F443425

General Info

Members Datasets Scaffolds Average Seq Length
435 215 435 116

Family's Representative Sequence

Representative Sequence 3300050515|nmdc:mga0a205_764524_c1|nmdc:mga0a205_764524_c1_19_441
Length 140
Sequence MRRGHEPGADVAESAARPEAGERGEAMKKEQAASETKGITVKLLAVLDLGPEIEGMAGRQLRMRLVTIEPGGVFGPVHDHRERPGMVYVLQGTITDHRDGVATEYGPGPGWPEDRSTLHWLENRGTIPAVEVSVDIVRKE

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
141 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
142 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
143 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
144 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
148 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
149 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
158 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
163 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
168 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
171 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
176 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
181 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.7
Metatranscriptomes 2.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.69
Nodule 0
Rhizoplane 8.97
Rhizosphere 90.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10026296 3300002067 Bacteria 1750
2 Ga0070658_10029041 3300005327 Bacteria 4441
3 Ga0070658_10944667 3300005327 Bacteria 750
4 Ga0070683_100007175 3300005329 Bacteria 9397
5 Ga0070683_100095714 3300005329 Bacteria 2792
6 Ga0070683_100405950 3300005329 Bacteria 1299
7 Ga0070683_100474494 3300005329 Bacteria 1194
8 Ga0070683_101045243 3300005329 Unclassified 784
9 Ga0070690_100307622 3300005330 Bacteria 1138
10 Ga0070670_100053702 3300005331 Bacteria 3460
11 Ga0070670_101585253 3300005331 Bacteria 602
12 Ga0070680_100146335 3300005336 Bacteria 1982
13 Ga0070680_100447007 3300005336 Bacteria 1104
14 Ga0070680_101640484 3300005336 Bacteria 557
15 Ga0070682_100889164 3300005337 Bacteria 731
16 Ga0070682_101536070 3300005337 Bacteria 574
17 Ga0068868_101666753 3300005338 Bacteria 600
18 Ga0070660_100019046 3300005339 Bacteria 5025
19 Ga0070660_100058294 3300005339 Bacteria 2993
20 Ga0070691_10013536 3300005341 Bacteria 3736
21 Ga0070687_100049015 3300005343 Bacteria 2174
22 Ga0070687_101491337 3300005343 Bacteria 508
23 Ga0070661_100240574 3300005344 Bacteria 1394
24 Ga0070661_101088415 3300005344 Bacteria 665
25 Ga0070669_100150539 3300005353 Bacteria 1801
26 Ga0070675_100336968 3300005354 Unclassified 1335
27 Ga0070675_100873011 3300005354 Bacteria 824
28 Ga0070671_100797447 3300005355 Bacteria 822
29 Ga0070671_101203795 3300005355 Bacteria 667
30 Ga0070671_101318150 3300005355 Bacteria 637
31 Ga0070674_100754225 3300005356 Bacteria 837
32 Ga0070673_102288716 3300005364 Bacteria 514
33 Ga0070709_10069387 3300005434 Bacteria 2270
34 Ga0070709_10747811 3300005434 Bacteria 764
35 Ga0070714_100001701 3300005435 Bacteria 16003
36 Ga0070714_100005662 3300005435 Bacteria 9561
37 Ga0070714_100962937 3300005435 Bacteria 830
38 Ga0070714_101150810 3300005435 Bacteria 757
39 Ga0070713_100428966 3300005436 Bacteria 1238
40 Ga0070713_100591021 3300005436 Bacteria 1054
41 Ga0070713_100995306 3300005436 Bacteria 809
42 Ga0070713_101766995 3300005436 Bacteria 600
43 Ga0070701_10115560 3300005438 Bacteria 1505
44 Ga0070711_100111507 3300005439 Bacteria 2008
45 Ga0070711_101437426 3300005439 Bacteria 601
46 Ga0070705_101323148 3300005440 Bacteria 598
47 Ga0070700_100115146 3300005441 Bacteria 1793
48 Ga0070694_100422395 3300005444 Bacteria 1048
49 Ga0070678_100577708 3300005456 Unclassified 1001
50 Ga0070678_101189112 3300005456 Bacteria 707
51 Ga0070662_100389673 3300005457 Bacteria 1148
52 Ga0070681_10014471 3300005458 Bacteria 7851
53 Ga0070681_10088346 3300005458 Bacteria 3051
54 Ga0070681_10331709 3300005458 Bacteria 1431
55 Ga0070681_11513503 3300005458 Bacteria 596
56 Ga0070707_102350276 3300005468 Bacteria 500
57 Ga0070698_102128972 3300005471 Bacteria 514
58 Ga0070679_100017458 3300005530 Bacteria 6946
59 Ga0070679_100101399 3300005530 Bacteria 2865
60 Ga0070679_100241818 3300005530 Bacteria 1762
61 Ga0070679_100385462 3300005530 Bacteria 1348
62 Ga0070679_101253125 3300005530 Bacteria 687
63 Ga0070684_100000501 3300005535 Bacteria 26949
64 Ga0070684_100004104 3300005535 Bacteria 11014
65 Ga0070684_100046295 3300005535 Bacteria 3769
66 Ga0070684_100120086 3300005535 Bacteria 2364
67 Ga0070684_100456681 3300005535 Bacteria 1181
68 Ga0070684_100694502 3300005535 Bacteria 948
69 Ga0068853_100060417 3300005539 Bacteria 3275
70 Ga0068853_100243209 3300005539 Bacteria 1650
71 Ga0068853_100338314 3300005539 Bacteria 1398
72 Ga0070686_100393026 3300005544 Bacteria 1053
73 Ga0070686_100508096 3300005544 Bacteria 936
74 Ga0070693_100098812 3300005547 Bacteria 1774
75 Ga0068855_100321865 3300005563 Bacteria 1709
76 Ga0070664_100004926 3300005564 Bacteria 10693
77 Ga0070664_100010745 3300005564 Bacteria 7423
78 Ga0070664_100171177 3300005564 Bacteria 1927
79 Ga0070664_100210358 3300005564 Bacteria 1738
80 Ga0070664_100368743 3300005564 Bacteria 1309
81 Ga0068857_100074414 3300005577 Bacteria 3026
82 Ga0068857_100134172 3300005577 Bacteria 2235
83 Ga0068857_100232195 3300005577 Bacteria 1687
84 Ga0068857_100337484 3300005577 Bacteria 1394
85 Ga0068856_100013282 3300005614 Bacteria 7976
86 Ga0068856_100297550 3300005614 Bacteria 1631
87 Ga0068856_100451001 3300005614 Bacteria 1307
88 Ga0068856_100940588 3300005614 Bacteria 883
89 Ga0068856_101685060 3300005614 Bacteria 646
90 Ga0068856_102300302 3300005614 Bacteria 547
91 Ga0068852_101022843 3300005616 Bacteria 845
92 Ga0068852_101027987 3300005616 Bacteria 843
93 Ga0068852_102122634 3300005616 Bacteria 584
94 Ga0068859_100064594 3300005617 Bacteria 3693
95 Ga0068864_100011038 3300005618 Bacteria 7466
96 Ga0068864_100023994 3300005618 Bacteria 5127
97 Ga0068864_100093646 3300005618 Bacteria 2654
98 Ga0068864_100353869 3300005618 Bacteria 1386
99 Ga0068863_100097332 3300005841 Bacteria 2794
100 Ga0068863_100964836 3300005841 Bacteria 854
101 Ga0068863_101211858 3300005841 Bacteria 761
102 Ga0068858_101060473 3300005842 Bacteria 795
103 Ga0068860_100322174 3300005843 Bacteria 1517
104 Ga0068860_102033603 3300005843 Bacteria 596
105 Ga0075364_10257354 3300006051 Bacteria 1186
106 Ga0070716_100412800 3300006173 Bacteria 974
107 Ga0070716_100854685 3300006173 Bacteria 709
108 Ga0070712_100038828 3300006175 Bacteria 3256
109 Ga0070712_100212734 3300006175 Unclassified 1526
110 Ga0097621_100430943 3300006237 Bacteria 1185
111 Ga0097621_100539380 3300006237 Bacteria 1061
112 Ga0097621_100587355 3300006237 Bacteria 1017
113 Ga0068871_100117227 3300006358 Bacteria 2246
114 Ga0075433_10010992 3300006852 Bacteria 7279
115 Ga0075433_10342801 3300006852 Bacteria 1321
116 Ga0075434_100002248 3300006871 Bacteria 16884
117 Ga0075434_100291643 3300006871 Bacteria 1651
118 Ga0075434_102093596 3300006871 Bacteria 570
119 Ga0068865_100113037 3300006881 Bacteria 2007
120 Ga0075436_100069431 3300006914 Bacteria 2434
121 Ga0075436_100150287 3300006914 Bacteria 1639
122 Ga0097620_100064593 3300006931 Bacteria 3693
123 Ga0075435_101374841 3300007076 Bacteria 619
124 Ga0105240_10038854 3300009093 Bacteria 6102
125 Ga0111539_11313677 3300009094 Bacteria 839
126 Ga0105245_10026542 3300009098 Bacteria 5099
127 Ga0114129_11012379 3300009147 Bacteria 1045
128 Ga0105241_10001817 3300009174 Bacteria 16199
129 Ga0105241_12102047 3300009174 Bacteria 558
130 Ga0105248_10010154 3300009177 Bacteria 10369
131 Ga0105248_10428349 3300009177 Bacteria 1490
132 Ga0105237_10094143 3300009545 Bacteria 2985
133 Ga0105237_10437898 3300009545 Bacteria 1313
134 Ga0105237_10869904 3300009545 Bacteria 908
135 Ga0105249_10051727 3300009553 Bacteria 3749
136 Ga0105239_10014730 3300010375 Bacteria 8672
137 Ga0105239_10529868 3300010375 Bacteria 1341
138 Ga0105239_10891913 3300010375 Bacteria 1020
139 Ga0105239_10974676 3300010375 Bacteria 974
140 Ga0105239_12098299 3300010375 Unclassified 657
141 Ga0105239_12492855 3300010375 Bacteria 603
142 Ga0105246_10311055 3300011119 Bacteria 1276
143 Ga0105246_11095668 3300011119 Bacteria 727
144 Ga0157313_1053562 3300012503 Bacteria 532
145 Ga0157373_10084019 3300013100 Bacteria 2244
146 Ga0157373_11495074 3300013100 Bacteria 515
147 Ga0157371_10234355 3300013102 Unclassified 1320
148 Ga0157369_10002329 3300013105 Bacteria 22857
149 Ga0157369_10024513 3300013105 Bacteria 6709
150 Ga0157369_10195714 3300013105 Bacteria 2123
151 Ga0157374_11715889 3300013296 Unclassified 653
152 Ga0163162_10024958 3300013306 Bacteria 5905
153 Ga0163162_10522431 3300013306 Bacteria 1316
154 Ga0163162_11730644 3300013306 Bacteria 714
155 Ga0163162_12135723 3300013306 Bacteria 643
156 Ga0157372_10043363 3300013307 Bacteria 4980
157 Ga0157372_10078613 3300013307 Bacteria 3728
158 Ga0157372_10190312 3300013307 Bacteria 2377
159 Ga0157372_10272387 3300013307 Bacteria 1967
160 Ga0157372_12355980 3300013307 Bacteria 611
161 Ga0157372_12676574 3300013307 Bacteria 572
162 Ga0157375_11041377 3300013308 Bacteria 956
163 Ga0163163_10039766 3300014325 Bacteria 4591
164 Ga0163163_10086956 3300014325 Bacteria 3135
165 Ga0163163_10673504 3300014325 Bacteria 1098
166 Ga0157380_11188739 3300014326 Bacteria 806
167 Ga0182008_10154891 3300014497 Bacteria 1151
168 Ga0157377_10433910 3300014745 Bacteria 903
169 Ga0157377_10609322 3300014745 Bacteria 780
170 Ga0157379_10389973 3300014968 Bacteria 1279
171 Ga0157379_12069540 3300014968 Bacteria 564
172 Ga0157376_11030532 3300014969 Bacteria 846
173 Ga0182006_1313434 3300015261 Bacteria 515
174 Ga0206356_10787821 3300020070 Bacteria 759
175 Ga0206355_1687614 3300020076 Bacteria 577
176 Ga0206352_10801691 3300020078 Bacteria 644
177 Ga0206350_11019036 3300020080 Bacteria 758
178 Ga0206354_11284312 3300020081 Bacteria 914
179 Ga0224712_10013167 3300022467 Bacteria 2625
180 Ga0224712_10194863 3300022467 Bacteria 919
181 Ga0224712_10527140 3300022467 Bacteria 573
182 Ga0207692_10081093 3300025898 Bacteria 1735
183 Ga0207710_10242441 3300025900 Bacteria 900
184 Ga0207688_10024822 3300025901 Bacteria 3288
185 Ga0207699_10515002 3300025906 Unclassified 865
186 Ga0207699_10694710 3300025906 Bacteria 744
187 Ga0207705_10067857 3300025909 Bacteria 2581
188 Ga0207705_10144629 3300025909 Bacteria 1778
189 Ga0207654_10035467 3300025911 Bacteria 2780
190 Ga0207707_10504842 3300025912 Bacteria 1031
191 Ga0207707_10790751 3300025912 Bacteria 791
192 Ga0207695_10086603 3300025913 Bacteria 3159
193 Ga0207693_10049825 3300025915 Bacteria 3289
194 Ga0207663_10733077 3300025916 Bacteria 784
195 Ga0207663_11495486 3300025916 Bacteria 544
196 Ga0207660_10159662 3300025917 Bacteria 1738
197 Ga0207660_11672099 3300025917 Bacteria 512
198 Ga0207657_10373763 3300025919 Bacteria 1123
199 Ga0207649_10546725 3300025920 Bacteria 885
200 Ga0207652_10015310 3300025921 Bacteria 6228
201 Ga0207652_10091887 3300025921 Bacteria 2669
202 Ga0207652_10504296 3300025921 Bacteria 1089
203 Ga0207694_11529757 3300025924 Bacteria 563
204 Ga0207650_10174750 3300025925 Bacteria 1709
205 Ga0207659_10453545 3300025926 Bacteria 1080
206 Ga0207687_10290902 3300025927 Bacteria 1313
207 Ga0207687_10725580 3300025927 Bacteria 845
208 Ga0207700_10209401 3300025928 Bacteria 1647
209 Ga0207700_10740049 3300025928 Bacteria 878
210 Ga0207700_11193029 3300025928 Bacteria 680
211 Ga0207664_10043974 3300025929 Bacteria 3496
212 Ga0207664_10245310 3300025929 Bacteria 1561
213 Ga0207644_10712233 3300025931 Bacteria 837
214 Ga0207644_11753408 3300025931 Bacteria 520
215 Ga0207706_10135512 3300025933 Bacteria 2166
216 Ga0207670_10348553 3300025936 Bacteria 1172
217 Ga0207669_10674146 3300025937 Bacteria 848
218 Ga0207704_10177086 3300025938 Bacteria 1537
219 Ga0207704_10545833 3300025938 Bacteria 941
220 Ga0207665_10212776 3300025939 Bacteria 1413
221 Ga0207711_10606924 3300025941 Bacteria 1021
222 Ga0207689_10001317 3300025942 Bacteria 23923
223 Ga0207661_10008544 3300025944 Bacteria 7319
224 Ga0207661_10648199 3300025944 Bacteria 970
225 Ga0207679_10006108 3300025945 Bacteria 7601
226 Ga0207679_10059888 3300025945 Bacteria 2826
227 Ga0207679_10075285 3300025945 Bacteria 2561
228 Ga0207679_10634639 3300025945 Bacteria 965
229 Ga0207679_10646645 3300025945 Bacteria 956
230 Ga0207667_10697180 3300025949 Bacteria 1018
231 Ga0207651_10209660 3300025960 Bacteria 1567
232 Ga0207712_10026197 3300025961 Unclassified 3882
233 Ga0207640_11267594 3300025981 Bacteria 657
234 Ga0207703_10347167 3300026035 Bacteria 1365
235 Ga0207639_10162299 3300026041 Bacteria 1884
236 Ga0207639_10764119 3300026041 Bacteria 899
237 Ga0207702_10004745 3300026078 Bacteria 12001
238 Ga0207702_10022912 3300026078 Bacteria 5181
239 Ga0207702_10810922 3300026078 Bacteria 925
240 Ga0207641_10053422 3300026088 Bacteria 3425
241 Ga0207641_11657649 3300026088 Bacteria 641
242 Ga0207676_10047940 3300026095 Bacteria 3314
243 Ga0207676_10074433 3300026095 Bacteria 2736
244 Ga0207676_11262309 3300026095 Bacteria 733
245 Ga0207674_10000041 3300026116 Bacteria 129439
246 Ga0207674_10043027 3300026116 Bacteria 4659
247 Ga0207674_10128964 3300026116 Bacteria 2493
248 Ga0207674_10185105 3300026116 Bacteria 2033
249 Ga0207683_10545603 3300026121 Bacteria 1072
250 Ga0207683_11188085 3300026121 Bacteria 707
251 Ga0209981_1018545 3300027378 Bacteria 986
252 Ga0209996_1056838 3300027395 Bacteria 598
253 Ga0210000_1066467 3300027462 Bacteria 586
254 Ga0209983_1058822 3300027665 Bacteria 847
255 Ga0209971_1038904 3300027682 Bacteria 1145
256 Ga0209974_10001267 3300027876 Bacteria 9074
257 Ga0209974_10059042 3300027876 Bacteria 1297
258 Ga0207428_10618506 3300027907 Bacteria 779
259 Ga0268265_10183104 3300028380 Bacteria 1802
260 Ga0268265_10210638 3300028380 Bacteria 1693
261 Ga0268264_12368793 3300028381 Bacteria 537
262 Ga0265334_10108370 3300028573 Bacteria 1000
263 Ga0265318_10008767 3300028577 Bacteria 4480
264 Ga0316575_10523892 3300031665 Bacteria 515
265 Ga0316579_10037460 3300031691 Bacteria 2240
266 Ga0316579_10039379 3300031691 Bacteria 2189
267 Ga0316579_10062779 3300031691 Bacteria 1749
268 Ga0316576_10016450 3300031727 Bacteria 4997
269 Ga0316576_10074951 3300031727 Bacteria 2502
270 Ga0316576_10262165 3300031727 Bacteria 1296
271 Ga0316576_10289642 3300031727 Bacteria 1225
272 Ga0316578_10076326 3300031728 Bacteria 1989
273 Ga0316578_10342836 3300031728 Bacteria 890
274 Ga0316577_10042720 3300031733 Bacteria 2536
275 Ga0316577_10542664 3300031733 Bacteria 661
276 Ga0307409_101225310 3300031995 Bacteria 774
277 Ga0307416_100775648 3300032002 Bacteria 1053
278 Ga0316583_10036713 3300032133 Bacteria 1737
279 Ga0316583_10078813 3300032133 Bacteria 1151
280 Ga0316580_10010574 3300032139 Bacteria 2792
281 Ga0316580_10163471 3300032139 Bacteria 684
282 Ga0316588_1088827 3300033528 Bacteria 769
283 Ga0316596_1010089 3300033541 Bacteria 2279
284 Ga0373926_0043017 3300035083 Bacteria 1616
285 Ga0373951_0059297 3300035091 Bacteria 956
286 Ga0373945_0001155 3300035116 Bacteria 8002
287 Ga0373960_0058472 3300035121 Bacteria 1163
288 Ga0373943_0012587 3300035170 Bacteria 3813
289 Ga0373943_0224780 3300035170 Bacteria 1047
290 Ga0373946_0111400 3300035171 Bacteria 1239
291 Ga0316574_0045712 3300035398 Bacteria 2712
292 Ga0316574_0199851 3300035398 Bacteria 1284
293 Ga0316574_0340855 3300035398 Bacteria 949
294 Ga0316574_0519586 3300035398 Unclassified 741
295 Ga0373935_0012499 3300035692 Bacteria 5105
296 Ga0373927_0000002 3300035695 Bacteria 966219
297 Ga0373927_0028218 3300035695 Bacteria 3661
298 Ga0373947_0019729 3300035725 Bacteria 3888
299 Ga0373947_0096668 3300035725 Bacteria 1850
300 Ga0373937_1271499 3300036401 Bacteria 684
301 Ga0316582_0009111 3300036647 Bacteria 5372
302 Ga0316582_0024540 3300036647 Bacteria 3609
303 Ga0316582_0110056 3300036647 Bacteria 1833
304 Ga0316582_0651294 3300036647 Bacteria 724
305 Ga0316584_0122066 3300036712 Bacteria 1946
306 Ga0316584_0849279 3300036712 Bacteria 617
307 Ga0373925_0034085 3300037068 Bacteria 3752
308 Ga0373925_0393958 3300037068 Bacteria 1129
309 Ga0316581_0087556 3300037588 Bacteria 959
310 Ga0395901_0348185 3300038443 Bacteria 1529
311 Ga0451807_0174739 3300041486 Bacteria 530
312 Ga0451807_2560339 3300041486 Bacteria 534
313 Ga0450914_035404 3300042118 Bacteria 617
314 Ga0451577_0000942 3300042876 Bacteria 42655
315 Ga0451577_0001172 3300042876 Bacteria 36813
316 Ga0451577_0018095 3300042876 Bacteria 6495
317 Ga0451577_0028505 3300042876 Bacteria 5049
318 Ga0451577_0268665 3300042876 Bacteria 1544
319 Ga0451577_0295409 3300042876 Bacteria 1468
320 Ga0451577_0411017 3300042876 Bacteria 1228
321 Ga0451577_0775840 3300042876 Bacteria 866
322 Ga0451577_1105754 3300042876 Bacteria 709
323 Ga0453683_0001173 3300044673 Bacteria 23651
324 Ga0453683_0059250 3300044673 Bacteria 2394
325 Ga0453683_0247200 3300044673 Bacteria 1137
326 Ga0453684_0000005 3300044712 Bacteria 1431632
327 Ga0453684_0000023 3300044712 Bacteria 857153
328 Ga0453684_0002651 3300044712 Bacteria 42717
329 Ga0453684_0011758 3300044712 Bacteria 14595
330 Ga0453684_0011772 3300044712 Bacteria 14581
331 Ga0453684_0041372 3300044712 Bacteria 6234
332 Ga0453684_0051241 3300044712 Bacteria 5415
333 Ga0453684_0051647 3300044712 Bacteria 5386
334 Ga0453684_0066736 3300044712 Bacteria 4580
335 Ga0453684_0094215 3300044712 Bacteria 3684
336 Ga0453684_0094872 3300044712 Bacteria 3668
337 Ga0453684_0102569 3300044712 Bacteria 3498
338 Ga0453684_0113831 3300044712 Bacteria 3281
339 Ga0453684_0192412 3300044712 Bacteria 2385
340 Ga0453684_0251174 3300044712 Bacteria 2031
341 Ga0453684_0278586 3300044712 Bacteria 1908
342 Ga0453684_0754418 3300044712 Bacteria 1053
343 Ga0453684_0777762 3300044712 Bacteria 1034
344 Ga0453684_0823930 3300044712 Bacteria 999
345 Ga0453684_0903317 3300044712 Unclassified 946
346 Ga0453684_0989028 3300044712 Bacteria 895
347 Ga0453684_1051160 3300044712 Bacteria 863
348 Ga0453684_1127456 3300044712 Bacteria 827
349 Ga0453684_1218015 3300044712 Bacteria 789
350 Ga0453684_1332158 3300044712 Bacteria 747
351 Ga0453684_1360648 3300044712 Bacteria 738
352 Ga0453684_1435477 3300044712 Bacteria 714
353 Ga0453684_1482377 3300044712 Bacteria 701
354 Ga0451576_0015582 3300045051 Bacteria 8415
355 Ga0451576_0054861 3300045051 Bacteria 4171
356 Ga0451576_0176509 3300045051 Bacteria 2230
357 Ga0466967_1734092 3300045976 Bacteria 622
358 Ga0495629_0005769 3300046459 Bacteria 9240
359 Ga0495629_0225889 3300046459 Bacteria 1291
360 Ga0495641_0086747 3300046461 Bacteria 1400
361 Ga0495641_0111441 3300046461 Bacteria 1221
362 Ga0495653_0190975 3300046463 Bacteria 1397
363 Ga0495582_0021833 3300046473 Bacteria 3502
364 Ga0495639_0003905 3300046475 Bacteria 6402
365 Ga0495662_0137913 3300046476 Bacteria 1200
366 Ga0495630_0087836 3300046517 Bacteria 2348
367 Ga0495665_0023025 3300046531 Bacteria 3346
368 Ga0495640_0004728 3300046533 Bacteria 10852
369 Ga0495640_0737829 3300046533 Bacteria 589
370 Ga0495634_0020306 3300046642 Bacteria 4713
371 Ga0495635_0008942 3300046663 Bacteria 6992
372 Ga0495635_0115781 3300046663 Bacteria 1830
373 Ga0495647_0012216 3300046681 Bacteria 2955
374 Ga0495647_0116447 3300046681 Bacteria 1120
375 Ga0495658_0027904 3300046683 Bacteria 3043
376 Ga0495613_0004416 3300046689 Bacteria 10535
377 Ga0495613_0007249 3300046689 Bacteria 8255
378 Ga0495624_0029925 3300046690 Bacteria 3549
379 Ga0495581_0011990 3300047315 Bacteria 5014
380 Ga0495581_0526721 3300047315 Bacteria 686
381 Ga0495674_0501090 3300047319 Bacteria 971
382 Ga0495676_0041012 3300047321 Bacteria 3814
383 Ga0495680_0003977 3300047322 Bacteria 14281
384 Ga0495680_0358879 3300047322 Bacteria 1013
385 Ga0496100_0095946 3300048903 Bacteria 2034
386 Ga0496100_1115585 3300048903 Bacteria 622
387 Ga0496101_0133359 3300048904 Bacteria 1887
388 Ga0496102_0085927 3300048905 Bacteria 2905
389 Ga0496102_0511886 3300048905 Bacteria 1123
390 Ga0496102_1418939 3300048905 Bacteria 613
391 Ga0496104_0020573 3300048907 Bacteria 6050
392 Ga0496104_0046750 3300048907 Bacteria 4077
393 Ga0496104_0636394 3300048907 Bacteria 976
394 Ga0496105_0070661 3300048908 Bacteria 2886
395 Ga0496105_0286955 3300048908 Unclassified 1326
396 Ga0496105_0397411 3300048908 Bacteria 1095
397 Ga0496105_0769063 3300048908 Bacteria 734
398 Ga0496108_0110779 3300048911 Bacteria 2347
399 Ga0496108_0296254 3300048911 Bacteria 1409
400 Ga0496108_1522182 3300048911 Bacteria 556
401 Ga0496109_0194653 3300048912 Bacteria 1905
402 Ga0496109_0576057 3300048912 Bacteria 1061
403 Ga0496109_1011663 3300048912 Bacteria 769
404 Ga0496110_0065332 3300048913 Bacteria 3216
405 Ga0496110_0151540 3300048913 Bacteria 2100
406 Ga0496110_0469876 3300048913 Bacteria 1146
407 Ga0496110_0481392 3300048913 Bacteria 1131
408 Ga0496111_0011688 3300048914 Bacteria 5926
409 Ga0496111_0123439 3300048914 Bacteria 1914
410 Ga0496111_0307161 3300048914 Bacteria 1176
411 Ga0496111_0406435 3300048914 Bacteria 1006
412 Ga0496111_0716013 3300048914 Bacteria 727
413 Ga0496112_0018917 3300048915 Bacteria 6490
414 Ga0496112_0211216 3300048915 Bacteria 1898
415 Ga0496113_0026758 3300048916 Bacteria 4127
416 Ga0496113_0257972 3300048916 Bacteria 1392
417 Ga0496113_0357401 3300048916 Bacteria 1172
418 Ga0496113_0499006 3300048916 Bacteria 977
419 Ga0496114_0546469 3300048917 Bacteria 1024
420 Ga0496114_0709724 3300048917 Bacteria 881
421 Ga0496115_0215346 3300048918 Bacteria 1586
422 Ga0501034_0475536 3300049571 Bacteria 1165
423 Ga0501072_1087244 3300049588 Unclassified 622
424 nmdc:mga0yw44_88592_c1 3300050492 Bacteria 1951
425 nmdc:mga05p37_110115_c1 3300050507 Bacteria 3388
426 nmdc:mga05p37_653029_c1 3300050507 Bacteria 1177
427 nmdc:mga08y16_172973_c1 3300050511 Bacteria 2243
428 nmdc:mga0n895_286869_c1 3300050512 Bacteria 1669
429 nmdc:mga0rr50_560554_c1 3300050513 Bacteria 973
430 nmdc:mga0a205_407031_c1 3300050515 Bacteria 1224
431 nmdc:mga0a205_67112_c1 3300050515 Bacteria 3465
432 nmdc:mga0a205_764524_c1 3300050515 Bacteria 814
433 Ga0495619_0012084 3300053085 Bacteria 5439
434 Ga0495619_0284446 3300053085 Bacteria 1146
435 Ga0500559_0099947 3300053136 Bacteria 1336

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031995 Ga0307409_101225310 Ga0307409_1012253101 105
2 3300050513 nmdc:mga0rr50_560554_c1 nmdc:mga0rr50_560554_c1_447_812 106
3 3300035398 Ga0316574_0199851 Ga0316574_0199851_128_490 109
4 3300031665 Ga0316575_10523892 Ga0316575_105238921 111
5 3300005329 Ga0070683_101045243 Ga0070683_1010452431 112
6 3300005354 Ga0070675_100336968 Ga0070675_1003369683 112
7 3300005355 Ga0070671_101203795 Ga0070671_1012037952 112
8 3300005544 Ga0070686_100508096 Ga0070686_1005080963 112
9 3300005614 Ga0068856_100297550 Ga0068856_1002975504 112
10 3300005614 Ga0068856_100940588 Ga0068856_1009405881 112
11 3300006051 Ga0075364_10257354 Ga0075364_102573541 112
12 3300009093 Ga0105240_10038854 Ga0105240_100388546 112
13 3300009147 Ga0114129_11012379 Ga0114129_110123792 112
14 3300010375 Ga0105239_10529868 Ga0105239_105298683 112
15 3300010375 Ga0105239_10891913 Ga0105239_108919132 112
16 3300010375 Ga0105239_12098299 Ga0105239_120982992 112
17 3300013306 Ga0163162_12135723 Ga0163162_121357232 112
18 3300013307 Ga0157372_10190312 Ga0157372_101903122 112
19 3300025913 Ga0207695_10086603 Ga0207695_100866031 112
20 3300025919 Ga0207657_10373763 Ga0207657_103737632 112
21 3300027378 Ga0209981_1018545 Ga0209981_10185452 112
22 3300027462 Ga0210000_1066467 Ga0210000_10664671 112
23 3300027665 Ga0209983_1058822 Ga0209983_10588221 112
24 3300027682 Ga0209971_1038904 Ga0209971_10389042 112
25 3300027876 Ga0209974_10001267 Ga0209974_100012676 112
26 3300042118 Ga0450914_035404 Ga0450914_035404_78_461 112
27 3300044673 Ga0453683_0247200 Ga0453683_0247200_685_1026 112
28 3300044712 Ga0453684_0251174 Ga0453684_0251174_1236_1577 112
29 3300045976 Ga0466967_1734092 Ga0466967_1734092_64_423 112
30 3300046689 Ga0495613_0004416 Ga0495613_0004416_8146_8487 112
31 3300048914 Ga0496111_0307161 Ga0496111_0307161_100_441 112
32 3300048916 Ga0496113_0499006 Ga0496113_0499006_593_934 112
33 3300049571 Ga0501034_0475536 Ga0501034_0475536_643_984 112
34 3300049588 Ga0501072_1087244 Ga0501072_1087244_198_539 112
35 3300050507 nmdc:mga05p37_653029_c1 nmdc:mga05p37_653029_c1_164_505 112
36 3300005327 Ga0070658_10029041 Ga0070658_100290412 113
37 3300005327 Ga0070658_10944667 Ga0070658_109446671 113
38 3300005329 Ga0070683_100007175 Ga0070683_1000071752 113
39 3300005329 Ga0070683_100095714 Ga0070683_1000957143 113
40 3300005329 Ga0070683_100405950 Ga0070683_1004059502 113
41 3300005329 Ga0070683_100474494 Ga0070683_1004744942 113
42 3300005330 Ga0070690_100307622 Ga0070690_1003076222 113
43 3300005331 Ga0070670_100053702 Ga0070670_1000537024 113
44 3300005331 Ga0070670_101585253 Ga0070670_1015852531 113
45 3300005336 Ga0070680_100146335 Ga0070680_1001463351 113
46 3300005336 Ga0070680_100447007 Ga0070680_1004470072 113
47 3300005336 Ga0070680_101640484 Ga0070680_1016404842 113
48 3300005337 Ga0070682_100889164 Ga0070682_1008891641 113
49 3300005337 Ga0070682_101536070 Ga0070682_1015360701 113
50 3300005338 Ga0068868_101666753 Ga0068868_1016667531 113
51 3300005339 Ga0070660_100019046 Ga0070660_1000190464 113
52 3300005339 Ga0070660_100058294 Ga0070660_1000582942 113
53 3300005341 Ga0070691_10013536 Ga0070691_100135363 113
54 3300005343 Ga0070687_100049015 Ga0070687_1000490153 113
55 3300005343 Ga0070687_101491337 Ga0070687_1014913371 113
56 3300005344 Ga0070661_100240574 Ga0070661_1002405742 113
57 3300005344 Ga0070661_101088415 Ga0070661_1010884151 113
58 3300005353 Ga0070669_100150539 Ga0070669_1001505393 113
59 3300005354 Ga0070675_100873011 Ga0070675_1008730112 113
60 3300005355 Ga0070671_100797447 Ga0070671_1007974471 113
61 3300005355 Ga0070671_101318150 Ga0070671_1013181501 113
62 3300005356 Ga0070674_100754225 Ga0070674_1007542252 113
63 3300005364 Ga0070673_102288716 Ga0070673_1022887161 113
64 3300005434 Ga0070709_10069387 Ga0070709_100693872 113
65 3300005434 Ga0070709_10747811 Ga0070709_107478112 113
66 3300005435 Ga0070714_100001701 Ga0070714_1000017012 113
67 3300005435 Ga0070714_100005662 Ga0070714_1000056622 113
68 3300005435 Ga0070714_100962937 Ga0070714_1009629371 113
69 3300005435 Ga0070714_101150810 Ga0070714_1011508102 113
70 3300005436 Ga0070713_100428966 Ga0070713_1004289662 113
71 3300005436 Ga0070713_100591021 Ga0070713_1005910212 113
72 3300005436 Ga0070713_100995306 Ga0070713_1009953061 113
73 3300005436 Ga0070713_101766995 Ga0070713_1017669952 113
74 3300005438 Ga0070701_10115560 Ga0070701_101155603 113
75 3300005439 Ga0070711_100111507 Ga0070711_1001115072 113
76 3300005439 Ga0070711_101437426 Ga0070711_1014374261 113
77 3300005440 Ga0070705_101323148 Ga0070705_1013231482 113
78 3300005441 Ga0070700_100115146 Ga0070700_1001151462 113
79 3300005444 Ga0070694_100422395 Ga0070694_1004223952 113
80 3300005456 Ga0070678_100577708 Ga0070678_1005777082 113
81 3300005456 Ga0070678_101189112 Ga0070678_1011891121 113
82 3300005457 Ga0070662_100389673 Ga0070662_1003896732 113
83 3300005458 Ga0070681_10014471 Ga0070681_100144715 113
84 3300005458 Ga0070681_10088346 Ga0070681_100883463 113
85 3300005458 Ga0070681_10331709 Ga0070681_103317091 113
86 3300005458 Ga0070681_11513503 Ga0070681_115135031 113
87 3300005468 Ga0070707_102350276 Ga0070707_1023502761 113
88 3300005471 Ga0070698_102128972 Ga0070698_1021289721 113
89 3300005530 Ga0070679_100017458 Ga0070679_1000174587 113
90 3300005530 Ga0070679_100101399 Ga0070679_1001013994 113
91 3300005530 Ga0070679_100241818 Ga0070679_1002418182 113
92 3300005530 Ga0070679_100385462 Ga0070679_1003854622 113
93 3300005530 Ga0070679_101253125 Ga0070679_1012531252 113
94 3300005535 Ga0070684_100000501 Ga0070684_1000005012 113
95 3300005535 Ga0070684_100004104 Ga0070684_1000041044 113
96 3300005535 Ga0070684_100046295 Ga0070684_1000462954 113
97 3300005535 Ga0070684_100120086 Ga0070684_1001200864 113
98 3300005535 Ga0070684_100456681 Ga0070684_1004566812 113
99 3300005535 Ga0070684_100694502 Ga0070684_1006945022 113
100 3300005539 Ga0068853_100060417 Ga0068853_1000604174 113
101 3300005539 Ga0068853_100243209 Ga0068853_1002432093 113
102 3300005539 Ga0068853_100338314 Ga0068853_1003383141 113
103 3300005544 Ga0070686_100393026 Ga0070686_1003930262 113
104 3300005547 Ga0070693_100098812 Ga0070693_1000988124 113
105 3300005563 Ga0068855_100321865 Ga0068855_1003218653 113
106 3300005564 Ga0070664_100004926 Ga0070664_1000049262 113
107 3300005564 Ga0070664_100010745 Ga0070664_1000107452 113
108 3300005564 Ga0070664_100171177 Ga0070664_1001711772 113
109 3300005564 Ga0070664_100210358 Ga0070664_1002103582 113
110 3300005564 Ga0070664_100368743 Ga0070664_1003687432 113
111 3300005577 Ga0068857_100074414 Ga0068857_1000744142 113
112 3300005577 Ga0068857_100134172 Ga0068857_1001341723 113
113 3300005577 Ga0068857_100232195 Ga0068857_1002321952 113
114 3300005577 Ga0068857_100337484 Ga0068857_1003374842 113
115 3300005614 Ga0068856_100013282 Ga0068856_1000132827 113
116 3300005614 Ga0068856_100451001 Ga0068856_1004510012 113
117 3300005614 Ga0068856_101685060 Ga0068856_1016850602 113
118 3300005614 Ga0068856_102300302 Ga0068856_1023003021 113
119 3300005616 Ga0068852_101022843 Ga0068852_1010228432 113
120 3300005616 Ga0068852_101027987 Ga0068852_1010279872 113
121 3300005616 Ga0068852_102122634 Ga0068852_1021226341 113
122 3300005617 Ga0068859_100064594 Ga0068859_1000645941 113
123 3300005618 Ga0068864_100011038 Ga0068864_1000110386 113
124 3300005618 Ga0068864_100023994 Ga0068864_1000239947 113
125 3300005618 Ga0068864_100093646 Ga0068864_1000936462 113
126 3300005618 Ga0068864_100353869 Ga0068864_1003538692 113
127 3300005841 Ga0068863_100097332 Ga0068863_1000973323 113
128 3300005841 Ga0068863_100964836 Ga0068863_1009648362 113
129 3300005841 Ga0068863_101211858 Ga0068863_1012118581 113
130 3300005842 Ga0068858_101060473 Ga0068858_1010604732 113
131 3300005843 Ga0068860_100322174 Ga0068860_1003221742 113
132 3300005843 Ga0068860_102033603 Ga0068860_1020336032 113
133 3300006173 Ga0070716_100412800 Ga0070716_1004128002 113
134 3300006173 Ga0070716_100854685 Ga0070716_1008546852 113
135 3300006175 Ga0070712_100038828 Ga0070712_1000388282 113
136 3300006175 Ga0070712_100212734 Ga0070712_1002127341 113
137 3300006237 Ga0097621_100430943 Ga0097621_1004309432 113
138 3300006237 Ga0097621_100539380 Ga0097621_1005393802 113
139 3300006237 Ga0097621_100587355 Ga0097621_1005873552 113
140 3300006358 Ga0068871_100117227 Ga0068871_1001172273 113
141 3300006852 Ga0075433_10010992 Ga0075433_100109929 113
142 3300006852 Ga0075433_10342801 Ga0075433_103428012 113
143 3300006871 Ga0075434_100002248 Ga0075434_10000224816 113
144 3300006871 Ga0075434_100291643 Ga0075434_1002916432 113
145 3300006871 Ga0075434_102093596 Ga0075434_1020935961 113
146 3300006881 Ga0068865_100113037 Ga0068865_1001130374 113
147 3300006914 Ga0075436_100069431 Ga0075436_1000694315 113
148 3300006914 Ga0075436_100150287 Ga0075436_1001502873 113
149 3300006931 Ga0097620_100064593 Ga0097620_1000645931 113
150 3300007076 Ga0075435_101374841 Ga0075435_1013748411 113
151 3300009094 Ga0111539_11313677 Ga0111539_113136772 113
152 3300009098 Ga0105245_10026542 Ga0105245_100265424 113
153 3300009174 Ga0105241_10001817 Ga0105241_100018178 113
154 3300009174 Ga0105241_12102047 Ga0105241_121020471 113
155 3300009177 Ga0105248_10010154 Ga0105248_100101548 113
156 3300009177 Ga0105248_10428349 Ga0105248_104283493 113
157 3300009545 Ga0105237_10094143 Ga0105237_100941434 113
158 3300009545 Ga0105237_10437898 Ga0105237_104378982 113
159 3300009545 Ga0105237_10869904 Ga0105237_108699042 113
160 3300009553 Ga0105249_10051727 Ga0105249_100517275 113
161 3300010375 Ga0105239_10014730 Ga0105239_100147306 113
162 3300010375 Ga0105239_10974676 Ga0105239_109746762 113
163 3300010375 Ga0105239_12492855 Ga0105239_124928551 113
164 3300011119 Ga0105246_10311055 Ga0105246_103110553 113
165 3300011119 Ga0105246_11095668 Ga0105246_110956682 113
166 3300012503 Ga0157313_1053562 Ga0157313_10535621 113
167 3300013100 Ga0157373_10084019 Ga0157373_100840192 113
168 3300013100 Ga0157373_11495074 Ga0157373_114950742 113
169 3300013102 Ga0157371_10234355 Ga0157371_102343552 113
170 3300013105 Ga0157369_10002329 Ga0157369_100023293 113
171 3300013105 Ga0157369_10024513 Ga0157369_100245137 113
172 3300013105 Ga0157369_10195714 Ga0157369_101957145 113
173 3300013296 Ga0157374_11715889 Ga0157374_117158892 113
174 3300013306 Ga0163162_10024958 Ga0163162_100249585 113
175 3300013306 Ga0163162_10522431 Ga0163162_105224311 113
176 3300013306 Ga0163162_11730644 Ga0163162_117306441 113
177 3300013307 Ga0157372_10043363 Ga0157372_100433638 113
178 3300013307 Ga0157372_10078613 Ga0157372_100786134 113
179 3300013307 Ga0157372_10272387 Ga0157372_102723872 113
180 3300013307 Ga0157372_12355980 Ga0157372_123559801 113
181 3300013307 Ga0157372_12676574 Ga0157372_126765741 113
182 3300013308 Ga0157375_11041377 Ga0157375_110413772 113
183 3300014325 Ga0163163_10039766 Ga0163163_100397663 113
184 3300014325 Ga0163163_10086956 Ga0163163_100869563 113
185 3300014325 Ga0163163_10673504 Ga0163163_106735042 113
186 3300014326 Ga0157380_11188739 Ga0157380_111887392 113
187 3300014497 Ga0182008_10154891 Ga0182008_101548912 113
188 3300014745 Ga0157377_10433910 Ga0157377_104339101 113
189 3300014745 Ga0157377_10609322 Ga0157377_106093222 113
190 3300014968 Ga0157379_10389973 Ga0157379_103899732 113
191 3300014968 Ga0157379_12069540 Ga0157379_120695402 113
192 3300014969 Ga0157376_11030532 Ga0157376_110305322 113
193 3300015261 Ga0182006_1313434 Ga0182006_13134341 113
194 3300020070 Ga0206356_10787821 Ga0206356_107878211 113
195 3300020076 Ga0206355_1687614 Ga0206355_16876141 113
196 3300020078 Ga0206352_10801691 Ga0206352_108016911 113
197 3300020080 Ga0206350_11019036 Ga0206350_110190361 113
198 3300020081 Ga0206354_11284312 Ga0206354_112843121 113
199 3300022467 Ga0224712_10013167 Ga0224712_100131671 113
200 3300022467 Ga0224712_10194863 Ga0224712_101948632 113
201 3300022467 Ga0224712_10527140 Ga0224712_105271402 113
202 3300025898 Ga0207692_10081093 Ga0207692_100810932 113
203 3300025900 Ga0207710_10242441 Ga0207710_102424412 113
204 3300025901 Ga0207688_10024822 Ga0207688_100248222 113
205 3300025906 Ga0207699_10515002 Ga0207699_105150022 113
206 3300025906 Ga0207699_10694710 Ga0207699_106947102 113
207 3300025909 Ga0207705_10067857 Ga0207705_100678572 113
208 3300025909 Ga0207705_10144629 Ga0207705_101446292 113
209 3300025911 Ga0207654_10035467 Ga0207654_100354672 113
210 3300025912 Ga0207707_10504842 Ga0207707_105048422 113
211 3300025912 Ga0207707_10790751 Ga0207707_107907512 113
212 3300025915 Ga0207693_10049825 Ga0207693_100498252 113
213 3300025916 Ga0207663_10733077 Ga0207663_107330772 113
214 3300025916 Ga0207663_11495486 Ga0207663_114954861 113
215 3300025917 Ga0207660_10159662 Ga0207660_101596622 113
216 3300025917 Ga0207660_11672099 Ga0207660_116720991 113
217 3300025920 Ga0207649_10546725 Ga0207649_105467252 113
218 3300025921 Ga0207652_10015310 Ga0207652_100153102 113
219 3300025921 Ga0207652_10091887 Ga0207652_100918875 113
220 3300025921 Ga0207652_10504296 Ga0207652_105042962 113
221 3300025924 Ga0207694_11529757 Ga0207694_115297571 113
222 3300025925 Ga0207650_10174750 Ga0207650_101747502 113
223 3300025926 Ga0207659_10453545 Ga0207659_104535452 113
224 3300025927 Ga0207687_10290902 Ga0207687_102909023 113
225 3300025927 Ga0207687_10725580 Ga0207687_107255802 113
226 3300025928 Ga0207700_10209401 Ga0207700_102094013 113
227 3300025928 Ga0207700_10740049 Ga0207700_107400492 113
228 3300025928 Ga0207700_11193029 Ga0207700_111930292 113
229 3300025929 Ga0207664_10043974 Ga0207664_100439742 113
230 3300025929 Ga0207664_10245310 Ga0207664_102453102 113
231 3300025931 Ga0207644_10712233 Ga0207644_107122331 113
232 3300025931 Ga0207644_11753408 Ga0207644_117534081 113
233 3300025933 Ga0207706_10135512 Ga0207706_101355124 113
234 3300025936 Ga0207670_10348553 Ga0207670_103485531 113
235 3300025937 Ga0207669_10674146 Ga0207669_106741462 113
236 3300025938 Ga0207704_10177086 Ga0207704_101770863 113
237 3300025938 Ga0207704_10545833 Ga0207704_105458332 113
238 3300025939 Ga0207665_10212776 Ga0207665_102127763 113
239 3300025941 Ga0207711_10606924 Ga0207711_106069242 113
240 3300025942 Ga0207689_10001317 Ga0207689_1000131723 113
241 3300025944 Ga0207661_10008544 Ga0207661_100085442 113
242 3300025944 Ga0207661_10648199 Ga0207661_106481991 113
243 3300025945 Ga0207679_10006108 Ga0207679_100061088 113
244 3300025945 Ga0207679_10059888 Ga0207679_100598881 113
245 3300025945 Ga0207679_10075285 Ga0207679_100752852 113
246 3300025945 Ga0207679_10634639 Ga0207679_106346391 113
247 3300025945 Ga0207679_10646645 Ga0207679_106466452 113
248 3300025949 Ga0207667_10697180 Ga0207667_106971802 113
249 3300025960 Ga0207651_10209660 Ga0207651_102096601 113
250 3300025961 Ga0207712_10026197 Ga0207712_100261974 113
251 3300025981 Ga0207640_11267594 Ga0207640_112675941 113
252 3300026035 Ga0207703_10347167 Ga0207703_103471672 113
253 3300026041 Ga0207639_10162299 Ga0207639_101622992 113
254 3300026041 Ga0207639_10764119 Ga0207639_107641192 113
255 3300026078 Ga0207702_10004745 Ga0207702_100047451 113
256 3300026078 Ga0207702_10022912 Ga0207702_100229122 113
257 3300026078 Ga0207702_10810922 Ga0207702_108109222 113
258 3300026088 Ga0207641_10053422 Ga0207641_100534223 113
259 3300026088 Ga0207641_11657649 Ga0207641_116576491 113
260 3300026095 Ga0207676_10047940 Ga0207676_100479402 113
261 3300026095 Ga0207676_10074433 Ga0207676_100744334 113
262 3300026095 Ga0207676_11262309 Ga0207676_112623091 113
263 3300026116 Ga0207674_10000041 Ga0207674_1000004115 113
264 3300026116 Ga0207674_10043027 Ga0207674_100430277 113
265 3300026116 Ga0207674_10128964 Ga0207674_101289642 113
266 3300026116 Ga0207674_10185105 Ga0207674_101851053 113
267 3300026121 Ga0207683_10545603 Ga0207683_105456032 113
268 3300026121 Ga0207683_11188085 Ga0207683_111880852 113
269 3300027395 Ga0209996_1056838 Ga0209996_10568381 113
270 3300027876 Ga0209974_10059042 Ga0209974_100590422 113
271 3300027907 Ga0207428_10618506 Ga0207428_106185061 113
272 3300028380 Ga0268265_10183104 Ga0268265_101831042 113
273 3300028380 Ga0268265_10210638 Ga0268265_102106382 113
274 3300028381 Ga0268264_12368793 Ga0268264_123687932 113
275 3300028573 Ga0265334_10108370 Ga0265334_101083702 113
276 3300028577 Ga0265318_10008767 Ga0265318_100087674 113
277 3300031691 Ga0316579_10037460 Ga0316579_100374604 113
278 3300031691 Ga0316579_10039379 Ga0316579_100393792 113
279 3300031691 Ga0316579_10062779 Ga0316579_100627793 113
280 3300031727 Ga0316576_10016450 Ga0316576_100164502 113
281 3300031727 Ga0316576_10074951 Ga0316576_100749513 113
282 3300031727 Ga0316576_10262165 Ga0316576_102621651 113
283 3300031727 Ga0316576_10289642 Ga0316576_102896422 113
284 3300031728 Ga0316578_10076326 Ga0316578_100763263 113
285 3300031728 Ga0316578_10342836 Ga0316578_103428361 113
286 3300031733 Ga0316577_10042720 Ga0316577_100427204 113
287 3300031733 Ga0316577_10542664 Ga0316577_105426642 113
288 3300032002 Ga0307416_100775648 Ga0307416_1007756481 113
289 3300032133 Ga0316583_10036713 Ga0316583_100367134 113
290 3300032133 Ga0316583_10078813 Ga0316583_100788132 113
291 3300032139 Ga0316580_10010574 Ga0316580_100105741 113
292 3300032139 Ga0316580_10163471 Ga0316580_101634711 113
293 3300033528 Ga0316588_1088827 Ga0316588_10888271 113
294 3300033541 Ga0316596_1010089 Ga0316596_10100892 113
295 3300035083 Ga0373926_0043017 Ga0373926_0043017_684_1058 113
296 3300035091 Ga0373951_0059297 Ga0373951_0059297_421_765 113
297 3300035116 Ga0373945_0001155 Ga0373945_0001155_2008_2382 113
298 3300035121 Ga0373960_0058472 Ga0373960_0058472_686_1030 113
299 3300035170 Ga0373943_0012587 Ga0373943_0012587_3021_3395 113
300 3300035170 Ga0373943_0224780 Ga0373943_0224780_132_476 113
301 3300035171 Ga0373946_0111400 Ga0373946_0111400_464_838 113
302 3300035398 Ga0316574_0045712 Ga0316574_0045712_2072_2416 113
303 3300035398 Ga0316574_0340855 Ga0316574_0340855_371_715 113
304 3300035398 Ga0316574_0519586 Ga0316574_0519586_53_397 113
305 3300035692 Ga0373935_0012499 Ga0373935_0012499_2791_3165 113
306 3300035695 Ga0373927_0000002 Ga0373927_0000002_347748_348092 113
307 3300035695 Ga0373927_0028218 Ga0373927_0028218_2855_3229 113
308 3300035725 Ga0373947_0019729 Ga0373947_0019729_2957_3331 113
309 3300035725 Ga0373947_0096668 Ga0373947_0096668_1141_1485 113
310 3300036401 Ga0373937_1271499 Ga0373937_1271499_188_532 113
311 3300036647 Ga0316582_0009111 Ga0316582_0009111_888_1232 113
312 3300036647 Ga0316582_0024540 Ga0316582_0024540_1039_1383 113
313 3300036647 Ga0316582_0110056 Ga0316582_0110056_943_1287 113
314 3300036647 Ga0316582_0651294 Ga0316582_0651294_269_613 113
315 3300036712 Ga0316584_0122066 Ga0316584_0122066_84_428 113
316 3300036712 Ga0316584_0849279 Ga0316584_0849279_212_556 113
317 3300037068 Ga0373925_0034085 Ga0373925_0034085_2956_3330 113
318 3300037068 Ga0373925_0393958 Ga0373925_0393958_119_463 113
319 3300037588 Ga0316581_0087556 Ga0316581_0087556_272_616 113
320 3300041486 Ga0451807_0174739 Ga0451807_0174739_37_381 113
321 3300041486 Ga0451807_2560339 Ga0451807_2560339_53_397 113
322 3300042876 Ga0451577_0000942 Ga0451577_0000942_8092_8436 113
323 3300042876 Ga0451577_0001172 Ga0451577_0001172_28583_28927 113
324 3300042876 Ga0451577_0018095 Ga0451577_0018095_2109_2453 113
325 3300042876 Ga0451577_0028505 Ga0451577_0028505_4176_4520 113
326 3300042876 Ga0451577_0268665 Ga0451577_0268665_1091_1468 113
327 3300042876 Ga0451577_0295409 Ga0451577_0295409_715_1059 113
328 3300042876 Ga0451577_0411017 Ga0451577_0411017_674_1018 113
329 3300042876 Ga0451577_0775840 Ga0451577_0775840_210_554 113
330 3300042876 Ga0451577_1105754 Ga0451577_1105754_57_401 113
331 3300044673 Ga0453683_0001173 Ga0453683_0001173_6663_7010 113
332 3300044673 Ga0453683_0059250 Ga0453683_0059250_1111_1455 113
333 3300044712 Ga0453684_0000005 Ga0453684_0000005_642244_642588 113
334 3300044712 Ga0453684_0000023 Ga0453684_0000023_273285_273629 113
335 3300044712 Ga0453684_0002651 Ga0453684_0002651_8045_8389 113
336 3300044712 Ga0453684_0011758 Ga0453684_0011758_13833_14177 113
337 3300044712 Ga0453684_0011772 Ga0453684_0011772_13190_13534 113
338 3300044712 Ga0453684_0041372 Ga0453684_0041372_512_856 113
339 3300044712 Ga0453684_0051241 Ga0453684_0051241_368_712 113
340 3300044712 Ga0453684_0051647 Ga0453684_0051647_230_574 113
341 3300044712 Ga0453684_0066736 Ga0453684_0066736_194_538 113
342 3300044712 Ga0453684_0094215 Ga0453684_0094215_671_1015 113
343 3300044712 Ga0453684_0094872 Ga0453684_0094872_907_1251 113
344 3300044712 Ga0453684_0102569 Ga0453684_0102569_2594_2938 113
345 3300044712 Ga0453684_0113831 Ga0453684_0113831_275_622 113
346 3300044712 Ga0453684_0192412 Ga0453684_0192412_1899_2243 113
347 3300044712 Ga0453684_0278586 Ga0453684_0278586_846_1190 113
348 3300044712 Ga0453684_0754418 Ga0453684_0754418_686_1039 113
349 3300044712 Ga0453684_0777762 Ga0453684_0777762_651_995 113
350 3300044712 Ga0453684_0823930 Ga0453684_0823930_24_368 113
351 3300044712 Ga0453684_0903317 Ga0453684_0903317_306_650 113
352 3300044712 Ga0453684_0989028 Ga0453684_0989028_263_607 113
353 3300044712 Ga0453684_1051160 Ga0453684_1051160_309_677 113
354 3300044712 Ga0453684_1127456 Ga0453684_1127456_304_648 113
355 3300044712 Ga0453684_1218015 Ga0453684_1218015_345_692 113
356 3300044712 Ga0453684_1332158 Ga0453684_1332158_281_625 113
357 3300044712 Ga0453684_1360648 Ga0453684_1360648_174_518 113
358 3300044712 Ga0453684_1435477 Ga0453684_1435477_284_628 113
359 3300044712 Ga0453684_1482377 Ga0453684_1482377_299_643 113
360 3300045051 Ga0451576_0015582 Ga0451576_0015582_3904_4251 113
361 3300045051 Ga0451576_0054861 Ga0451576_0054861_850_1194 113
362 3300045051 Ga0451576_0176509 Ga0451576_0176509_285_629 113
363 3300046459 Ga0495629_0005769 Ga0495629_0005769_406_780 113
364 3300046459 Ga0495629_0225889 Ga0495629_0225889_216_560 113
365 3300046461 Ga0495641_0086747 Ga0495641_0086747_368_742 113
366 3300046461 Ga0495641_0111441 Ga0495641_0111441_345_689 113
367 3300046463 Ga0495653_0190975 Ga0495653_0190975_639_983 113
368 3300046473 Ga0495582_0021833 Ga0495582_0021833_285_659 113
369 3300046475 Ga0495639_0003905 Ga0495639_0003905_5596_5970 113
370 3300046476 Ga0495662_0137913 Ga0495662_0137913_287_661 113
371 3300046517 Ga0495630_0087836 Ga0495630_0087836_370_744 113
372 3300046531 Ga0495665_0023025 Ga0495665_0023025_429_803 113
373 3300046533 Ga0495640_0004728 Ga0495640_0004728_1230_1604 113
374 3300046533 Ga0495640_0737829 Ga0495640_0737829_191_535 113
375 3300046642 Ga0495634_0020306 Ga0495634_0020306_450_824 113
376 3300046663 Ga0495635_0008942 Ga0495635_0008942_3763_4137 113
377 3300046663 Ga0495635_0115781 Ga0495635_0115781_673_1017 113
378 3300046681 Ga0495647_0012216 Ga0495647_0012216_46_390 113
379 3300046681 Ga0495647_0116447 Ga0495647_0116447_377_721 113
380 3300046683 Ga0495658_0027904 Ga0495658_0027904_2198_2572 113
381 3300046689 Ga0495613_0007249 Ga0495613_0007249_2832_3206 113
382 3300046690 Ga0495624_0029925 Ga0495624_0029925_2839_3213 113
383 3300047315 Ga0495581_0011990 Ga0495581_0011990_2828_3202 113
384 3300047315 Ga0495581_0526721 Ga0495581_0526721_264_608 113
385 3300047319 Ga0495674_0501090 Ga0495674_0501090_584_928 113
386 3300047321 Ga0495676_0041012 Ga0495676_0041012_3021_3395 113
387 3300047322 Ga0495680_0003977 Ga0495680_0003977_13486_13860 113
388 3300047322 Ga0495680_0358879 Ga0495680_0358879_561_905 113
389 3300048903 Ga0496100_0095946 Ga0496100_0095946_1555_1911 113
390 3300048903 Ga0496100_1115585 Ga0496100_1115585_237_581 113
391 3300048904 Ga0496101_0133359 Ga0496101_0133359_204_548 113
392 3300048905 Ga0496102_0511886 Ga0496102_0511886_46_390 113
393 3300048905 Ga0496102_1418939 Ga0496102_1418939_179_523 113
394 3300048907 Ga0496104_0020573 Ga0496104_0020573_3396_3794 113
395 3300048907 Ga0496104_0046750 Ga0496104_0046750_1741_2085 113
396 3300048907 Ga0496104_0636394 Ga0496104_0636394_328_672 113
397 3300048908 Ga0496105_0070661 Ga0496105_0070661_2071_2469 113
398 3300048908 Ga0496105_0286955 Ga0496105_0286955_92_436 113
399 3300048908 Ga0496105_0397411 Ga0496105_0397411_619_963 113
400 3300048908 Ga0496105_0769063 Ga0496105_0769063_216_590 113
401 3300048911 Ga0496108_0110779 Ga0496108_0110779_499_843 113
402 3300048911 Ga0496108_0296254 Ga0496108_0296254_308_652 113
403 3300048911 Ga0496108_1522182 Ga0496108_1522182_85_459 113
404 3300048912 Ga0496109_0194653 Ga0496109_0194653_115_513 113
405 3300048912 Ga0496109_0576057 Ga0496109_0576057_497_841 113
406 3300048912 Ga0496109_1011663 Ga0496109_1011663_318_662 113
407 3300048913 Ga0496110_0065332 Ga0496110_0065332_2837_3181 113
408 3300048913 Ga0496110_0151540 Ga0496110_0151540_349_693 113
409 3300048913 Ga0496110_0469876 Ga0496110_0469876_254_598 113
410 3300048913 Ga0496110_0481392 Ga0496110_0481392_324_668 113
411 3300048914 Ga0496111_0011688 Ga0496111_0011688_3331_3675 113
412 3300048914 Ga0496111_0123439 Ga0496111_0123439_452_796 113
413 3300048914 Ga0496111_0716013 Ga0496111_0716013_150_494 113
414 3300048915 Ga0496112_0018917 Ga0496112_0018917_3493_3837 113
415 3300048915 Ga0496112_0211216 Ga0496112_0211216_1463_1837 113
416 3300048916 Ga0496113_0026758 Ga0496113_0026758_2023_2367 113
417 3300048916 Ga0496113_0257972 Ga0496113_0257972_149_493 113
418 3300048916 Ga0496113_0357401 Ga0496113_0357401_470_814 113
419 3300048917 Ga0496114_0546469 Ga0496114_0546469_427_792 113
420 3300048917 Ga0496114_0709724 Ga0496114_0709724_43_387 113
421 3300048918 Ga0496115_0215346 Ga0496115_0215346_156_500 113
422 3300050492 nmdc:mga0yw44_88592_c1 nmdc:mga0yw44_88592_c1_219_563 113
423 3300050507 nmdc:mga05p37_110115_c1 nmdc:mga05p37_110115_c1_1398_1742 113
424 3300050511 nmdc:mga08y16_172973_c1 nmdc:mga08y16_172973_c1_242_586 113
425 3300050512 nmdc:mga0n895_286869_c1 nmdc:mga0n895_286869_c1_61_405 113
426 3300050515 nmdc:mga0a205_407031_c1 nmdc:mga0a205_407031_c1_414_788 113
427 3300050515 nmdc:mga0a205_67112_c1 nmdc:mga0a205_67112_c1_2326_2670 113
428 3300050515 nmdc:mga0a205_764524_c1 nmdc:mga0a205_764524_c1_19_441 113
429 3300053085 Ga0495619_0012084 Ga0495619_0012084_4269_4643 113
430 3300053085 Ga0495619_0284446 Ga0495619_0284446_778_1122 113
431 3300053136 Ga0500559_0099947 Ga0500559_0099947_670_1014 113
432 3300002067 JGI24735J21928_10026296 JGI24735J21928_100262964 114
433 3300038443 Ga0395901_0348185 Ga0395901_0348185_1064_1408 114
434 3300048905 Ga0496102_0085927 Ga0496102_0085927_699_1049 114
435 3300048914 Ga0496111_0406435 Ga0496111_0406435_148_498 114

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

64

135

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4la3-assembly2.cif.gz_B crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp 0.8821 34 108
8hjy-assembly1.cif.gz_B crystal structure of a cupin protein (tm1459, h52a/h58e/f104w mutant) in copper (cu) substituted form 0.88 8 109
6l2f-assembly1.cif.gz_B crystal structure of a cupin protein (tm1459, h54ah58a mutant) in copper (cu) substituted form 0.8791 8 109
5wsd-assembly1.cif.gz_B crystal structure of a cupin protein (tm1459) in apo form 0.8791 8 109
5jsp-assembly1.cif.gz_A new mechanistic insight from substrate and product bound structures of the metal-dependent dimethylsulfoniopropionate lyase dddq 0.8788 34 108
ID Description Score Start End Superfamily
5jspB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8791 34 108 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8638 10 110 2.60.120.10
2h0vB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8635 34 108 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8634 10 110 2.60.120.10
5wsdA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8556 8 108 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A1H5LHQ7-F1-model_v4 deleted 1.004 6 111
AF-A0JTC5-F1-model_v4 Cupin 2, conserved barrel domain protein 1.001 3 111
AF-Q1I8G4-F1-model_v4 Cupin 2 conserved barrel domain-containing protein 0.9964 2 111
AF-A0A0Q9EMV4-F1-model_v4 Cupin 0.9955 20 111
AF-A0A4R8WTJ1-F1-model_v4 Cupin domain-containing protein 0.9934 2 111

Feature Viewer

pLDDT pTM Quality
94.5 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map