495684_0140551_1282_1746 | 153 |
| 368 | 3300047673 | Ga0495593_0428591 | Ga0495593_0428591_146_610 | 153 |
| 369 | 3300048088 | Ga0495602_0106159 | Ga0495602_0106159_190_651 | 153 |
| 370 | 3300048088 | Ga0495602_0107033 | Ga0495602_0107033_922_1386 | 153 |
| 371 | 3300048903 | Ga0496100_0760465 | Ga0496100_0760465_48_509 | 153 |
| 372 | 3300048904 | Ga0496101_0300825 | Ga0496101_0300825_526_987 | 153 |
| 373 | 3300048907 | Ga0496104_0153824 | Ga0496104_0153824_1461_1925 | 153 |
| 374 | 3300048908 | Ga0496105_0829957 | Ga0496105_0829957_174_635 | 153 |
| 375 | 3300048908 | Ga0496105_0843242 | Ga0496105_0843242_91_555 | 153 |
| 376 | 3300048914 | Ga0496111_0744889 | Ga0496111_0744889_145_606 | 153 |
| 377 | 3300048916 | Ga0496113_0053691 | Ga0496113_0053691_223_684 | 153 |
| 378 | 3300050511 | nmdc:mga08y16_305515_c1 | nmdc:mga08y16_305515_c1_1156_1617 | 153 |
| 379 | 3300053077 | Ga0495601_0171417 | Ga0495601_0171417_794_1258 | 153 |
| 380 | 3300053078 | Ga0495612_0095624 | Ga0495612_0095624_552_1016 | 153 |
| 381 | 3300053084 | Ga0495595_0019267 | Ga0495595_0019267_930_1394 | 153 |
| 382 | 3300053085 | Ga0495619_0027527 | Ga0495619_0027527_3139_3603 | 153 |
| 383 | 3300005329 | Ga0070683_100126293 | Ga0070683_1001262932 | 154 |
| 384 | 3300005329 | Ga0070683_100278573 | Ga0070683_1002785732 | 154 |
| 385 | 3300005535 | Ga0070684_100019923 | Ga0070684_1000199234 | 154 |
| 386 | 3300009177 | Ga0105248_10170750 | Ga0105248_101707502 | 154 |
| 387 | 3300025941 | Ga0207711_10431304 | Ga0207711_104313042 | 154 |
| 388 | 3300025944 | Ga0207661_10035788 | Ga0207661_100357883 | 154 |
| 389 | 3300026035 | Ga0207703_11503873 | Ga0207703_115038732 | 154 |
| 390 | 3300031548 | Ga0307408_100645161 | Ga0307408_1006451612 | 154 |
| 391 | 3300031901 | Ga0307406_10596832 | Ga0307406_105968322 | 154 |
| 392 | 3300031995 | Ga0307409_102071671 | Ga0307409_1020716712 | 154 |
| 393 | 3300032002 | Ga0307416_100200290 | Ga0307416_1002002903 | 154 |
| 394 | 3300035691 | Ga0373931_0141728 | Ga0373931_0141728_473_940 | 154 |
| 395 | 3300048907 | Ga0496104_0535484 | Ga0496104_0535484_595_1062 | 154 |
| 396 | 3300048912 | Ga0496109_0071184 | Ga0496109_0071184_1179_1646 | 154 |
| 397 | 3300048915 | Ga0496112_0001391 | Ga0496112_0001391_14335_14802 | 154 |
| 398 | 3300048916 | Ga0496113_0387117 | Ga0496113_0387117_37_504 | 154 |
| 399 | 3300032002 | Ga0307416_100505687 | Ga0307416_1005056871 | 155 |
| 400 | 3300032126 | Ga0307415_100022134 | Ga0307415_1000221344 | 155 |
| 401 | 3300045976 | Ga0466967_0206982 | Ga0466967_0206982_1315_1782 | 155 |
| 402 | 3300013104 | Ga0157370_10001672 | Ga0157370_100016722 | 156 |
| 403 | 3300031852 | Ga0307410_10441015 | Ga0307410_104410152 | 156 |
| 404 | 3300031903 | Ga0307407_10656442 | Ga0307407_106564422 | 156 |
| 405 | 3300031548 | Ga0307408_100833522 | Ga0307408_1008335221 | 157 |
| 406 | 3300031731 | Ga0307405_10626122 | Ga0307405_106261221 | 157 |
| 407 | 3300031995 | Ga0307409_100994486 | Ga0307409_1009944861 | 157 |
| 408 | 3300032005 | Ga0307411_10141866 | Ga0307411_101418661 | 157 |
| 409 | 3300060353 | Ga0501082_0953368 | Ga0501082_0953368_216_692 | 157 |
| 410 | 3300046537 | Ga0495598_0100400 | Ga0495598_0100400_405_881 | 158 |
| 411 | 3300013307 | Ga0157372_10450378 | Ga0157372_104503782 | 159 |
| 412 | 3300005366 | Ga0070659_100006133 | Ga0070659_1000061336 | 161 |
| 413 | 3300027695 | Ga0209966_1000835 | Ga0209966_10008356 | 161 |
| 414 | 3300027717 | Ga0209998_10001531 | Ga0209998_100015312 | 161 |
| 415 | 3300005328 | Ga0070676_10225920 | Ga0070676_102259202 | 163 |
| 416 | 3300005347 | Ga0070668_100022240 | Ga0070668_1000222402 | 163 |
| 417 | 3300005459 | Ga0068867_100011835 | Ga0068867_1000118356 | 163 |
| 418 | 3300005564 | Ga0070664_100178699 | Ga0070664_1001786992 | 163 |
| 419 | 3300031731 | Ga0307405_10539989 | Ga0307405_105399892 | 163 |
| 420 | 3300031995 | Ga0307409_100034873 | Ga0307409_1000348735 | 163 |
| 421 | 3300048911 | Ga0496108_0202274 | Ga0496108_0202274_1149_1640 | 163 |
| 422 | 3300049572 | Ga0501036_0238135 | Ga0501036_0238135_744_1238 | 164 |
| 423 | 3300005535 | Ga0070684_100043008 | Ga0070684_1000430084 | 166 |
| 424 | 3300006358 | Ga0068871_100356404 | Ga0068871_1003564042 | 166 |
| 425 | 3300025915 | Ga0207693_10089758 | Ga0207693_100897583 | 166 |
| 426 | 3300001990 | JGI24737J22298_10030564 | JGI24737J22298_100305641 | 167 |
| 427 | 3300005327 | Ga0070658_10033793 | Ga0070658_100337932 | 167 |
| 428 | 3300005329 | Ga0070683_100044709 | Ga0070683_1000447091 | 167 |
| 429 | 3300005331 | Ga0070670_100155917 | Ga0070670_1001559171 | 167 |
| 430 | 3300005344 | Ga0070661_101022279 | Ga0070661_1010222792 | 167 |
| 431 | 3300005535 | Ga0070684_100001158 | Ga0070684_1000011587 | 167 |
| 432 | 3300025920 | Ga0207649_10298195 | Ga0207649_102981952 | 167 |
| 433 | 3300026088 | Ga0207641_11275541 | Ga0207641_112755412 | 167 |
| 434 | 3300026095 | Ga0207676_10597680 | Ga0207676_105976802 | 167 |
| 435 | 3300028380 | Ga0268265_11923232 | Ga0268265_119232321 | 167 |
| 436 | 3300032002 | Ga0307416_100816152 | Ga0307416_1008161522 | 167 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hyn-assembly1.cif.gz_A | structure of human polycomb repressive complex 2 (prc2) with oncogenic histone h3k27m peptide | 0.9045 | 20 | 135 |
| 5wg6-assembly1.cif.gz_A | human polycomb repressive complex 2 in complex with gsk126 inhibitor | 0.8891 | 19 | 133 |
| 5kjh-assembly1.cif.gz_B | crystal structure of an active polycomb repressive complex 2 in the stimulated state | 0.8851 | 22 | 135 |
| 5hyn-assembly6.cif.gz_F | structure of human polycomb repressive complex 2 (prc2) with oncogenic histone h3k27m peptide | 0.8802 | 20 | 135 |
| 5ls6-assembly4.cif.gz_J | structure of human polycomb repressive complex 2 (prc2) with inhibitor | 0.8772 | 20 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6Q4P2_267_472_2.170.270.10 | Mainly Beta;Beta Complex;Beta-clip-like;SET domain | 0.8841 | 22 | 133 | 2.170.270.10 |
| af_Q8IDE8_189_274_2.170.270.10 | Mainly Beta;Beta Complex;Beta-clip-like;SET domain | 0.8811 | 90 | 135 | 2.170.270.10 |
| af_Q9ZSM8_608_824_2.170.270.10 | Mainly Beta;Beta Complex;Beta-clip-like;SET domain | 0.8644 | 20 | 135 | 2.170.270.10 |
| af_A4IBZ5_743_846_2.170.270.10 | Mainly Beta;Beta Complex;Beta-clip-like;SET domain | 0.8384 | 24 | 130 | 2.170.270.10 |
| 6p0rB00 | Mainly Beta;Beta Complex;Beta-clip-like;SET domain | 0.8264 | 26 | 133 | 2.170.270.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A143BNZ7-F1-model_v4 | Lysine methyltransferase | 0.9685 | 21 | 167 |
GO:0005694
GO:0016279 GO:0032259 GO:0140938 |
| AF-C1AE45-F1-model_v4 | SET domain-containing protein-lysine N-methyltransferase | 0.958 | 27 | 167 |
GO:0005694
GO:0016279 GO:0032259 GO:0140938 |
| AF-A0A2W4JZJ4-F1-model_v4 | SET domain-containing protein-lysine N-methyltransferase | 0.9578 | 22 | 167 |
GO:0005694
GO:0016279 GO:0032259 GO:0140938 |
| AF-A0A2W4S3H7-F1-model_v4 | SET domain-containing protein-lysine N-methyltransferase | 0.9499 | 22 | 166 |
GO:0005694
GO:0016279 GO:0032259 GO:0140938 |
| AF-A0A7Y5V3U0-F1-model_v4 | SET domain-containing protein-lysine N-methyltransferase | 0.9497 | 17 | 167 |
GO:0005694
GO:0016279 GO:0032259 GO:0140938 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar