F443425
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 435 | 215 | 435 | 116 |
Family's Representative Sequence
| Representative Sequence | 3300050515|nmdc:mga0a205_764524_c1|nmdc:mga0a205_764524_c1_19_441 |
| Length | 140 |
| Sequence | MRRGHEPGADVAESAARPEAGERGEAMKKEQAASETKGITVKLLAVLDLGPEIEGMAGRQLRMRLVTIEPGGVFGPVHDHRERPGMVYVLQGTITDHRDGVATEYGPGPGWPEDRSTLHWLENRGTIPAVEVSVDIVRKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 47 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 82 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 84 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 136 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 140 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 141 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 142 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 143 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 144 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 145 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 146 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 147 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 148 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 149 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 151 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 152 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 155 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 156 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 158 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 160 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 161 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 163 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 164 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 166 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 167 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 168 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 169 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 170 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 171 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 172 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 173 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 174 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 196 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 197 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 198 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 201 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 202 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 203 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 204 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 205 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 206 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 209 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 210 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 211 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 212 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 213 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.7 |
| Metatranscriptomes | 2.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.69 |
| Nodule | 0 |
| Rhizoplane | 8.97 |
| Rhizosphere | 90.34 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10026296 | 3300002067 | Bacteria | 1750 |
| 2 | Ga0070658_10029041 | 3300005327 | Bacteria | 4441 |
| 3 | Ga0070658_10944667 | 3300005327 | Bacteria | 750 |
| 4 | Ga0070683_100007175 | 3300005329 | Bacteria | 9397 |
| 5 | Ga0070683_100095714 | 3300005329 | Bacteria | 2792 |
| 6 | Ga0070683_100405950 | 3300005329 | Bacteria | 1299 |
| 7 | Ga0070683_100474494 | 3300005329 | Bacteria | 1194 |
| 8 | Ga0070683_101045243 | 3300005329 | Unclassified | 784 |
| 9 | Ga0070690_100307622 | 3300005330 | Bacteria | 1138 |
| 10 | Ga0070670_100053702 | 3300005331 | Bacteria | 3460 |
| 11 | Ga0070670_101585253 | 3300005331 | Bacteria | 602 |
| 12 | Ga0070680_100146335 | 3300005336 | Bacteria | 1982 |
| 13 | Ga0070680_100447007 | 3300005336 | Bacteria | 1104 |
| 14 | Ga0070680_101640484 | 3300005336 | Bacteria | 557 |
| 15 | Ga0070682_100889164 | 3300005337 | Bacteria | 731 |
| 16 | Ga0070682_101536070 | 3300005337 | Bacteria | 574 |
| 17 | Ga0068868_101666753 | 3300005338 | Bacteria | 600 |
| 18 | Ga0070660_100019046 | 3300005339 | Bacteria | 5025 |
| 19 | Ga0070660_100058294 | 3300005339 | Bacteria | 2993 |
| 20 | Ga0070691_10013536 | 3300005341 | Bacteria | 3736 |
| 21 | Ga0070687_100049015 | 3300005343 | Bacteria | 2174 |
| 22 | Ga0070687_101491337 | 3300005343 | Bacteria | 508 |
| 23 | Ga0070661_100240574 | 3300005344 | Bacteria | 1394 |
| 24 | Ga0070661_101088415 | 3300005344 | Bacteria | 665 |
| 25 | Ga0070669_100150539 | 3300005353 | Bacteria | 1801 |
| 26 | Ga0070675_100336968 | 3300005354 | Unclassified | 1335 |
| 27 | Ga0070675_100873011 | 3300005354 | Bacteria | 824 |
| 28 | Ga0070671_100797447 | 3300005355 | Bacteria | 822 |
| 29 | Ga0070671_101203795 | 3300005355 | Bacteria | 667 |
| 30 | Ga0070671_101318150 | 3300005355 | Bacteria | 637 |
| 31 | Ga0070674_100754225 | 3300005356 | Bacteria | 837 |
| 32 | Ga0070673_102288716 | 3300005364 | Bacteria | 514 |
| 33 | Ga0070709_10069387 | 3300005434 | Bacteria | 2270 |
| 34 | Ga0070709_10747811 | 3300005434 | Bacteria | 764 |
| 35 | Ga0070714_100001701 | 3300005435 | Bacteria | 16003 |
| 36 | Ga0070714_100005662 | 3300005435 | Bacteria | 9561 |
| 37 | Ga0070714_100962937 | 3300005435 | Bacteria | 830 |
| 38 | Ga0070714_101150810 | 3300005435 | Bacteria | 757 |
| 39 | Ga0070713_100428966 | 3300005436 | Bacteria | 1238 |
| 40 | Ga0070713_100591021 | 3300005436 | Bacteria | 1054 |
| 41 | Ga0070713_100995306 | 3300005436 | Bacteria | 809 |
| 42 | Ga0070713_101766995 | 3300005436 | Bacteria | 600 |
| 43 | Ga0070701_10115560 | 3300005438 | Bacteria | 1505 |
| 44 | Ga0070711_100111507 | 3300005439 | Bacteria | 2008 |
| 45 | Ga0070711_101437426 | 3300005439 | Bacteria | 601 |
| 46 | Ga0070705_101323148 | 3300005440 | Bacteria | 598 |
| 47 | Ga0070700_100115146 | 3300005441 | Bacteria | 1793 |
| 48 | Ga0070694_100422395 | 3300005444 | Bacteria | 1048 |
| 49 | Ga0070678_100577708 | 3300005456 | Unclassified | 1001 |
| 50 | Ga0070678_101189112 | 3300005456 | Bacteria | 707 |
| 51 | Ga0070662_100389673 | 3300005457 | Bacteria | 1148 |
| 52 | Ga0070681_10014471 | 3300005458 | Bacteria | 7851 |
| 53 | Ga0070681_10088346 | 3300005458 | Bacteria | 3051 |
| 54 | Ga0070681_10331709 | 3300005458 | Bacteria | 1431 |
| 55 | Ga0070681_11513503 | 3300005458 | Bacteria | 596 |
| 56 | Ga0070707_102350276 | 3300005468 | Bacteria | 500 |
| 57 | Ga0070698_102128972 | 3300005471 | Bacteria | 514 |
| 58 | Ga0070679_100017458 | 3300005530 | Bacteria | 6946 |
| 59 | Ga0070679_100101399 | 3300005530 | Bacteria | 2865 |
| 60 | Ga0070679_100241818 | 3300005530 | Bacteria | 1762 |
| 61 | Ga0070679_100385462 | 3300005530 | Bacteria | 1348 |
| 62 | Ga0070679_101253125 | 3300005530 | Bacteria | 687 |
| 63 | Ga0070684_100000501 | 3300005535 | Bacteria | 26949 |
| 64 | Ga0070684_100004104 | 3300005535 | Bacteria | 11014 |
| 65 | Ga0070684_100046295 | 3300005535 | Bacteria | 3769 |
| 66 | Ga0070684_100120086 | 3300005535 | Bacteria | 2364 |
| 67 | Ga0070684_100456681 | 3300005535 | Bacteria | 1181 |
| 68 | Ga0070684_100694502 | 3300005535 | Bacteria | 948 |
| 69 | Ga0068853_100060417 | 3300005539 | Bacteria | 3275 |
| 70 | Ga0068853_100243209 | 3300005539 | Bacteria | 1650 |
| 71 | Ga0068853_100338314 | 3300005539 | Bacteria | 1398 |
| 72 | Ga0070686_100393026 | 3300005544 | Bacteria | 1053 |
| 73 | Ga0070686_100508096 | 3300005544 | Bacteria | 936 |
| 74 | Ga0070693_100098812 | 3300005547 | Bacteria | 1774 |
| 75 | Ga0068855_100321865 | 3300005563 | Bacteria | 1709 |
| 76 | Ga0070664_100004926 | 3300005564 | Bacteria | 10693 |
| 77 | Ga0070664_100010745 | 3300005564 | Bacteria | 7423 |
| 78 | Ga0070664_100171177 | 3300005564 | Bacteria | 1927 |
| 79 | Ga0070664_100210358 | 3300005564 | Bacteria | 1738 |
| 80 | Ga0070664_100368743 | 3300005564 | Bacteria | 1309 |
| 81 | Ga0068857_100074414 | 3300005577 | Bacteria | 3026 |
| 82 | Ga0068857_100134172 | 3300005577 | Bacteria | 2235 |
| 83 | Ga0068857_100232195 | 3300005577 | Bacteria | 1687 |
| 84 | Ga0068857_100337484 | 3300005577 | Bacteria | 1394 |
| 85 | Ga0068856_100013282 | 3300005614 | Bacteria | 7976 |
| 86 | Ga0068856_100297550 | 3300005614 | Bacteria | 1631 |
| 87 | Ga0068856_100451001 | 3300005614 | Bacteria | 1307 |
| 88 | Ga0068856_100940588 | 3300005614 | Bacteria | 883 |
| 89 | Ga0068856_101685060 | 3300005614 | Bacteria | 646 |
| 90 | Ga0068856_102300302 | 3300005614 | Bacteria | 547 |
| 91 | Ga0068852_101022843 | 3300005616 | Bacteria | 845 |
| 92 | Ga0068852_101027987 | 3300005616 | Bacteria | 843 |
| 93 | Ga0068852_102122634 | 3300005616 | Bacteria | 584 |
| 94 | Ga0068859_100064594 | 3300005617 | Bacteria | 3693 |
| 95 | Ga0068864_100011038 | 3300005618 | Bacteria | 7466 |
| 96 | Ga0068864_100023994 | 3300005618 | Bacteria | 5127 |
| 97 | Ga0068864_100093646 | 3300005618 | Bacteria | 2654 |
| 98 | Ga0068864_100353869 | 3300005618 | Bacteria | 1386 |
| 99 | Ga0068863_100097332 | 3300005841 | Bacteria | 2794 |
| 100 | Ga0068863_100964836 | 3300005841 | Bacteria | 854 |
| 101 | Ga0068863_101211858 | 3300005841 | Bacteria | 761 |
| 102 | Ga0068858_101060473 | 3300005842 | Bacteria | 795 |
| 103 | Ga0068860_100322174 | 3300005843 | Bacteria | 1517 |
| 104 | Ga0068860_102033603 | 3300005843 | Bacteria | 596 |
| 105 | Ga0075364_10257354 | 3300006051 | Bacteria | 1186 |
| 106 | Ga0070716_100412800 | 3300006173 | Bacteria | 974 |
| 107 | Ga0070716_100854685 | 3300006173 | Bacteria | 709 |
| 108 | Ga0070712_100038828 | 3300006175 | Bacteria | 3256 |
| 109 | Ga0070712_100212734 | 3300006175 | Unclassified | 1526 |
| 110 | Ga0097621_100430943 | 3300006237 | Bacteria | 1185 |
| 111 | Ga0097621_100539380 | 3300006237 | Bacteria | 1061 |
| 112 | Ga0097621_100587355 | 3300006237 | Bacteria | 1017 |
| 113 | Ga0068871_100117227 | 3300006358 | Bacteria | 2246 |
| 114 | Ga0075433_10010992 | 3300006852 | Bacteria | 7279 |
| 115 | Ga0075433_10342801 | 3300006852 | Bacteria | 1321 |
| 116 | Ga0075434_100002248 | 3300006871 | Bacteria | 16884 |
| 117 | Ga0075434_100291643 | 3300006871 | Bacteria | 1651 |
| 118 | Ga0075434_102093596 | 3300006871 | Bacteria | 570 |
| 119 | Ga0068865_100113037 | 3300006881 | Bacteria | 2007 |
| 120 | Ga0075436_100069431 | 3300006914 | Bacteria | 2434 |
| 121 | Ga0075436_100150287 | 3300006914 | Bacteria | 1639 |
| 122 | Ga0097620_100064593 | 3300006931 | Bacteria | 3693 |
| 123 | Ga0075435_101374841 | 3300007076 | Bacteria | 619 |
| 124 | Ga0105240_10038854 | 3300009093 | Bacteria | 6102 |
| 125 | Ga0111539_11313677 | 3300009094 | Bacteria | 839 |
| 126 | Ga0105245_10026542 | 3300009098 | Bacteria | 5099 |
| 127 | Ga0114129_11012379 | 3300009147 | Bacteria | 1045 |
| 128 | Ga0105241_10001817 | 3300009174 | Bacteria | 16199 |
| 129 | Ga0105241_12102047 | 3300009174 | Bacteria | 558 |
| 130 | Ga0105248_10010154 | 3300009177 | Bacteria | 10369 |
| 131 | Ga0105248_10428349 | 3300009177 | Bacteria | 1490 |
| 132 | Ga0105237_10094143 | 3300009545 | Bacteria | 2985 |
| 133 | Ga0105237_10437898 | 3300009545 | Bacteria | 1313 |
| 134 | Ga0105237_10869904 | 3300009545 | Bacteria | 908 |
| 135 | Ga0105249_10051727 | 3300009553 | Bacteria | 3749 |
| 136 | Ga0105239_10014730 | 3300010375 | Bacteria | 8672 |
| 137 | Ga0105239_10529868 | 3300010375 | Bacteria | 1341 |
| 138 | Ga0105239_10891913 | 3300010375 | Bacteria | 1020 |
| 139 | Ga0105239_10974676 | 3300010375 | Bacteria | 974 |
| 140 | Ga0105239_12098299 | 3300010375 | Unclassified | 657 |
| 141 | Ga0105239_12492855 | 3300010375 | Bacteria | 603 |
| 142 | Ga0105246_10311055 | 3300011119 | Bacteria | 1276 |
| 143 | Ga0105246_11095668 | 3300011119 | Bacteria | 727 |
| 144 | Ga0157313_1053562 | 3300012503 | Bacteria | 532 |
| 145 | Ga0157373_10084019 | 3300013100 | Bacteria | 2244 |
| 146 | Ga0157373_11495074 | 3300013100 | Bacteria | 515 |
| 147 | Ga0157371_10234355 | 3300013102 | Unclassified | 1320 |
| 148 | Ga0157369_10002329 | 3300013105 | Bacteria | 22857 |
| 149 | Ga0157369_10024513 | 3300013105 | Bacteria | 6709 |
| 150 | Ga0157369_10195714 | 3300013105 | Bacteria | 2123 |
| 151 | Ga0157374_11715889 | 3300013296 | Unclassified | 653 |
| 152 | Ga0163162_10024958 | 3300013306 | Bacteria | 5905 |
| 153 | Ga0163162_10522431 | 3300013306 | Bacteria | 1316 |
| 154 | Ga0163162_11730644 | 3300013306 | Bacteria | 714 |
| 155 | Ga0163162_12135723 | 3300013306 | Bacteria | 643 |
| 156 | Ga0157372_10043363 | 3300013307 | Bacteria | 4980 |
| 157 | Ga0157372_10078613 | 3300013307 | Bacteria | 3728 |
| 158 | Ga0157372_10190312 | 3300013307 | Bacteria | 2377 |
| 159 | Ga0157372_10272387 | 3300013307 | Bacteria | 1967 |
| 160 | Ga0157372_12355980 | 3300013307 | Bacteria | 611 |
| 161 | Ga0157372_12676574 | 3300013307 | Bacteria | 572 |
| 162 | Ga0157375_11041377 | 3300013308 | Bacteria | 956 |
| 163 | Ga0163163_10039766 | 3300014325 | Bacteria | 4591 |
| 164 | Ga0163163_10086956 | 3300014325 | Bacteria | 3135 |
| 165 | Ga0163163_10673504 | 3300014325 | Bacteria | 1098 |
| 166 | Ga0157380_11188739 | 3300014326 | Bacteria | 806 |
| 167 | Ga0182008_10154891 | 3300014497 | Bacteria | 1151 |
| 168 | Ga0157377_10433910 | 3300014745 | Bacteria | 903 |
| 169 | Ga0157377_10609322 | 3300014745 | Bacteria | 780 |
| 170 | Ga0157379_10389973 | 3300014968 | Bacteria | 1279 |
| 171 | Ga0157379_12069540 | 3300014968 | Bacteria | 564 |
| 172 | Ga0157376_11030532 | 3300014969 | Bacteria | 846 |
| 173 | Ga0182006_1313434 | 3300015261 | Bacteria | 515 |
| 174 | Ga0206356_10787821 | 3300020070 | Bacteria | 759 |
| 175 | Ga0206355_1687614 | 3300020076 | Bacteria | 577 |
| 176 | Ga0206352_10801691 | 3300020078 | Bacteria | 644 |
| 177 | Ga0206350_11019036 | 3300020080 | Bacteria | 758 |
| 178 | Ga0206354_11284312 | 3300020081 | Bacteria | 914 |
| 179 | Ga0224712_10013167 | 3300022467 | Bacteria | 2625 |
| 180 | Ga0224712_10194863 | 3300022467 | Bacteria | 919 |
| 181 | Ga0224712_10527140 | 3300022467 | Bacteria | 573 |
| 182 | Ga0207692_10081093 | 3300025898 | Bacteria | 1735 |
| 183 | Ga0207710_10242441 | 3300025900 | Bacteria | 900 |
| 184 | Ga0207688_10024822 | 3300025901 | Bacteria | 3288 |
| 185 | Ga0207699_10515002 | 3300025906 | Unclassified | 865 |
| 186 | Ga0207699_10694710 | 3300025906 | Bacteria | 744 |
| 187 | Ga0207705_10067857 | 3300025909 | Bacteria | 2581 |
| 188 | Ga0207705_10144629 | 3300025909 | Bacteria | 1778 |
| 189 | Ga0207654_10035467 | 3300025911 | Bacteria | 2780 |
| 190 | Ga0207707_10504842 | 3300025912 | Bacteria | 1031 |
| 191 | Ga0207707_10790751 | 3300025912 | Bacteria | 791 |
| 192 | Ga0207695_10086603 | 3300025913 | Bacteria | 3159 |
| 193 | Ga0207693_10049825 | 3300025915 | Bacteria | 3289 |
| 194 | Ga0207663_10733077 | 3300025916 | Bacteria | 784 |
| 195 | Ga0207663_11495486 | 3300025916 | Bacteria | 544 |
| 196 | Ga0207660_10159662 | 3300025917 | Bacteria | 1738 |
| 197 | Ga0207660_11672099 | 3300025917 | Bacteria | 512 |
| 198 | Ga0207657_10373763 | 3300025919 | Bacteria | 1123 |
| 199 | Ga0207649_10546725 | 3300025920 | Bacteria | 885 |
| 200 | Ga0207652_10015310 | 3300025921 | Bacteria | 6228 |
| 201 | Ga0207652_10091887 | 3300025921 | Bacteria | 2669 |
| 202 | Ga0207652_10504296 | 3300025921 | Bacteria | 1089 |
| 203 | Ga0207694_11529757 | 3300025924 | Bacteria | 563 |
| 204 | Ga0207650_10174750 | 3300025925 | Bacteria | 1709 |
| 205 | Ga0207659_10453545 | 3300025926 | Bacteria | 1080 |
| 206 | Ga0207687_10290902 | 3300025927 | Bacteria | 1313 |
| 207 | Ga0207687_10725580 | 3300025927 | Bacteria | 845 |
| 208 | Ga0207700_10209401 | 3300025928 | Bacteria | 1647 |
| 209 | Ga0207700_10740049 | 3300025928 | Bacteria | 878 |
| 210 | Ga0207700_11193029 | 3300025928 | Bacteria | 680 |
| 211 | Ga0207664_10043974 | 3300025929 | Bacteria | 3496 |
| 212 | Ga0207664_10245310 | 3300025929 | Bacteria | 1561 |
| 213 | Ga0207644_10712233 | 3300025931 | Bacteria | 837 |
| 214 | Ga0207644_11753408 | 3300025931 | Bacteria | 520 |
| 215 | Ga0207706_10135512 | 3300025933 | Bacteria | 2166 |
| 216 | Ga0207670_10348553 | 3300025936 | Bacteria | 1172 |
| 217 | Ga0207669_10674146 | 3300025937 | Bacteria | 848 |
| 218 | Ga0207704_10177086 | 3300025938 | Bacteria | 1537 |
| 219 | Ga0207704_10545833 | 3300025938 | Bacteria | 941 |
| 220 | Ga0207665_10212776 | 3300025939 | Bacteria | 1413 |
| 221 | Ga0207711_10606924 | 3300025941 | Bacteria | 1021 |
| 222 | Ga0207689_10001317 | 3300025942 | Bacteria | 23923 |
| 223 | Ga0207661_10008544 | 3300025944 | Bacteria | 7319 |
| 224 | Ga0207661_10648199 | 3300025944 | Bacteria | 970 |
| 225 | Ga0207679_10006108 | 3300025945 | Bacteria | 7601 |
| 226 | Ga0207679_10059888 | 3300025945 | Bacteria | 2826 |
| 227 | Ga0207679_10075285 | 3300025945 | Bacteria | 2561 |
| 228 | Ga0207679_10634639 | 3300025945 | Bacteria | 965 |
| 229 | Ga0207679_10646645 | 3300025945 | Bacteria | 956 |
| 230 | Ga0207667_10697180 | 3300025949 | Bacteria | 1018 |
| 231 | Ga0207651_10209660 | 3300025960 | Bacteria | 1567 |
| 232 | Ga0207712_10026197 | 3300025961 | Unclassified | 3882 |
| 233 | Ga0207640_11267594 | 3300025981 | Bacteria | 657 |
| 234 | Ga0207703_10347167 | 3300026035 | Bacteria | 1365 |
| 235 | Ga0207639_10162299 | 3300026041 | Bacteria | 1884 |
| 236 | Ga0207639_10764119 | 3300026041 | Bacteria | 899 |
| 237 | Ga0207702_10004745 | 3300026078 | Bacteria | 12001 |
| 238 | Ga0207702_10022912 | 3300026078 | Bacteria | 5181 |
| 239 | Ga0207702_10810922 | 3300026078 | Bacteria | 925 |
| 240 | Ga0207641_10053422 | 3300026088 | Bacteria | 3425 |
| 241 | Ga0207641_11657649 | 3300026088 | Bacteria | 641 |
| 242 | Ga0207676_10047940 | 3300026095 | Bacteria | 3314 |
| 243 | Ga0207676_10074433 | 3300026095 | Bacteria | 2736 |
| 244 | Ga0207676_11262309 | 3300026095 | Bacteria | 733 |
| 245 | Ga0207674_10000041 | 3300026116 | Bacteria | 129439 |
| 246 | Ga0207674_10043027 | 3300026116 | Bacteria | 4659 |
| 247 | Ga0207674_10128964 | 3300026116 | Bacteria | 2493 |
| 248 | Ga0207674_10185105 | 3300026116 | Bacteria | 2033 |
| 249 | Ga0207683_10545603 | 3300026121 | Bacteria | 1072 |
| 250 | Ga0207683_11188085 | 3300026121 | Bacteria | 707 |
| 251 | Ga0209981_1018545 | 3300027378 | Bacteria | 986 |
| 252 | Ga0209996_1056838 | 3300027395 | Bacteria | 598 |
| 253 | Ga0210000_1066467 | 3300027462 | Bacteria | 586 |
| 254 | Ga0209983_1058822 | 3300027665 | Bacteria | 847 |
| 255 | Ga0209971_1038904 | 3300027682 | Bacteria | 1145 |
| 256 | Ga0209974_10001267 | 3300027876 | Bacteria | 9074 |
| 257 | Ga0209974_10059042 | 3300027876 | Bacteria | 1297 |
| 258 | Ga0207428_10618506 | 3300027907 | Bacteria | 779 |
| 259 | Ga0268265_10183104 | 3300028380 | Bacteria | 1802 |
| 260 | Ga0268265_10210638 | 3300028380 | Bacteria | 1693 |
| 261 | Ga0268264_12368793 | 3300028381 | Bacteria | 537 |
| 262 | Ga0265334_10108370 | 3300028573 | Bacteria | 1000 |
| 263 | Ga0265318_10008767 | 3300028577 | Bacteria | 4480 |
| 264 | Ga0316575_10523892 | 3300031665 | Bacteria | 515 |
| 265 | Ga0316579_10037460 | 3300031691 | Bacteria | 2240 |
| 266 | Ga0316579_10039379 | 3300031691 | Bacteria | 2189 |
| 267 | Ga0316579_10062779 | 3300031691 | Bacteria | 1749 |
| 268 | Ga0316576_10016450 | 3300031727 | Bacteria | 4997 |
| 269 | Ga0316576_10074951 | 3300031727 | Bacteria | 2502 |
| 270 | Ga0316576_10262165 | 3300031727 | Bacteria | 1296 |
| 271 | Ga0316576_10289642 | 3300031727 | Bacteria | 1225 |
| 272 | Ga0316578_10076326 | 3300031728 | Bacteria | 1989 |
| 273 | Ga0316578_10342836 | 3300031728 | Bacteria | 890 |
| 274 | Ga0316577_10042720 | 3300031733 | Bacteria | 2536 |
| 275 | Ga0316577_10542664 | 3300031733 | Bacteria | 661 |
| 276 | Ga0307409_101225310 | 3300031995 | Bacteria | 774 |
| 277 | Ga0307416_100775648 | 3300032002 | Bacteria | 1053 |
| 278 | Ga0316583_10036713 | 3300032133 | Bacteria | 1737 |
| 279 | Ga0316583_10078813 | 3300032133 | Bacteria | 1151 |
| 280 | Ga0316580_10010574 | 3300032139 | Bacteria | 2792 |
| 281 | Ga0316580_10163471 | 3300032139 | Bacteria | 684 |
| 282 | Ga0316588_1088827 | 3300033528 | Bacteria | 769 |
| 283 | Ga0316596_1010089 | 3300033541 | Bacteria | 2279 |
| 284 | Ga0373926_0043017 | 3300035083 | Bacteria | 1616 |
| 285 | Ga0373951_0059297 | 3300035091 | Bacteria | 956 |
| 286 | Ga0373945_0001155 | 3300035116 | Bacteria | 8002 |
| 287 | Ga0373960_0058472 | 3300035121 | Bacteria | 1163 |
| 288 | Ga0373943_0012587 | 3300035170 | Bacteria | 3813 |
| 289 | Ga0373943_0224780 | 3300035170 | Bacteria | 1047 |
| 290 | Ga0373946_0111400 | 3300035171 | Bacteria | 1239 |
| 291 | Ga0316574_0045712 | 3300035398 | Bacteria | 2712 |
| 292 | Ga0316574_0199851 | 3300035398 | Bacteria | 1284 |
| 293 | Ga0316574_0340855 | 3300035398 | Bacteria | 949 |
| 294 | Ga0316574_0519586 | 3300035398 | Unclassified | 741 |
| 295 | Ga0373935_0012499 | 3300035692 | Bacteria | 5105 |
| 296 | Ga0373927_0000002 | 3300035695 | Bacteria | 966219 |
| 297 | Ga0373927_0028218 | 3300035695 | Bacteria | 3661 |
| 298 | Ga0373947_0019729 | 3300035725 | Bacteria | 3888 |
| 299 | Ga0373947_0096668 | 3300035725 | Bacteria | 1850 |
| 300 | Ga0373937_1271499 | 3300036401 | Bacteria | 684 |
| 301 | Ga0316582_0009111 | 3300036647 | Bacteria | 5372 |
| 302 | Ga0316582_0024540 | 3300036647 | Bacteria | 3609 |
| 303 | Ga0316582_0110056 | 3300036647 | Bacteria | 1833 |
| 304 | Ga0316582_0651294 | 3300036647 | Bacteria | 724 |
| 305 | Ga0316584_0122066 | 3300036712 | Bacteria | 1946 |
| 306 | Ga0316584_0849279 | 3300036712 | Bacteria | 617 |
| 307 | Ga0373925_0034085 | 3300037068 | Bacteria | 3752 |
| 308 | Ga0373925_0393958 | 3300037068 | Bacteria | 1129 |
| 309 | Ga0316581_0087556 | 3300037588 | Bacteria | 959 |
| 310 | Ga0395901_0348185 | 3300038443 | Bacteria | 1529 |
| 311 | Ga0451807_0174739 | 3300041486 | Bacteria | 530 |
| 312 | Ga0451807_2560339 | 3300041486 | Bacteria | 534 |
| 313 | Ga0450914_035404 | 3300042118 | Bacteria | 617 |
| 314 | Ga0451577_0000942 | 3300042876 | Bacteria | 42655 |
| 315 | Ga0451577_0001172 | 3300042876 | Bacteria | 36813 |
| 316 | Ga0451577_0018095 | 3300042876 | Bacteria | 6495 |
| 317 | Ga0451577_0028505 | 3300042876 | Bacteria | 5049 |
| 318 | Ga0451577_0268665 | 3300042876 | Bacteria | 1544 |
| 319 | Ga0451577_0295409 | 3300042876 | Bacteria | 1468 |
| 320 | Ga0451577_0411017 | 3300042876 | Bacteria | 1228 |
| 321 | Ga0451577_0775840 | 3300042876 | Bacteria | 866 |
| 322 | Ga0451577_1105754 | 3300042876 | Bacteria | 709 |
| 323 | Ga0453683_0001173 | 3300044673 | Bacteria | 23651 |
| 324 | Ga0453683_0059250 | 3300044673 | Bacteria | 2394 |
| 325 | Ga0453683_0247200 | 3300044673 | Bacteria | 1137 |
| 326 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 327 | Ga0453684_0000023 | 3300044712 | Bacteria | 857153 |
| 328 | Ga0453684_0002651 | 3300044712 | Bacteria | 42717 |
| 329 | Ga0453684_0011758 | 3300044712 | Bacteria | 14595 |
| 330 | Ga0453684_0011772 | 3300044712 | Bacteria | 14581 |
| 331 | Ga0453684_0041372 | 3300044712 | Bacteria | 6234 |
| 332 | Ga0453684_0051241 | 3300044712 | Bacteria | 5415 |
| 333 | Ga0453684_0051647 | 3300044712 | Bacteria | 5386 |
| 334 | Ga0453684_0066736 | 3300044712 | Bacteria | 4580 |
| 335 | Ga0453684_0094215 | 3300044712 | Bacteria | 3684 |
| 336 | Ga0453684_0094872 | 3300044712 | Bacteria | 3668 |
| 337 | Ga0453684_0102569 | 3300044712 | Bacteria | 3498 |
| 338 | Ga0453684_0113831 | 3300044712 | Bacteria | 3281 |
| 339 | Ga0453684_0192412 | 3300044712 | Bacteria | 2385 |
| 340 | Ga0453684_0251174 | 3300044712 | Bacteria | 2031 |
| 341 | Ga0453684_0278586 | 3300044712 | Bacteria | 1908 |
| 342 | Ga0453684_0754418 | 3300044712 | Bacteria | 1053 |
| 343 | Ga0453684_0777762 | 3300044712 | Bacteria | 1034 |
| 344 | Ga0453684_0823930 | 3300044712 | Bacteria | 999 |
| 345 | Ga0453684_0903317 | 3300044712 | Unclassified | 946 |
| 346 | Ga0453684_0989028 | 3300044712 | Bacteria | 895 |
| 347 | Ga0453684_1051160 | 3300044712 | Bacteria | 863 |
| 348 | Ga0453684_1127456 | 3300044712 | Bacteria | 827 |
| 349 | Ga0453684_1218015 | 3300044712 | Bacteria | 789 |
| 350 | Ga0453684_1332158 | 3300044712 | Bacteria | 747 |
| 351 | Ga0453684_1360648 | 3300044712 | Bacteria | 738 |
| 352 | Ga0453684_1435477 | 3300044712 | Bacteria | 714 |
| 353 | Ga0453684_1482377 | 3300044712 | Bacteria | 701 |
| 354 | Ga0451576_0015582 | 3300045051 | Bacteria | 8415 |
| 355 | Ga0451576_0054861 | 3300045051 | Bacteria | 4171 |
| 356 | Ga0451576_0176509 | 3300045051 | Bacteria | 2230 |
| 357 | Ga0466967_1734092 | 3300045976 | Bacteria | 622 |
| 358 | Ga0495629_0005769 | 3300046459 | Bacteria | 9240 |
| 359 | Ga0495629_0225889 | 3300046459 | Bacteria | 1291 |
| 360 | Ga0495641_0086747 | 3300046461 | Bacteria | 1400 |
| 361 | Ga0495641_0111441 | 3300046461 | Bacteria | 1221 |
| 362 | Ga0495653_0190975 | 3300046463 | Bacteria | 1397 |
| 363 | Ga0495582_0021833 | 3300046473 | Bacteria | 3502 |
| 364 | Ga0495639_0003905 | 3300046475 | Bacteria | 6402 |
| 365 | Ga0495662_0137913 | 3300046476 | Bacteria | 1200 |
| 366 | Ga0495630_0087836 | 3300046517 | Bacteria | 2348 |
| 367 | Ga0495665_0023025 | 3300046531 | Bacteria | 3346 |
| 368 | Ga0495640_0004728 | 3300046533 | Bacteria | 10852 |
| 369 | Ga0495640_0737829 | 3300046533 | Bacteria | 589 |
| 370 | Ga0495634_0020306 | 3300046642 | Bacteria | 4713 |
| 371 | Ga0495635_0008942 | 3300046663 | Bacteria | 6992 |
| 372 | Ga0495635_0115781 | 3300046663 | Bacteria | 1830 |
| 373 | Ga0495647_0012216 | 3300046681 | Bacteria | 2955 |
| 374 | Ga0495647_0116447 | 3300046681 | Bacteria | 1120 |
| 375 | Ga0495658_0027904 | 3300046683 | Bacteria | 3043 |
| 376 | Ga0495613_0004416 | 3300046689 | Bacteria | 10535 |
| 377 | Ga0495613_0007249 | 3300046689 | Bacteria | 8255 |
| 378 | Ga0495624_0029925 | 3300046690 | Bacteria | 3549 |
| 379 | Ga0495581_0011990 | 3300047315 | Bacteria | 5014 |
| 380 | Ga0495581_0526721 | 3300047315 | Bacteria | 686 |
| 381 | Ga0495674_0501090 | 3300047319 | Bacteria | 971 |
| 382 | Ga0495676_0041012 | 3300047321 | Bacteria | 3814 |
| 383 | Ga0495680_0003977 | 3300047322 | Bacteria | 14281 |
| 384 | Ga0495680_0358879 | 3300047322 | Bacteria | 1013 |
| 385 | Ga0496100_0095946 | 3300048903 | Bacteria | 2034 |
| 386 | Ga0496100_1115585 | 3300048903 | Bacteria | 622 |
| 387 | Ga0496101_0133359 | 3300048904 | Bacteria | 1887 |
| 388 | Ga0496102_0085927 | 3300048905 | Bacteria | 2905 |
| 389 | Ga0496102_0511886 | 3300048905 | Bacteria | 1123 |
| 390 | Ga0496102_1418939 | 3300048905 | Bacteria | 613 |
| 391 | Ga0496104_0020573 | 3300048907 | Bacteria | 6050 |
| 392 | Ga0496104_0046750 | 3300048907 | Bacteria | 4077 |
| 393 | Ga0496104_0636394 | 3300048907 | Bacteria | 976 |
| 394 | Ga0496105_0070661 | 3300048908 | Bacteria | 2886 |
| 395 | Ga0496105_0286955 | 3300048908 | Unclassified | 1326 |
| 396 | Ga0496105_0397411 | 3300048908 | Bacteria | 1095 |
| 397 | Ga0496105_0769063 | 3300048908 | Bacteria | 734 |
| 398 | Ga0496108_0110779 | 3300048911 | Bacteria | 2347 |
| 399 | Ga0496108_0296254 | 3300048911 | Bacteria | 1409 |
| 400 | Ga0496108_1522182 | 3300048911 | Bacteria | 556 |
| 401 | Ga0496109_0194653 | 3300048912 | Bacteria | 1905 |
| 402 | Ga0496109_0576057 | 3300048912 | Bacteria | 1061 |
| 403 | Ga0496109_1011663 | 3300048912 | Bacteria | 769 |
| 404 | Ga0496110_0065332 | 3300048913 | Bacteria | 3216 |
| 405 | Ga0496110_0151540 | 3300048913 | Bacteria | 2100 |
| 406 | Ga0496110_0469876 | 3300048913 | Bacteria | 1146 |
| 407 | Ga0496110_0481392 | 3300048913 | Bacteria | 1131 |
| 408 | Ga0496111_0011688 | 3300048914 | Bacteria | 5926 |
| 409 | Ga0496111_0123439 | 3300048914 | Bacteria | 1914 |
| 410 | Ga0496111_0307161 | 3300048914 | Bacteria | 1176 |
| 411 | Ga0496111_0406435 | 3300048914 | Bacteria | 1006 |
| 412 | Ga0496111_0716013 | 3300048914 | Bacteria | 727 |
| 413 | Ga0496112_0018917 | 3300048915 | Bacteria | 6490 |
| 414 | Ga0496112_0211216 | 3300048915 | Bacteria | 1898 |
| 415 | Ga0496113_0026758 | 3300048916 | Bacteria | 4127 |
| 416 | Ga0496113_0257972 | 3300048916 | Bacteria | 1392 |
| 417 | Ga0496113_0357401 | 3300048916 | Bacteria | 1172 |
| 418 | Ga0496113_0499006 | 3300048916 | Bacteria | 977 |
| 419 | Ga0496114_0546469 | 3300048917 | Bacteria | 1024 |
| 420 | Ga0496114_0709724 | 3300048917 | Bacteria | 881 |
| 421 | Ga0496115_0215346 | 3300048918 | Bacteria | 1586 |
| 422 | Ga0501034_0475536 | 3300049571 | Bacteria | 1165 |
| 423 | Ga0501072_1087244 | 3300049588 | Unclassified | 622 |
| 424 | nmdc:mga0yw44_88592_c1 | 3300050492 | Bacteria | 1951 |
| 425 | nmdc:mga05p37_110115_c1 | 3300050507 | Bacteria | 3388 |
| 426 | nmdc:mga05p37_653029_c1 | 3300050507 | Bacteria | 1177 |
| 427 | nmdc:mga08y16_172973_c1 | 3300050511 | Bacteria | 2243 |
| 428 | nmdc:mga0n895_286869_c1 | 3300050512 | Bacteria | 1669 |
| 429 | nmdc:mga0rr50_560554_c1 | 3300050513 | Bacteria | 973 |
| 430 | nmdc:mga0a205_407031_c1 | 3300050515 | Bacteria | 1224 |
| 431 | nmdc:mga0a205_67112_c1 | 3300050515 | Bacteria | 3465 |
| 432 | nmdc:mga0a205_764524_c1 | 3300050515 | Bacteria | 814 |
| 433 | Ga0495619_0012084 | 3300053085 | Bacteria | 5439 |
| 434 | Ga0495619_0284446 | 3300053085 | Bacteria | 1146 |
| 435 | Ga0500559_0099947 | 3300053136 | Bacteria | 1336 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031995 | Ga0307409_101225310 | Ga0307409_1012253101 | 105 |
| 2 | 3300050513 | nmdc:mga0rr50_560554_c1 | nmdc:mga0rr50_560554_c1_447_812 | 106 |
| 3 | 3300035398 | Ga0316574_0199851 | Ga0316574_0199851_128_490 | 109 |
| 4 | 3300031665 | Ga0316575_10523892 | Ga0316575_105238921 | 111 |
| 5 | 3300005329 | Ga0070683_101045243 | Ga0070683_1010452431 | 112 |
| 6 | 3300005354 | Ga0070675_100336968 | Ga0070675_1003369683 | 112 |
| 7 | 3300005355 | Ga0070671_101203795 | Ga0070671_1012037952 | 112 |
| 8 | 3300005544 | Ga0070686_100508096 | Ga0070686_1005080963 | 112 |
| 9 | 3300005614 | Ga0068856_100297550 | Ga0068856_1002975504 | 112 |
| 10 | 3300005614 | Ga0068856_100940588 | Ga0068856_1009405881 | 112 |
| 11 | 3300006051 | Ga0075364_10257354 | Ga0075364_102573541 | 112 |
| 12 | 3300009093 | Ga0105240_10038854 | Ga0105240_100388546 | 112 |
| 13 | 3300009147 | Ga0114129_11012379 | Ga0114129_110123792 | 112 |
| 14 | 3300010375 | Ga0105239_10529868 | Ga0105239_105298683 | 112 |
| 15 | 3300010375 | Ga0105239_10891913 | Ga0105239_108919132 | 112 |
| 16 | 3300010375 | Ga0105239_12098299 | Ga0105239_120982992 | 112 |
| 17 | 3300013306 | Ga0163162_12135723 | Ga0163162_121357232 | 112 |
| 18 | 3300013307 | Ga0157372_10190312 | Ga0157372_101903122 | 112 |
| 19 | 3300025913 | Ga0207695_10086603 | Ga0207695_100866031 | 112 |
| 20 | 3300025919 | Ga0207657_10373763 | Ga0207657_103737632 | 112 |
| 21 | 3300027378 | Ga0209981_1018545 | Ga0209981_10185452 | 112 |
| 22 | 3300027462 | Ga0210000_1066467 | Ga0210000_10664671 | 112 |
| 23 | 3300027665 | Ga0209983_1058822 | Ga0209983_10588221 | 112 |
| 24 | 3300027682 | Ga0209971_1038904 | Ga0209971_10389042 | 112 |
| 25 | 3300027876 | Ga0209974_10001267 | Ga0209974_100012676 | 112 |
| 26 | 3300042118 | Ga0450914_035404 | Ga0450914_035404_78_461 | 112 |
| 27 | 3300044673 | Ga0453683_0247200 | Ga0453683_0247200_685_1026 | 112 |
| 28 | 3300044712 | Ga0453684_0251174 | Ga0453684_0251174_1236_1577 | 112 |
| 29 | 3300045976 | Ga0466967_1734092 | Ga0466967_1734092_64_423 | 112 |
| 30 | 3300046689 | Ga0495613_0004416 | Ga0495613_0004416_8146_8487 | 112 |
| 31 | 3300048914 | Ga0496111_0307161 | Ga0496111_0307161_100_441 | 112 |
| 32 | 3300048916 | Ga0496113_0499006 | Ga0496113_0499006_593_934 | 112 |
| 33 | 3300049571 | Ga0501034_0475536 | Ga0501034_0475536_643_984 | 112 |
| 34 | 3300049588 | Ga0501072_1087244 | Ga0501072_1087244_198_539 | 112 |
| 35 | 3300050507 | nmdc:mga05p37_653029_c1 | nmdc:mga05p37_653029_c1_164_505 | 112 |
| 36 | 3300005327 | Ga0070658_10029041 | Ga0070658_100290412 | 113 |
| 37 | 3300005327 | Ga0070658_10944667 | Ga0070658_109446671 | 113 |
| 38 | 3300005329 | Ga0070683_100007175 | Ga0070683_1000071752 | 113 |
| 39 | 3300005329 | Ga0070683_100095714 | Ga0070683_1000957143 | 113 |
| 40 | 3300005329 | Ga0070683_100405950 | Ga0070683_1004059502 | 113 |
| 41 | 3300005329 | Ga0070683_100474494 | Ga0070683_1004744942 | 113 |
| 42 | 3300005330 | Ga0070690_100307622 | Ga0070690_1003076222 | 113 |
| 43 | 3300005331 | Ga0070670_100053702 | Ga0070670_1000537024 | 113 |
| 44 | 3300005331 | Ga0070670_101585253 | Ga0070670_1015852531 | 113 |
| 45 | 3300005336 | Ga0070680_100146335 | Ga0070680_1001463351 | 113 |
| 46 | 3300005336 | Ga0070680_100447007 | Ga0070680_1004470072 | 113 |
| 47 | 3300005336 | Ga0070680_101640484 | Ga0070680_1016404842 | 113 |
| 48 | 3300005337 | Ga0070682_100889164 | Ga0070682_1008891641 | 113 |
| 49 | 3300005337 | Ga0070682_101536070 | Ga0070682_1015360701 | 113 |
| 50 | 3300005338 | Ga0068868_101666753 | Ga0068868_1016667531 | 113 |
| 51 | 3300005339 | Ga0070660_100019046 | Ga0070660_1000190464 | 113 |
| 52 | 3300005339 | Ga0070660_100058294 | Ga0070660_1000582942 | 113 |
| 53 | 3300005341 | Ga0070691_10013536 | Ga0070691_100135363 | 113 |
| 54 | 3300005343 | Ga0070687_100049015 | Ga0070687_1000490153 | 113 |
| 55 | 3300005343 | Ga0070687_101491337 | Ga0070687_1014913371 | 113 |
| 56 | 3300005344 | Ga0070661_100240574 | Ga0070661_1002405742 | 113 |
| 57 | 3300005344 | Ga0070661_101088415 | Ga0070661_1010884151 | 113 |
| 58 | 3300005353 | Ga0070669_100150539 | Ga0070669_1001505393 | 113 |
| 59 | 3300005354 | Ga0070675_100873011 | Ga0070675_1008730112 | 113 |
| 60 | 3300005355 | Ga0070671_100797447 | Ga0070671_1007974471 | 113 |
| 61 | 3300005355 | Ga0070671_101318150 | Ga0070671_1013181501 | 113 |
| 62 | 3300005356 | Ga0070674_100754225 | Ga0070674_1007542252 | 113 |
| 63 | 3300005364 | Ga0070673_102288716 | Ga0070673_1022887161 | 113 |
| 64 | 3300005434 | Ga0070709_10069387 | Ga0070709_100693872 | 113 |
| 65 | 3300005434 | Ga0070709_10747811 | Ga0070709_107478112 | 113 |
| 66 | 3300005435 | Ga0070714_100001701 | Ga0070714_1000017012 | 113 |
| 67 | 3300005435 | Ga0070714_100005662 | Ga0070714_1000056622 | 113 |
| 68 | 3300005435 | Ga0070714_100962937 | Ga0070714_1009629371 | 113 |
| 69 | 3300005435 | Ga0070714_101150810 | Ga0070714_1011508102 | 113 |
| 70 | 3300005436 | Ga0070713_100428966 | Ga0070713_1004289662 | 113 |
| 71 | 3300005436 | Ga0070713_100591021 | Ga0070713_1005910212 | 113 |
| 72 | 3300005436 | Ga0070713_100995306 | Ga0070713_1009953061 | 113 |
| 73 | 3300005436 | Ga0070713_101766995 | Ga0070713_1017669952 | 113 |
| 74 | 3300005438 | Ga0070701_10115560 | Ga0070701_101155603 | 113 |
| 75 | 3300005439 | Ga0070711_100111507 | Ga0070711_1001115072 | 113 |
| 76 | 3300005439 | Ga0070711_101437426 | Ga0070711_1014374261 | 113 |
| 77 | 3300005440 | Ga0070705_101323148 | Ga0070705_1013231482 | 113 |
| 78 | 3300005441 | Ga0070700_100115146 | Ga0070700_1001151462 | 113 |
| 79 | 3300005444 | Ga0070694_100422395 | Ga0070694_1004223952 | 113 |
| 80 | 3300005456 | Ga0070678_100577708 | Ga0070678_1005777082 | 113 |
| 81 | 3300005456 | Ga0070678_101189112 | Ga0070678_1011891121 | 113 |
| 82 | 3300005457 | Ga0070662_100389673 | Ga0070662_1003896732 | 113 |
| 83 | 3300005458 | Ga0070681_10014471 | Ga0070681_100144715 | 113 |
| 84 | 3300005458 | Ga0070681_10088346 | Ga0070681_100883463 | 113 |
| 85 | 3300005458 | Ga0070681_10331709 | Ga0070681_103317091 | 113 |
| 86 | 3300005458 | Ga0070681_11513503 | Ga0070681_115135031 | 113 |
| 87 | 3300005468 | Ga0070707_102350276 | Ga0070707_1023502761 | 113 |
| 88 | 3300005471 | Ga0070698_102128972 | Ga0070698_1021289721 | 113 |
| 89 | 3300005530 | Ga0070679_100017458 | Ga0070679_1000174587 | 113 |
| 90 | 3300005530 | Ga0070679_100101399 | Ga0070679_1001013994 | 113 |
| 91 | 3300005530 | Ga0070679_100241818 | Ga0070679_1002418182 | 113 |
| 92 | 3300005530 | Ga0070679_100385462 | Ga0070679_1003854622 | 113 |
| 93 | 3300005530 | Ga0070679_101253125 | Ga0070679_1012531252 | 113 |
| 94 | 3300005535 | Ga0070684_100000501 | Ga0070684_1000005012 | 113 |
| 95 | 3300005535 | Ga0070684_100004104 | Ga0070684_1000041044 | 113 |
| 96 | 3300005535 | Ga0070684_100046295 | Ga0070684_1000462954 | 113 |
| 97 | 3300005535 | Ga0070684_100120086 | Ga0070684_1001200864 | 113 |
| 98 | 3300005535 | Ga0070684_100456681 | Ga0070684_1004566812 | 113 |
| 99 | 3300005535 | Ga0070684_100694502 | Ga0070684_1006945022 | 113 |
| 100 | 3300005539 | Ga0068853_100060417 | Ga0068853_1000604174 | 113 |
| 101 | 3300005539 | Ga0068853_100243209 | Ga0068853_1002432093 | 113 |
| 102 | 3300005539 | Ga0068853_100338314 | Ga0068853_1003383141 | 113 |
| 103 | 3300005544 | Ga0070686_100393026 | Ga0070686_1003930262 | 113 |
| 104 | 3300005547 | Ga0070693_100098812 | Ga0070693_1000988124 | 113 |
| 105 | 3300005563 | Ga0068855_100321865 | Ga0068855_1003218653 | 113 |
| 106 | 3300005564 | Ga0070664_100004926 | Ga0070664_1000049262 | 113 |
| 107 | 3300005564 | Ga0070664_100010745 | Ga0070664_1000107452 | 113 |
| 108 | 3300005564 | Ga0070664_100171177 | Ga0070664_1001711772 | 113 |
| 109 | 3300005564 | Ga0070664_100210358 | Ga0070664_1002103582 | 113 |
| 110 | 3300005564 | Ga0070664_100368743 | Ga0070664_1003687432 | 113 |
| 111 | 3300005577 | Ga0068857_100074414 | Ga0068857_1000744142 | 113 |
| 112 | 3300005577 | Ga0068857_100134172 | Ga0068857_1001341723 | 113 |
| 113 | 3300005577 | Ga0068857_100232195 | Ga0068857_1002321952 | 113 |
| 114 | 3300005577 | Ga0068857_100337484 | Ga0068857_1003374842 | 113 |
| 115 | 3300005614 | Ga0068856_100013282 | Ga0068856_1000132827 | 113 |
| 116 | 3300005614 | Ga0068856_100451001 | Ga0068856_1004510012 | 113 |
| 117 | 3300005614 | Ga0068856_101685060 | Ga0068856_1016850602 | 113 |
| 118 | 3300005614 | Ga0068856_102300302 | Ga0068856_1023003021 | 113 |
| 119 | 3300005616 | Ga0068852_101022843 | Ga0068852_1010228432 | 113 |
| 120 | 3300005616 | Ga0068852_101027987 | Ga0068852_1010279872 | 113 |
| 121 | 3300005616 | Ga0068852_102122634 | Ga0068852_1021226341 | 113 |
| 122 | 3300005617 | Ga0068859_100064594 | Ga0068859_1000645941 | 113 |
| 123 | 3300005618 | Ga0068864_100011038 | Ga0068864_1000110386 | 113 |
| 124 | 3300005618 | Ga0068864_100023994 | Ga0068864_1000239947 | 113 |
| 125 | 3300005618 | Ga0068864_100093646 | Ga0068864_1000936462 | 113 |
| 126 | 3300005618 | Ga0068864_100353869 | Ga0068864_1003538692 | 113 |
| 127 | 3300005841 | Ga0068863_100097332 | Ga0068863_1000973323 | 113 |
| 128 | 3300005841 | Ga0068863_100964836 | Ga0068863_1009648362 | 113 |
| 129 | 3300005841 | Ga0068863_101211858 | Ga0068863_1012118581 | 113 |
| 130 | 3300005842 | Ga0068858_101060473 | Ga0068858_1010604732 | 113 |
| 131 | 3300005843 | Ga0068860_100322174 | Ga0068860_1003221742 | 113 |
| 132 | 3300005843 | Ga0068860_102033603 | Ga0068860_1020336032 | 113 |
| 133 | 3300006173 | Ga0070716_100412800 | Ga0070716_1004128002 | 113 |
| 134 | 3300006173 | Ga0070716_100854685 | Ga0070716_1008546852 | 113 |
| 135 | 3300006175 | Ga0070712_100038828 | Ga0070712_1000388282 | 113 |
| 136 | 3300006175 | Ga0070712_100212734 | Ga0070712_1002127341 | 113 |
| 137 | 3300006237 | Ga0097621_100430943 | Ga0097621_1004309432 | 113 |
| 138 | 3300006237 | Ga0097621_100539380 | Ga0097621_1005393802 | 113 |
| 139 | 3300006237 | Ga0097621_100587355 | Ga0097621_1005873552 | 113 |
| 140 | 3300006358 | Ga0068871_100117227 | Ga0068871_1001172273 | 113 |
| 141 | 3300006852 | Ga0075433_10010992 | Ga0075433_100109929 | 113 |
| 142 | 3300006852 | Ga0075433_10342801 | Ga0075433_103428012 | 113 |
| 143 | 3300006871 | Ga0075434_100002248 | Ga0075434_10000224816 | 113 |
| 144 | 3300006871 | Ga0075434_100291643 | Ga0075434_1002916432 | 113 |
| 145 | 3300006871 | Ga0075434_102093596 | Ga0075434_1020935961 | 113 |
| 146 | 3300006881 | Ga0068865_100113037 | Ga0068865_1001130374 | 113 |
| 147 | 3300006914 | Ga0075436_100069431 | Ga0075436_1000694315 | 113 |
| 148 | 3300006914 | Ga0075436_100150287 | Ga0075436_1001502873 | 113 |
| 149 | 3300006931 | Ga0097620_100064593 | Ga0097620_1000645931 | 113 |
| 150 | 3300007076 | Ga0075435_101374841 | Ga0075435_1013748411 | 113 |
| 151 | 3300009094 | Ga0111539_11313677 | Ga0111539_113136772 | 113 |
| 152 | 3300009098 | Ga0105245_10026542 | Ga0105245_100265424 | 113 |
| 153 | 3300009174 | Ga0105241_10001817 | Ga0105241_100018178 | 113 |
| 154 | 3300009174 | Ga0105241_12102047 | Ga0105241_121020471 | 113 |
| 155 | 3300009177 | Ga0105248_10010154 | Ga0105248_100101548 | 113 |
| 156 | 3300009177 | Ga0105248_10428349 | Ga0105248_104283493 | 113 |
| 157 | 3300009545 | Ga0105237_10094143 | Ga0105237_100941434 | 113 |
| 158 | 3300009545 | Ga0105237_10437898 | Ga0105237_104378982 | 113 |
| 159 | 3300009545 | Ga0105237_10869904 | Ga0105237_108699042 | 113 |
| 160 | 3300009553 | Ga0105249_10051727 | Ga0105249_100517275 | 113 |
| 161 | 3300010375 | Ga0105239_10014730 | Ga0105239_100147306 | 113 |
| 162 | 3300010375 | Ga0105239_10974676 | Ga0105239_109746762 | 113 |
| 163 | 3300010375 | Ga0105239_12492855 | Ga0105239_124928551 | 113 |
| 164 | 3300011119 | Ga0105246_10311055 | Ga0105246_103110553 | 113 |
| 165 | 3300011119 | Ga0105246_11095668 | Ga0105246_110956682 | 113 |
| 166 | 3300012503 | Ga0157313_1053562 | Ga0157313_10535621 | 113 |
| 167 | 3300013100 | Ga0157373_10084019 | Ga0157373_100840192 | 113 |
| 168 | 3300013100 | Ga0157373_11495074 | Ga0157373_114950742 | 113 |
| 169 | 3300013102 | Ga0157371_10234355 | Ga0157371_102343552 | 113 |
| 170 | 3300013105 | Ga0157369_10002329 | Ga0157369_100023293 | 113 |
| 171 | 3300013105 | Ga0157369_10024513 | Ga0157369_100245137 | 113 |
| 172 | 3300013105 | Ga0157369_10195714 | Ga0157369_101957145 | 113 |
| 173 | 3300013296 | Ga0157374_11715889 | Ga0157374_117158892 | 113 |
| 174 | 3300013306 | Ga0163162_10024958 | Ga0163162_100249585 | 113 |
| 175 | 3300013306 | Ga0163162_10522431 | Ga0163162_105224311 | 113 |
| 176 | 3300013306 | Ga0163162_11730644 | Ga0163162_117306441 | 113 |
| 177 | 3300013307 | Ga0157372_10043363 | Ga0157372_100433638 | 113 |
| 178 | 3300013307 | Ga0157372_10078613 | Ga0157372_100786134 | 113 |
| 179 | 3300013307 | Ga0157372_10272387 | Ga0157372_102723872 | 113 |
| 180 | 3300013307 | Ga0157372_12355980 | Ga0157372_123559801 | 113 |
| 181 | 3300013307 | Ga0157372_12676574 | Ga0157372_126765741 | 113 |
| 182 | 3300013308 | Ga0157375_11041377 | Ga0157375_110413772 | 113 |
| 183 | 3300014325 | Ga0163163_10039766 | Ga0163163_100397663 | 113 |
| 184 | 3300014325 | Ga0163163_10086956 | Ga0163163_100869563 | 113 |
| 185 | 3300014325 | Ga0163163_10673504 | Ga0163163_106735042 | 113 |
| 186 | 3300014326 | Ga0157380_11188739 | Ga0157380_111887392 | 113 |
| 187 | 3300014497 | Ga0182008_10154891 | Ga0182008_101548912 | 113 |
| 188 | 3300014745 | Ga0157377_10433910 | Ga0157377_104339101 | 113 |
| 189 | 3300014745 | Ga0157377_10609322 | Ga0157377_106093222 | 113 |
| 190 | 3300014968 | Ga0157379_10389973 | Ga0157379_103899732 | 113 |
| 191 | 3300014968 | Ga0157379_12069540 | Ga0157379_120695402 | 113 |
| 192 | 3300014969 | Ga0157376_11030532 | Ga0157376_110305322 | 113 |
| 193 | 3300015261 | Ga0182006_1313434 | Ga0182006_13134341 | 113 |
| 194 | 3300020070 | Ga0206356_10787821 | Ga0206356_107878211 | 113 |
| 195 | 3300020076 | Ga0206355_1687614 | Ga0206355_16876141 | 113 |
| 196 | 3300020078 | Ga0206352_10801691 | Ga0206352_108016911 | 113 |
| 197 | 3300020080 | Ga0206350_11019036 | Ga0206350_110190361 | 113 |
| 198 | 3300020081 | Ga0206354_11284312 | Ga0206354_112843121 | 113 |
| 199 | 3300022467 | Ga0224712_10013167 | Ga0224712_100131671 | 113 |
| 200 | 3300022467 | Ga0224712_10194863 | Ga0224712_101948632 | 113 |
| 201 | 3300022467 | Ga0224712_10527140 | Ga0224712_105271402 | 113 |
| 202 | 3300025898 | Ga0207692_10081093 | Ga0207692_100810932 | 113 |
| 203 | 3300025900 | Ga0207710_10242441 | Ga0207710_102424412 | 113 |
| 204 | 3300025901 | Ga0207688_10024822 | Ga0207688_100248222 | 113 |
| 205 | 3300025906 | Ga0207699_10515002 | Ga0207699_105150022 | 113 |
| 206 | 3300025906 | Ga0207699_10694710 | Ga0207699_106947102 | 113 |
| 207 | 3300025909 | Ga0207705_10067857 | Ga0207705_100678572 | 113 |
| 208 | 3300025909 | Ga0207705_10144629 | Ga0207705_101446292 | 113 |
| 209 | 3300025911 | Ga0207654_10035467 | Ga0207654_100354672 | 113 |
| 210 | 3300025912 | Ga0207707_10504842 | Ga0207707_105048422 | 113 |
| 211 | 3300025912 | Ga0207707_10790751 | Ga0207707_107907512 | 113 |
| 212 | 3300025915 | Ga0207693_10049825 | Ga0207693_100498252 | 113 |
| 213 | 3300025916 | Ga0207663_10733077 | Ga0207663_107330772 | 113 |
| 214 | 3300025916 | Ga0207663_11495486 | Ga0207663_114954861 | 113 |
| 215 | 3300025917 | Ga0207660_10159662 | Ga0207660_101596622 | 113 |
| 216 | 3300025917 | Ga0207660_11672099 | Ga0207660_116720991 | 113 |
| 217 | 3300025920 | Ga0207649_10546725 | Ga0207649_105467252 | 113 |
| 218 | 3300025921 | Ga0207652_10015310 | Ga0207652_100153102 | 113 |
| 219 | 3300025921 | Ga0207652_10091887 | Ga0207652_100918875 | 113 |
| 220 | 3300025921 | Ga0207652_10504296 | Ga0207652_105042962 | 113 |
| 221 | 3300025924 | Ga0207694_11529757 | Ga0207694_115297571 | 113 |
| 222 | 3300025925 | Ga0207650_10174750 | Ga0207650_101747502 | 113 |
| 223 | 3300025926 | Ga0207659_10453545 | Ga0207659_104535452 | 113 |
| 224 | 3300025927 | Ga0207687_10290902 | Ga0207687_102909023 | 113 |
| 225 | 3300025927 | Ga0207687_10725580 | Ga0207687_107255802 | 113 |
| 226 | 3300025928 | Ga0207700_10209401 | Ga0207700_102094013 | 113 |
| 227 | 3300025928 | Ga0207700_10740049 | Ga0207700_107400492 | 113 |
| 228 | 3300025928 | Ga0207700_11193029 | Ga0207700_111930292 | 113 |
| 229 | 3300025929 | Ga0207664_10043974 | Ga0207664_100439742 | 113 |
| 230 | 3300025929 | Ga0207664_10245310 | Ga0207664_102453102 | 113 |
| 231 | 3300025931 | Ga0207644_10712233 | Ga0207644_107122331 | 113 |
| 232 | 3300025931 | Ga0207644_11753408 | Ga0207644_117534081 | 113 |
| 233 | 3300025933 | Ga0207706_10135512 | Ga0207706_101355124 | 113 |
| 234 | 3300025936 | Ga0207670_10348553 | Ga0207670_103485531 | 113 |
| 235 | 3300025937 | Ga0207669_10674146 | Ga0207669_106741462 | 113 |
| 236 | 3300025938 | Ga0207704_10177086 | Ga0207704_101770863 | 113 |
| 237 | 3300025938 | Ga0207704_10545833 | Ga0207704_105458332 | 113 |
| 238 | 3300025939 | Ga0207665_10212776 | Ga0207665_102127763 | 113 |
| 239 | 3300025941 | Ga0207711_10606924 | Ga0207711_106069242 | 113 |
| 240 | 3300025942 | Ga0207689_10001317 | Ga0207689_1000131723 | 113 |
| 241 | 3300025944 | Ga0207661_10008544 | Ga0207661_100085442 | 113 |
| 242 | 3300025944 | Ga0207661_10648199 | Ga0207661_106481991 | 113 |
| 243 | 3300025945 | Ga0207679_10006108 | Ga0207679_100061088 | 113 |
| 244 | 3300025945 | Ga0207679_10059888 | Ga0207679_100598881 | 113 |
| 245 | 3300025945 | Ga0207679_10075285 | Ga0207679_100752852 | 113 |
| 246 | 3300025945 | Ga0207679_10634639 | Ga0207679_106346391 | 113 |
| 247 | 3300025945 | Ga0207679_10646645 | Ga0207679_106466452 | 113 |
| 248 | 3300025949 | Ga0207667_10697180 | Ga0207667_106971802 | 113 |
| 249 | 3300025960 | Ga0207651_10209660 | Ga0207651_102096601 | 113 |
| 250 | 3300025961 | Ga0207712_10026197 | Ga0207712_100261974 | 113 |
| 251 | 3300025981 | Ga0207640_11267594 | Ga0207640_112675941 | 113 |
| 252 | 3300026035 | Ga0207703_10347167 | Ga0207703_103471672 | 113 |
| 253 | 3300026041 | Ga0207639_10162299 | Ga0207639_101622992 | 113 |
| 254 | 3300026041 | Ga0207639_10764119 | Ga0207639_107641192 | 113 |
| 255 | 3300026078 | Ga0207702_10004745 | Ga0207702_100047451 | 113 |
| 256 | 3300026078 | Ga0207702_10022912 | Ga0207702_100229122 | 113 |
| 257 | 3300026078 | Ga0207702_10810922 | Ga0207702_108109222 | 113 |
| 258 | 3300026088 | Ga0207641_10053422 | Ga0207641_100534223 | 113 |
| 259 | 3300026088 | Ga0207641_11657649 | Ga0207641_116576491 | 113 |
| 260 | 3300026095 | Ga0207676_10047940 | Ga0207676_100479402 | 113 |
| 261 | 3300026095 | Ga0207676_10074433 | Ga0207676_100744334 | 113 |
| 262 | 3300026095 | Ga0207676_11262309 | Ga0207676_112623091 | 113 |
| 263 | 3300026116 | Ga0207674_10000041 | Ga0207674_1000004115 | 113 |
| 264 | 3300026116 | Ga0207674_10043027 | Ga0207674_100430277 | 113 |
| 265 | 3300026116 | Ga0207674_10128964 | Ga0207674_101289642 | 113 |
| 266 | 3300026116 | Ga0207674_10185105 | Ga0207674_101851053 | 113 |
| 267 | 3300026121 | Ga0207683_10545603 | Ga0207683_105456032 | 113 |
| 268 | 3300026121 | Ga0207683_11188085 | Ga0207683_111880852 | 113 |
| 269 | 3300027395 | Ga0209996_1056838 | Ga0209996_10568381 | 113 |
| 270 | 3300027876 | Ga0209974_10059042 | Ga0209974_100590422 | 113 |
| 271 | 3300027907 | Ga0207428_10618506 | Ga0207428_106185061 | 113 |
| 272 | 3300028380 | Ga0268265_10183104 | Ga0268265_101831042 | 113 |
| 273 | 3300028380 | Ga0268265_10210638 | Ga0268265_102106382 | 113 |
| 274 | 3300028381 | Ga0268264_12368793 | Ga0268264_123687932 | 113 |
| 275 | 3300028573 | Ga0265334_10108370 | Ga0265334_101083702 | 113 |
| 276 | 3300028577 | Ga0265318_10008767 | Ga0265318_100087674 | 113 |
| 277 | 3300031691 | Ga0316579_10037460 | Ga0316579_100374604 | 113 |
| 278 | 3300031691 | Ga0316579_10039379 | Ga0316579_100393792 | 113 |
| 279 | 3300031691 | Ga0316579_10062779 | Ga0316579_100627793 | 113 |
| 280 | 3300031727 | Ga0316576_10016450 | Ga0316576_100164502 | 113 |
| 281 | 3300031727 | Ga0316576_10074951 | Ga0316576_100749513 | 113 |
| 282 | 3300031727 | Ga0316576_10262165 | Ga0316576_102621651 | 113 |
| 283 | 3300031727 | Ga0316576_10289642 | Ga0316576_102896422 | 113 |
| 284 | 3300031728 | Ga0316578_10076326 | Ga0316578_100763263 | 113 |
| 285 | 3300031728 | Ga0316578_10342836 | Ga0316578_103428361 | 113 |
| 286 | 3300031733 | Ga0316577_10042720 | Ga0316577_100427204 | 113 |
| 287 | 3300031733 | Ga0316577_10542664 | Ga0316577_105426642 | 113 |
| 288 | 3300032002 | Ga0307416_100775648 | Ga0307416_1007756481 | 113 |
| 289 | 3300032133 | Ga0316583_10036713 | Ga0316583_100367134 | 113 |
| 290 | 3300032133 | Ga0316583_10078813 | Ga0316583_100788132 | 113 |
| 291 | 3300032139 | Ga0316580_10010574 | Ga0316580_100105741 | 113 |
| 292 | 3300032139 | Ga0316580_10163471 | Ga0316580_101634711 | 113 |
| 293 | 3300033528 | Ga0316588_1088827 | Ga0316588_10888271 | 113 |
| 294 | 3300033541 | Ga0316596_1010089 | Ga0316596_10100892 | 113 |
| 295 | 3300035083 | Ga0373926_0043017 | Ga0373926_0043017_684_1058 | 113 |
| 296 | 3300035091 | Ga0373951_0059297 | Ga0373951_0059297_421_765 | 113 |
| 297 | 3300035116 | Ga0373945_0001155 | Ga0373945_0001155_2008_2382 | 113 |
| 298 | 3300035121 | Ga0373960_0058472 | Ga0373960_0058472_686_1030 | 113 |
| 299 | 3300035170 | Ga0373943_0012587 | Ga0373943_0012587_3021_3395 | 113 |
| 300 | 3300035170 | Ga0373943_0224780 | Ga0373943_0224780_132_476 | 113 |
| 301 | 3300035171 | Ga0373946_0111400 | Ga0373946_0111400_464_838 | 113 |
| 302 | 3300035398 | Ga0316574_0045712 | Ga0316574_0045712_2072_2416 | 113 |
| 303 | 3300035398 | Ga0316574_0340855 | Ga0316574_0340855_371_715 | 113 |
| 304 | 3300035398 | Ga0316574_0519586 | Ga0316574_0519586_53_397 | 113 |
| 305 | 3300035692 | Ga0373935_0012499 | Ga0373935_0012499_2791_3165 | 113 |
| 306 | 3300035695 | Ga0373927_0000002 | Ga0373927_0000002_347748_348092 | 113 |
| 307 | 3300035695 | Ga0373927_0028218 | Ga0373927_0028218_2855_3229 | 113 |
| 308 | 3300035725 | Ga0373947_0019729 | Ga0373947_0019729_2957_3331 | 113 |
| 309 | 3300035725 | Ga0373947_0096668 | Ga0373947_0096668_1141_1485 | 113 |
| 310 | 3300036401 | Ga0373937_1271499 | Ga0373937_1271499_188_532 | 113 |
| 311 | 3300036647 | Ga0316582_0009111 | Ga0316582_0009111_888_1232 | 113 |
| 312 | 3300036647 | Ga0316582_0024540 | Ga0316582_0024540_1039_1383 | 113 |
| 313 | 3300036647 | Ga0316582_0110056 | Ga0316582_0110056_943_1287 | 113 |
| 314 | 3300036647 | Ga0316582_0651294 | Ga0316582_0651294_269_613 | 113 |
| 315 | 3300036712 | Ga0316584_0122066 | Ga0316584_0122066_84_428 | 113 |
| 316 | 3300036712 | Ga0316584_0849279 | Ga0316584_0849279_212_556 | 113 |
| 317 | 3300037068 | Ga0373925_0034085 | Ga0373925_0034085_2956_3330 | 113 |
| 318 | 3300037068 | Ga0373925_0393958 | Ga0373925_0393958_119_463 | 113 |
| 319 | 3300037588 | Ga0316581_0087556 | Ga0316581_0087556_272_616 | 113 |
| 320 | 3300041486 | Ga0451807_0174739 | Ga0451807_0174739_37_381 | 113 |
| 321 | 3300041486 | Ga0451807_2560339 | Ga0451807_2560339_53_397 | 113 |
| 322 | 3300042876 | Ga0451577_0000942 | Ga0451577_0000942_8092_8436 | 113 |
| 323 | 3300042876 | Ga0451577_0001172 | Ga0451577_0001172_28583_28927 | 113 |
| 324 | 3300042876 | Ga0451577_0018095 | Ga0451577_0018095_2109_2453 | 113 |
| 325 | 3300042876 | Ga0451577_0028505 | Ga0451577_0028505_4176_4520 | 113 |
| 326 | 3300042876 | Ga0451577_0268665 | Ga0451577_0268665_1091_1468 | 113 |
| 327 | 3300042876 | Ga0451577_0295409 | Ga0451577_0295409_715_1059 | 113 |
| 328 | 3300042876 | Ga0451577_0411017 | Ga0451577_0411017_674_1018 | 113 |
| 329 | 3300042876 | Ga0451577_0775840 | Ga0451577_0775840_210_554 | 113 |
| 330 | 3300042876 | Ga0451577_1105754 | Ga0451577_1105754_57_401 | 113 |
| 331 | 3300044673 | Ga0453683_0001173 | Ga0453683_0001173_6663_7010 | 113 |
| 332 | 3300044673 | Ga0453683_0059250 | Ga0453683_0059250_1111_1455 | 113 |
| 333 | 3300044712 | Ga0453684_0000005 | Ga0453684_0000005_642244_642588 | 113 |
| 334 | 3300044712 | Ga0453684_0000023 | Ga0453684_0000023_273285_273629 | 113 |
| 335 | 3300044712 | Ga0453684_0002651 | Ga0453684_0002651_8045_8389 | 113 |
| 336 | 3300044712 | Ga0453684_0011758 | Ga0453684_0011758_13833_14177 | 113 |
| 337 | 3300044712 | Ga0453684_0011772 | Ga0453684_0011772_13190_13534 | 113 |
| 338 | 3300044712 | Ga0453684_0041372 | Ga0453684_0041372_512_856 | 113 |
| 339 | 3300044712 | Ga0453684_0051241 | Ga0453684_0051241_368_712 | 113 |
| 340 | 3300044712 | Ga0453684_0051647 | Ga0453684_0051647_230_574 | 113 |
| 341 | 3300044712 | Ga0453684_0066736 | Ga0453684_0066736_194_538 | 113 |
| 342 | 3300044712 | Ga0453684_0094215 | Ga0453684_0094215_671_1015 | 113 |
| 343 | 3300044712 | Ga0453684_0094872 | Ga0453684_0094872_907_1251 | 113 |
| 344 | 3300044712 | Ga0453684_0102569 | Ga0453684_0102569_2594_2938 | 113 |
| 345 | 3300044712 | Ga0453684_0113831 | Ga0453684_0113831_275_622 | 113 |
| 346 | 3300044712 | Ga0453684_0192412 | Ga0453684_0192412_1899_2243 | 113 |
| 347 | 3300044712 | Ga0453684_0278586 | Ga0453684_0278586_846_1190 | 113 |
| 348 | 3300044712 | Ga0453684_0754418 | Ga0453684_0754418_686_1039 | 113 |
| 349 | 3300044712 | Ga0453684_0777762 | Ga0453684_0777762_651_995 | 113 |
| 350 | 3300044712 | Ga0453684_0823930 | Ga0453684_0823930_24_368 | 113 |
| 351 | 3300044712 | Ga0453684_0903317 | Ga0453684_0903317_306_650 | 113 |
| 352 | 3300044712 | Ga0453684_0989028 | Ga0453684_0989028_263_607 | 113 |
| 353 | 3300044712 | Ga0453684_1051160 | Ga0453684_1051160_309_677 | 113 |
| 354 | 3300044712 | Ga0453684_1127456 | Ga0453684_1127456_304_648 | 113 |
| 355 | 3300044712 | Ga0453684_1218015 | Ga0453684_1218015_345_692 | 113 |
| 356 | 3300044712 | Ga0453684_1332158 | Ga0453684_1332158_281_625 | 113 |
| 357 | 3300044712 | Ga0453684_1360648 | Ga0453684_1360648_174_518 | 113 |
| 358 | 3300044712 | Ga0453684_1435477 | Ga0453684_1435477_284_628 | 113 |
| 359 | 3300044712 | Ga0453684_1482377 | Ga0453684_1482377_299_643 | 113 |
| 360 | 3300045051 | Ga0451576_0015582 | Ga0451576_0015582_3904_4251 | 113 |
| 361 | 3300045051 | Ga0451576_0054861 | Ga0451576_0054861_850_1194 | 113 |
| 362 | 3300045051 | Ga0451576_0176509 | Ga0451576_0176509_285_629 | 113 |
| 363 | 3300046459 | Ga0495629_0005769 | Ga0495629_0005769_406_780 | 113 |
| 364 | 3300046459 | Ga0495629_0225889 | Ga0495629_0225889_216_560 | 113 |
| 365 | 3300046461 | Ga0495641_0086747 | Ga0495641_0086747_368_742 | 113 |
| 366 | 3300046461 | Ga0495641_0111441 | Ga0495641_0111441_345_689 | 113 |
| 367 | 3300046463 | Ga0495653_0190975 | Ga0495653_0190975_639_983 | 113 |
| 368 | 3300046473 | Ga0495582_0021833 | Ga0495582_0021833_285_659 | 113 |
| 369 | 3300046475 | Ga0495639_0003905 | Ga0495639_0003905_5596_5970 | 113 |
| 370 | 3300046476 | Ga0495662_0137913 | Ga0495662_0137913_287_661 | 113 |
| 371 | 3300046517 | Ga0495630_0087836 | Ga0495630_0087836_370_744 | 113 |
| 372 | 3300046531 | Ga0495665_0023025 | Ga0495665_0023025_429_803 | 113 |
| 373 | 3300046533 | Ga0495640_0004728 | Ga0495640_0004728_1230_1604 | 113 |
| 374 | 3300046533 | Ga0495640_0737829 | Ga0495640_0737829_191_535 | 113 |
| 375 | 3300046642 | Ga0495634_0020306 | Ga0495634_0020306_450_824 | 113 |
| 376 | 3300046663 | Ga0495635_0008942 | Ga0495635_0008942_3763_4137 | 113 |
| 377 | 3300046663 | Ga0495635_0115781 | Ga0495635_0115781_673_1017 | 113 |
| 378 | 3300046681 | Ga0495647_0012216 | Ga0495647_0012216_46_390 | 113 |
| 379 | 3300046681 | Ga0495647_0116447 | Ga0495647_0116447_377_721 | 113 |
| 380 | 3300046683 | Ga0495658_0027904 | Ga0495658_0027904_2198_2572 | 113 |
| 381 | 3300046689 | Ga0495613_0007249 | Ga0495613_0007249_2832_3206 | 113 |
| 382 | 3300046690 | Ga0495624_0029925 | Ga0495624_0029925_2839_3213 | 113 |
| 383 | 3300047315 | Ga0495581_0011990 | Ga0495581_0011990_2828_3202 | 113 |
| 384 | 3300047315 | Ga0495581_0526721 | Ga0495581_0526721_264_608 | 113 |
| 385 | 3300047319 | Ga0495674_0501090 | Ga0495674_0501090_584_928 | 113 |
| 386 | 3300047321 | Ga0495676_0041012 | Ga0495676_0041012_3021_3395 | 113 |
| 387 | 3300047322 | Ga0495680_0003977 | Ga0495680_0003977_13486_13860 | 113 |
| 388 | 3300047322 | Ga0495680_0358879 | Ga0495680_0358879_561_905 | 113 |
| 389 | 3300048903 | Ga0496100_0095946 | Ga0496100_0095946_1555_1911 | 113 |
| 390 | 3300048903 | Ga0496100_1115585 | Ga0496100_1115585_237_581 | 113 |
| 391 | 3300048904 | Ga0496101_0133359 | Ga0496101_0133359_204_548 | 113 |
| 392 | 3300048905 | Ga0496102_0511886 | Ga0496102_0511886_46_390 | 113 |
| 393 | 3300048905 | Ga0496102_1418939 | Ga0496102_1418939_179_523 | 113 |
| 394 | 3300048907 | Ga0496104_0020573 | Ga0496104_0020573_3396_3794 | 113 |
| 395 | 3300048907 | Ga0496104_0046750 | Ga0496104_0046750_1741_2085 | 113 |
| 396 | 3300048907 | Ga0496104_0636394 | Ga0496104_0636394_328_672 | 113 |
| 397 | 3300048908 | Ga0496105_0070661 | Ga0496105_0070661_2071_2469 | 113 |
| 398 | 3300048908 | Ga0496105_0286955 | Ga0496105_0286955_92_436 | 113 |
| 399 | 3300048908 | Ga0496105_0397411 | Ga0496105_0397411_619_963 | 113 |
| 400 | 3300048908 | Ga0496105_0769063 | Ga0496105_0769063_216_590 | 113 |
| 401 | 3300048911 | Ga0496108_0110779 | Ga0496108_0110779_499_843 | 113 |
| 402 | 3300048911 | Ga0496108_0296254 | Ga0496108_0296254_308_652 | 113 |
| 403 | 3300048911 | Ga0496108_1522182 | Ga0496108_1522182_85_459 | 113 |
| 404 | 3300048912 | Ga0496109_0194653 | Ga0496109_0194653_115_513 | 113 |
| 405 | 3300048912 | Ga0496109_0576057 | Ga0496109_0576057_497_841 | 113 |
| 406 | 3300048912 | Ga0496109_1011663 | Ga0496109_1011663_318_662 | 113 |
| 407 | 3300048913 | Ga0496110_0065332 | Ga0496110_0065332_2837_3181 | 113 |
| 408 | 3300048913 | Ga0496110_0151540 | Ga0496110_0151540_349_693 | 113 |
| 409 | 3300048913 | Ga0496110_0469876 | Ga0496110_0469876_254_598 | 113 |
| 410 | 3300048913 | Ga0496110_0481392 | Ga0496110_0481392_324_668 | 113 |
| 411 | 3300048914 | Ga0496111_0011688 | Ga0496111_0011688_3331_3675 | 113 |
| 412 | 3300048914 | Ga0496111_0123439 | Ga0496111_0123439_452_796 | 113 |
| 413 | 3300048914 | Ga0496111_0716013 | Ga0496111_0716013_150_494 | 113 |
| 414 | 3300048915 | Ga0496112_0018917 | Ga0496112_0018917_3493_3837 | 113 |
| 415 | 3300048915 | Ga0496112_0211216 | Ga0496112_0211216_1463_1837 | 113 |
| 416 | 3300048916 | Ga0496113_0026758 | Ga0496113_0026758_2023_2367 | 113 |
| 417 | 3300048916 | Ga0496113_0257972 | Ga0496113_0257972_149_493 | 113 |
| 418 | 3300048916 | Ga0496113_0357401 | Ga0496113_0357401_470_814 | 113 |
| 419 | 3300048917 | Ga0496114_0546469 | Ga0496114_0546469_427_792 | 113 |
| 420 | 3300048917 | Ga0496114_0709724 | Ga0496114_0709724_43_387 | 113 |
| 421 | 3300048918 | Ga0496115_0215346 | Ga0496115_0215346_156_500 | 113 |
| 422 | 3300050492 | nmdc:mga0yw44_88592_c1 | nmdc:mga0yw44_88592_c1_219_563 | 113 |
| 423 | 3300050507 | nmdc:mga05p37_110115_c1 | nmdc:mga05p37_110115_c1_1398_1742 | 113 |
| 424 | 3300050511 | nmdc:mga08y16_172973_c1 | nmdc:mga08y16_172973_c1_242_586 | 113 |
| 425 | 3300050512 | nmdc:mga0n895_286869_c1 | nmdc:mga0n895_286869_c1_61_405 | 113 |
| 426 | 3300050515 | nmdc:mga0a205_407031_c1 | nmdc:mga0a205_407031_c1_414_788 | 113 |
| 427 | 3300050515 | nmdc:mga0a205_67112_c1 | nmdc:mga0a205_67112_c1_2326_2670 | 113 |
| 428 | 3300050515 | nmdc:mga0a205_764524_c1 | nmdc:mga0a205_764524_c1_19_441 | 113 |
| 429 | 3300053085 | Ga0495619_0012084 | Ga0495619_0012084_4269_4643 | 113 |
| 430 | 3300053085 | Ga0495619_0284446 | Ga0495619_0284446_778_1122 | 113 |
| 431 | 3300053136 | Ga0500559_0099947 | Ga0500559_0099947_670_1014 | 113 |
| 432 | 3300002067 | JGI24735J21928_10026296 | JGI24735J21928_100262964 | 114 |
| 433 | 3300038443 | Ga0395901_0348185 | Ga0395901_0348185_1064_1408 | 114 |
| 434 | 3300048905 | Ga0496102_0085927 | Ga0496102_0085927_699_1049 | 114 |
| 435 | 3300048914 | Ga0496111_0406435 | Ga0496111_0406435_148_498 | 114 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4la3-assembly2.cif.gz_B | crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp | 0.8821 | 34 | 108 |
| 8hjy-assembly1.cif.gz_B | crystal structure of a cupin protein (tm1459, h52a/h58e/f104w mutant) in copper (cu) substituted form | 0.88 | 8 | 109 |
| 6l2f-assembly1.cif.gz_B | crystal structure of a cupin protein (tm1459, h54ah58a mutant) in copper (cu) substituted form | 0.8791 | 8 | 109 |
| 5wsd-assembly1.cif.gz_B | crystal structure of a cupin protein (tm1459) in apo form | 0.8791 | 8 | 109 |
| 5jsp-assembly1.cif.gz_A | new mechanistic insight from substrate and product bound structures of the metal-dependent dimethylsulfoniopropionate lyase dddq | 0.8788 | 34 | 108 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5jspB00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8791 | 34 | 108 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8638 | 10 | 110 | 2.60.120.10 |
| 2h0vB02 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8635 | 34 | 108 | 2.60.120.10 |
| af_Q9USR9_537_626_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8634 | 10 | 110 | 2.60.120.10 |
| 5wsdA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.8556 | 8 | 108 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H5LHQ7-F1-model_v4 | deleted | 1.004 | 6 | 111 |
|
| AF-A0JTC5-F1-model_v4 | Cupin 2, conserved barrel domain protein | 1.001 | 3 | 111 |
|
| AF-Q1I8G4-F1-model_v4 | Cupin 2 conserved barrel domain-containing protein | 0.9964 | 2 | 111 |
|
| AF-A0A0Q9EMV4-F1-model_v4 | Cupin | 0.9955 | 20 | 111 |
|
| AF-A0A4R8WTJ1-F1-model_v4 | Cupin domain-containing protein | 0.9934 | 2 | 111 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar