F443335

General Info

Members Datasets Scaffolds Average Seq Length
435 203 870 321

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10099705|Ga0182008_100997052
Length 346
Sequence MQASGAGQDFLLFYLLVHRVDRKQSSMTAPKVLVTGAGGFVGEALVFRLLVDKQFAPIAAARSPTRLQGLCPVVPFDLNDPEALPELKDVSAVVHAAARVHVMNEVASDALAEFRKVNVEGTLRLARRAAESGVKRFIFISSIKVNGENTLPGKPFKADDAPAPVDPYGVSKHEAEQGLRQLARETGMEVVIIRPPLIYGAGVKANFLSMLRWLNKGIPLPLGAVRNQRSLVSIGNLVDLVITCIDHPAAANQTFLVSDGQDLSTTEMLRRLGKALGKKAWLLPLPEWLLVGVASALGKQSVAQRICGSLQVDISKNRELLGWTPPINMDEAMRQTAGHYLDAQTK

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
22 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
27 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
33 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
37 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
42 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
55 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
58 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
59 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
60 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
61 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
62 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
63 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
64 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
65 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
66 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
67 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
68 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
69 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
70 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
71 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
72 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
73 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
74 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
75 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
76 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
77 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
78 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
79 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
80 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
81 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
82 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
83 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
84 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
87 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
88 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
89 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
90 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
91 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
96 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
97 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
98 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
99 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
102 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
115 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
116 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
117 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
118 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
121 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
122 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
123 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
124 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
128 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
135 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
136 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
137 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
138 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
139 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
140 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
141 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
142 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
143 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
149 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
150 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
155 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
156 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
157 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
158 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
159 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
160 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
161 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
165 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
166 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
171 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
173 2511231006 Pseudomonas sp. GM17 Isolate Nodule
174 2511231014 Pseudomonas sp. GM48 Isolate Nodule
175 2511231015 Pseudomonas sp. GM49 Isolate Nodule
176 2511231016 Pseudomonas sp. GM50 Isolate Nodule
177 2511231022 Pseudomonas sp. GM79 Isolate Nodule
178 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
179 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
180 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
181 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
182 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
183 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
184 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
185 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
186 2765235841 Pseudomonas putida AA7 Isolate Unclassified
187 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
188 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
189 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
190 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
191 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
192 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
193 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
194 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
195 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
196 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
197 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
198 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
199 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
200 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
201 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
202 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
203 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.87
Metatranscriptomes 0
Isolates 7.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.76
Nodule 1.84
Rhizoplane 1.61
Rhizosphere 87.13
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10099705 3300014497 Bacteria 1435
2 MRS2a_Contig_1671 2124908027 Bacteria 3412
3 MRS2a_Contig_57 2124908027 Bacteria 9216
4 SwRhRL2b_contig_839902 2162886007 Bacteria 8498
5 JGI24735J21928_10002131 3300002067 Bacteria 6966
6 JGI24735J21928_10002701 3300002067 Bacteria 6126
7 Ga0055536_1000300 3300003781 Bacteria 37111
8 Ga0055530_10000434 3300003791 Bacteria 37091
9 Ga0055540_1001268 3300003792 Bacteria 15391
10 Ga0065714_10001429 3300005288 Bacteria 4350
11 Ga0065714_10002369 3300005288 Bacteria 21310
12 Ga0065714_10007797 3300005288 Bacteria 2745
13 Ga0065714_10009129 3300005288 Bacteria 2384
14 Ga0065714_10064948 3300005288 Bacteria 15009
15 Ga0065714_10066241 3300005288 Bacteria 7296
16 Ga0065714_10078135 3300005288 Bacteria 2625
17 Ga0065714_10094560 3300005288 Bacteria 1794
18 Ga0065714_10116700 3300005288 Bacteria 1400
19 Ga0065714_10140201 3300005288 Unclassified 1178
20 Ga0065704_10070365 3300005289 Bacteria 29509
21 Ga0065712_10121393 3300005290 Bacteria 1665
22 Ga0065715_10006120 3300005293 Unclassified 2969
23 Ga0070658_10193409 3300005327 Bacteria 1715
24 Ga0070683_100141243 3300005329 Bacteria 2282
25 Ga0070690_100003691 3300005330 Bacteria 8431
26 Ga0070670_100029748 3300005331 Bacteria 4704
27 Ga0070673_100005836 3300005364 Bacteria 7934
28 Ga0070688_100020635 3300005365 Unclassified 3834
29 Ga0070707_100093297 3300005468 Unclassified 2914
30 Ga0070672_100158488 3300005543 Unclassified 1876
31 Ga0068856_100005136 3300005614 Bacteria 12923
32 Ga0068859_100032076 3300005617 Bacteria 5276
33 Ga0068858_100177163 3300005842 Unclassified 2012
34 Ga0075362_10015465 3300006177 Bacteria 3104
35 Ga0075362_10040514 3300006177 Bacteria 2051
36 Ga0075366_10000811 3300006195 Bacteria 14996
37 Ga0097620_100032076 3300006931 Bacteria 5276
38 Ga0079104_1000955 3300006946 Bacteria 22753
39 Ga0105251_10000242 3300009011 Bacteria 54918
40 Ga0105251_10000844 3300009011 Bacteria 27457
41 Ga0105251_10001035 3300009011 Bacteria 24427
42 Ga0105251_10001051 3300009011 Bacteria 24156
43 Ga0105251_10001638 3300009011 Bacteria 18967
44 Ga0105251_10011534 3300009011 Bacteria 5043
45 Ga0105251_10054316 3300009011 Bacteria 1903
46 Ga0105251_10054322 3300009011 Bacteria 1903
47 Ga0105244_10000638 3300009036 Bacteria 30900
48 Ga0105244_10002706 3300009036 Bacteria 13254
49 Ga0105244_10007477 3300009036 Bacteria 6939
50 Ga0105244_10015723 3300009036 Bacteria 4332
51 Ga0105244_10036943 3300009036 Bacteria 2555
52 Ga0105250_10000358 3300009092 Bacteria 34694
53 Ga0105250_10004315 3300009092 Bacteria 6564
54 Ga0105250_10007613 3300009092 Bacteria 4642
55 Ga0111539_10206803 3300009094 Bacteria 2288
56 Ga0105243_10000971 3300009148 Bacteria 26695
57 Ga0157373_10000216 3300013100 Bacteria 47143
58 Ga0157373_10000380 3300013100 Bacteria 35597
59 Ga0157373_10000684 3300013100 Bacteria 26574
60 Ga0157373_10003694 3300013100 Bacteria 11580
61 Ga0157371_10005883 3300013102 Bacteria 10244
62 Ga0157371_10019996 3300013102 Bacteria 4929
63 Ga0157371_10033740 3300013102 Bacteria 3675
64 Ga0157370_10090031 3300013104 Bacteria 2881
65 Ga0157370_10178417 3300013104 Bacteria 1974
66 Ga0157369_10016134 3300013105 Bacteria 8407
67 Ga0163162_10001789 3300013306 Bacteria 20169
68 Ga0163162_10003212 3300013306 Bacteria 15638
69 Ga0163162_10025481 3300013306 Bacteria 5844
70 Ga0157375_10000664 3300013308 Bacteria 30435
71 Ga0157375_10007922 3300013308 Bacteria 9300
72 Ga0182008_10000895 3300014497 Bacteria 20715
73 Ga0182008_10001910 3300014497 Bacteria 13487
74 Ga0182008_10010159 3300014497 Bacteria 5045
75 Ga0182008_10024591 3300014497 Bacteria 3065
76 Ga0182006_1001142 3300015261 Bacteria 16891
77 Ga0182007_10000296 3300015262 Bacteria 32264
78 Ga0182007_10006652 3300015262 Bacteria 4944
79 Ga0182007_10040255 3300015262 Bacteria 1561
80 Ga0163161_10139162 3300017792 Bacteria 1837
81 Ga0213872_10000377 3300021361 Bacteria 37517
82 Ga0209676_1000006 3300025292 Bacteria 1039588
83 Ga0209050_1000260 3300025298 Bacteria 113066
84 Ga0209051_1000163 3300025303 Bacteria 124249
85 Ga0207696_1007488 3300025711 Bacteria 4265
86 Ga0207655_1000857 3300025728 Bacteria 32446
87 Ga0207655_1002467 3300025728 Bacteria 14986
88 Ga0207655_1005471 3300025728 Bacteria 8626
89 Ga0207655_1023385 3300025728 Bacteria 3067
90 Ga0207713_1000444 3300025735 Bacteria 43513
91 Ga0207713_1000874 3300025735 Bacteria 27547
92 Ga0207713_1000922 3300025735 Bacteria 26366
93 Ga0207713_1000968 3300025735 Bacteria 25358
94 Ga0207713_1001664 3300025735 Bacteria 17228
95 Ga0207713_1002700 3300025735 Bacteria 12671
96 Ga0207713_1002702 3300025735 Bacteria 12665
97 Ga0207713_1004123 3300025735 Bacteria 9570
98 Ga0207705_10078515 3300025909 Bacteria 2403
99 Ga0207650_10038822 3300025925 Unclassified 3479
100 Ga0207670_10080192 3300025936 Unclassified 2281
101 Ga0207661_10217516 3300025944 Bacteria 1687
102 Ga0207651_10009708 3300025960 Bacteria 5290
103 Ga0207702_10014311 3300026078 Bacteria 6587
104 Ga0209281_1000902 3300027111 Bacteria 24860
105 Ga0207428_10067919 3300027907 Bacteria 2806
106 Ga0265327_10001921 3300031251 Bacteria 23986
107 Ga0307412_10019510 3300031911 Bacteria 4108
108 Ga0436361_0328269 3300039447 Bacteria 34583
109 Ga0439438_000275 3300041405 Bacteria 23167
110 Ga0439438_000596 3300041405 Bacteria 16345
111 Ga0439438_001039 3300041405 Bacteria 12369
112 Ga0439438_003934 3300041405 Bacteria 5846
113 Ga0439447_000245 3300041407 Bacteria 19071
114 Ga0439447_000384 3300041407 Bacteria 16142
115 Ga0439447_011308 3300041407 Bacteria 2611
116 Ga0439447_024333 3300041407 Bacteria 1569
117 Ga0439466_0000299 3300041411 Bacteria 19156
118 Ga0439466_0000791 3300041411 Bacteria 12022
119 Ga0439466_0001066 3300041411 Bacteria 10594
120 Ga0439466_0001163 3300041411 Bacteria 10252
121 Ga0439466_0001858 3300041411 Bacteria 8275
122 Ga0439466_0002388 3300041411 Bacteria 7363
123 Ga0439466_0004559 3300041411 Bacteria 5323
124 Ga0439466_0006811 3300041411 Bacteria 4334
125 Ga0439466_0025631 3300041411 Bacteria 2057
126 Ga0439466_0039701 3300041411 Bacteria 1576
127 Ga0439432_000110 3300042006 Bacteria 26479
128 Ga0439432_000124 3300042006 Bacteria 25479
129 Ga0439432_000253 3300042006 Bacteria 19122
130 Ga0439432_003903 3300042006 Bacteria 5488
131 Ga0439432_016413 3300042006 Bacteria 2492
132 Ga0439451_000014 3300042009 Bacteria 42560
133 Ga0439451_000034 3300042009 Bacteria 27633
134 Ga0439451_004151 3300042009 Bacteria 2939
135 Ga0439451_007854 3300042009 Bacteria 2166
136 Ga0439451_013885 3300042009 Bacteria 1626
137 Ga0439452_000404 3300042010 Bacteria 25488
138 Ga0439452_000609 3300042010 Bacteria 18220
139 Ga0439452_003589 3300042010 Bacteria 5406
140 Ga0439452_011111 3300042010 Bacteria 2596
141 Ga0439456_000119 3300042013 Bacteria 24617
142 Ga0439456_000412 3300042013 Bacteria 9574
143 Ga0439456_009742 3300042013 Bacteria 1983
144 Ga0439463_003707 3300042016 Bacteria 3851
145 Ga0450911_001202 3300042115 Bacteria 6318
146 Ga0450890_000319 3300042127 Bacteria 6935
147 Ga0450906_000022 3300042145 Bacteria 27788
148 Ga0450907_008665 3300042146 Bacteria 1686
149 Ga0439460_0003078 3300042461 Bacteria 4031
150 Ga0439460_0010507 3300042461 Bacteria 2371
151 Ga0439440_0000005 3300042993 Bacteria 31981
152 Ga0453684_0150602 3300044712 Unclassified 2765
153 Ga0495617_000200 3300046452 Bacteria 37820
154 Ga0495617_000794 3300046452 Bacteria 15243
155 Ga0495617_002589 3300046452 Bacteria 7096
156 Ga0495617_002914 3300046452 Bacteria 6576
157 Ga0495617_018216 3300046452 Bacteria 2375
158 Ga0495627_000586 3300046453 Bacteria 29130
159 Ga0495592_0000531 3300046454 Bacteria 27424
160 Ga0495590_0000248 3300046457 Bacteria 29287
161 Ga0495590_0000508 3300046457 Bacteria 19111
162 Ga0495590_0002700 3300046457 Bacteria 7331
163 Ga0495590_0003717 3300046457 Bacteria 6214
164 Ga0495591_001574 3300046458 Bacteria 13877
165 Ga0495638_0000726 3300046460 Bacteria 35496
166 Ga0495638_0004298 3300046460 Bacteria 10811
167 Ga0495638_0008559 3300046460 Bacteria 7243
168 Ga0495638_0010747 3300046460 Bacteria 6335
169 Ga0495638_0011407 3300046460 Bacteria 6124
170 Ga0495653_0000688 3300046463 Bacteria 25835
171 Ga0495653_0050710 3300046463 Bacteria 3190
172 Ga0495653_0056066 3300046463 Bacteria 3005
173 Ga0495653_0069361 3300046463 Bacteria 2641
174 Ga0495653_0080324 3300046463 Bacteria 2413
175 Ga0495653_0093976 3300046463 Bacteria 2186
176 Ga0495650_0001217 3300046471 Bacteria 26985
177 Ga0495650_0001799 3300046471 Bacteria 19344
178 Ga0495605_0000672 3300046474 Bacteria 25764
179 Ga0495605_0000747 3300046474 Bacteria 23843
180 Ga0495605_0000753 3300046474 Bacteria 23741
181 Ga0495639_0000020 3300046475 Bacteria 73983
182 Ga0495639_0047080 3300046475 Bacteria 1953
183 Ga0495584_0000285 3300046491 Bacteria 35720
184 Ga0495584_0000486 3300046491 Bacteria 27340
185 Ga0495584_0005176 3300046491 Bacteria 6922
186 Ga0495584_0014319 3300046491 Bacteria 4041
187 Ga0495585_0000121 3300046492 Bacteria 84876
188 Ga0495585_0000754 3300046492 Bacteria 28684
189 Ga0495585_0000810 3300046492 Bacteria 27246
190 Ga0495585_0010050 3300046492 Bacteria 5653
191 Ga0495585_0042207 3300046492 Bacteria 2556
192 Ga0495594_0001261 3300046499 Bacteria 13267
193 Ga0495594_0085285 3300046499 Bacteria 1767
194 Ga0495607_0000639 3300046501 Bacteria 34018
195 Ga0495607_0001640 3300046501 Bacteria 19395
196 Ga0495607_0009839 3300046501 Bacteria 6453
197 Ga0495607_0022922 3300046501 Bacteria 3914
198 Ga0495583_0003148 3300046506 Bacteria 13017
199 Ga0495583_0021085 3300046506 Bacteria 3357
200 Ga0495610_0000774 3300046512 Bacteria 30147
201 Ga0495616_0000484 3300046513 Bacteria 30294
202 Ga0495616_0000598 3300046513 Bacteria 27217
203 Ga0495616_0000750 3300046513 Bacteria 23713
204 Ga0495616_0001079 3300046513 Bacteria 19379
205 Ga0495616_0003336 3300046513 Bacteria 10311
206 Ga0495620_0000076 3300046515 Bacteria 80714
207 Ga0495620_0000266 3300046515 Bacteria 38388
208 Ga0495620_0001795 3300046515 Bacteria 12622
209 Ga0495628_0053262 3300046516 Bacteria 3194
210 Ga0495628_0079819 3300046516 Bacteria 2544
211 Ga0495630_0161781 3300046517 Bacteria 1704
212 Ga0495631_0045680 3300046518 Bacteria 1928
213 Ga0495632_0000164 3300046519 Bacteria 68590
214 Ga0495632_0000481 3300046519 Bacteria 37903
215 Ga0495632_0000527 3300046519 Bacteria 36131
216 Ga0495632_0001044 3300046519 Bacteria 23873
217 Ga0495632_0003678 3300046519 Bacteria 10761
218 Ga0495632_0083194 3300046519 Bacteria 1524
219 Ga0495637_0000538 3300046520 Bacteria 27221
220 Ga0495637_0000598 3300046520 Bacteria 25829
221 Ga0495637_0000675 3300046520 Bacteria 23730
222 Ga0495637_0001629 3300046520 Bacteria 13023
223 Ga0495637_0001828 3300046520 Bacteria 12175
224 Ga0495637_0003584 3300046520 Bacteria 8230
225 Ga0495637_0014928 3300046520 Bacteria 3656
226 Ga0495643_0000102 3300046522 Bacteria 141544
227 Ga0495643_0000801 3300046522 Bacteria 34761
228 Ga0495643_0001100 3300046522 Bacteria 26910
229 Ga0495643_0001350 3300046522 Bacteria 23094
230 Ga0495643_0007756 3300046522 Bacteria 6870
231 Ga0495644_0010671 3300046523 Bacteria 3538
232 Ga0495648_0000447 3300046524 Bacteria 44636
233 Ga0495648_0001380 3300046524 Bacteria 23914
234 Ga0495648_0001419 3300046524 Bacteria 23424
235 Ga0495648_0001939 3300046524 Bacteria 19708
236 Ga0495648_0002091 3300046524 Bacteria 18851
237 Ga0495666_0001366 3300046526 Bacteria 11831
238 Ga0495666_0056397 3300046526 Bacteria 1882
239 Ga0495666_0056823 3300046526 Bacteria 1873
240 Ga0495666_0081892 3300046526 Bacteria 1526
241 Ga0495642_0000096 3300046528 Bacteria 50386
242 Ga0495642_0000173 3300046528 Bacteria 37882
243 Ga0495654_0000499 3300046530 Bacteria 32120
244 Ga0495654_0000642 3300046530 Bacteria 27541
245 Ga0495654_0001445 3300046530 Bacteria 16308
246 Ga0495654_0002977 3300046530 Bacteria 10599
247 Ga0495654_0008310 3300046530 Bacteria 5740
248 Ga0495586_0028037 3300046535 Bacteria 3013
249 Ga0495587_0034341 3300046536 Bacteria 3059
250 Ga0495587_0038636 3300046536 Bacteria 2860
251 Ga0495587_0124596 3300046536 Bacteria 1474
252 Ga0495609_0000396 3300046538 Bacteria 36617
253 Ga0495609_0000661 3300046538 Bacteria 26766
254 Ga0495609_0000689 3300046538 Bacteria 26028
255 Ga0495609_0032942 3300046538 Bacteria 2352
256 Ga0495597_0078156 3300046542 Bacteria 1417
257 Ga0495645_0013415 3300046543 Bacteria 5791
258 Ga0495622_0001378 3300046557 Bacteria 12392
259 Ga0495656_0041343 3300046615 Bacteria 1926
260 Ga0495668_0015580 3300046616 Bacteria 4436
261 Ga0495668_0070046 3300046616 Bacteria 1928
262 Ga0495634_0000578 3300046642 Bacteria 35603
263 Ga0495634_0008816 3300046642 Bacteria 7480
264 Ga0495611_0008381 3300046648 Bacteria 4379
265 Ga0495611_0012517 3300046648 Bacteria 3607
266 Ga0495625_0001808 3300046660 Bacteria 24531
267 Ga0495625_0001948 3300046660 Bacteria 23351
268 Ga0495625_0002521 3300046660 Bacteria 19710
269 Ga0495625_0002691 3300046660 Bacteria 18886
270 Ga0495625_0023052 3300046660 Bacteria 4760
271 Ga0495625_0075407 3300046660 Bacteria 2360
272 Ga0495635_0011862 3300046663 Bacteria 6109
273 Ga0495635_0220863 3300046663 Bacteria 1281
274 Ga0495659_0000827 3300046664 Bacteria 10997
275 Ga0495659_0000914 3300046664 Bacteria 10488
276 Ga0495659_0002964 3300046664 Bacteria 5446
277 Ga0495661_0007415 3300046665 Bacteria 7647
278 Ga0495661_0038352 3300046665 Bacteria 2985
279 Ga0495588_0000332 3300046674 Bacteria 31035
280 Ga0495588_0071692 3300046674 Bacteria 1802
281 Ga0495623_0003974 3300046679 Bacteria 9730
282 Ga0495646_0000141 3300046680 Bacteria 36806
283 Ga0495646_0002439 3300046680 Bacteria 11412
284 Ga0495646_0003293 3300046680 Bacteria 10055
285 Ga0495646_0039256 3300046680 Bacteria 2920
286 Ga0495669_0010329 3300046684 Bacteria 3945
287 Ga0495613_0000653 3300046689 Bacteria 27454
288 Ga0495613_0042100 3300046689 Bacteria 3381
289 Ga0495624_0000531 3300046690 Bacteria 29852
290 Ga0495670_0000170 3300046691 Bacteria 28828
291 Ga0495670_0002412 3300046691 Bacteria 9221
292 Ga0495670_0041092 3300046691 Bacteria 2307
293 Ga0495671_0000500 3300046692 Bacteria 30197
294 Ga0495671_0000501 3300046692 Bacteria 30161
295 Ga0495671_0001061 3300046692 Bacteria 19046
296 Ga0495671_0003934 3300046692 Bacteria 9008
297 Ga0495671_0026188 3300046692 Bacteria 3025
298 Ga0495671_0107076 3300046692 Bacteria 1365
299 Ga0495649_0000432 3300046694 Bacteria 36223
300 Ga0495649_0002018 3300046694 Bacteria 14695
301 Ga0495649_0002136 3300046694 Bacteria 14139
302 Ga0495649_0012874 3300046694 Bacteria 4847
303 Ga0495649_0013172 3300046694 Bacteria 4777
304 Ga0495589_0000578 3300046794 Bacteria 25244
305 Ga0495589_0001569 3300046794 Bacteria 13144
306 Ga0495589_0002103 3300046794 Bacteria 11245
307 Ga0495589_0005779 3300046794 Bacteria 6527
308 Ga0495589_0017798 3300046794 Bacteria 3645
309 Ga0495589_0045093 3300046794 Bacteria 2190
310 Ga0495600_0000799 3300046809 Bacteria 16669
311 Ga0495600_0019131 3300046809 Bacteria 4368
312 Ga0495660_0000547 3300046810 Bacteria 30853
313 Ga0495660_0110011 3300046810 Bacteria 1407
314 Ga0495581_0035148 3300047315 Bacteria 2899
315 Ga0495604_0046768 3300047317 Bacteria 3373
316 Ga0495636_0000132 3300047318 Bacteria 29973
317 Ga0495636_0000191 3300047318 Bacteria 24040
318 Ga0495674_0012454 3300047319 Bacteria 8013
319 Ga0495672_0000378 3300047320 Bacteria 55187
320 Ga0495672_0000795 3300047320 Bacteria 34131
321 Ga0495672_0000938 3300047320 Bacteria 30432
322 Ga0495672_0001019 3300047320 Bacteria 28816
323 Ga0495672_0001359 3300047320 Bacteria 24241
324 Ga0495672_0001962 3300047320 Bacteria 19444
325 Ga0495672_0019821 3300047320 Bacteria 4425
326 Ga0495676_0000567 3300047321 Bacteria 30353
327 Ga0495676_0000691 3300047321 Bacteria 28103
328 Ga0495680_0000664 3300047322 Bacteria 38534
329 Ga0495680_0002689 3300047322 Bacteria 17947
330 Ga0495680_0004075 3300047322 Bacteria 14067
331 Ga0495680_0037989 3300047322 Bacteria 3852
332 Ga0495683_0001413 3300047323 Bacteria 15848
333 Ga0495683_0003760 3300047323 Bacteria 8773
334 Ga0495683_0005807 3300047323 Bacteria 6792
335 Ga0495683_0013255 3300047323 Bacteria 4315
336 Ga0495687_003617 3300047443 Bacteria 11044
337 Ga0495687_004145 3300047443 Bacteria 9986
338 Ga0495687_024700 3300047443 Bacteria 2852
339 Ga0495675_0007945 3300047444 Bacteria 6558
340 Ga0495677_0000289 3300047445 Bacteria 21903
341 Ga0495679_007490 3300047446 Bacteria 4542
342 Ga0495679_007641 3300047446 Bacteria 4486
343 Ga0495685_005424 3300047447 Bacteria 4164
344 Ga0495673_0000626 3300047469 Bacteria 34754
345 Ga0495673_0005939 3300047469 Bacteria 7276
346 Ga0495673_0007263 3300047469 Bacteria 6396
347 Ga0495673_0012152 3300047469 Bacteria 4584
348 Ga0495673_0026462 3300047469 Bacteria 2773
349 Ga0495673_0105955 3300047469 Bacteria 1130
350 Ga0495681_0001243 3300047470 Bacteria 19346
351 Ga0495681_0052444 3300047470 Bacteria 1914
352 Ga0495684_0000839 3300047471 Bacteria 24902
353 Ga0495686_0002428 3300047472 Bacteria 17617
354 Ga0495593_0002585 3300047673 Bacteria 10879
355 Ga0495593_0062353 3300047673 Bacteria 1948
356 Ga0495593_0068483 3300047673 Bacteria 1846
357 Ga0495602_0000857 3300048088 Bacteria 29349
358 Ga0495626_0000699 3300048091 Bacteria 31942
359 Ga0495626_0000819 3300048091 Bacteria 27987
360 Ga0495626_0000843 3300048091 Bacteria 27491
361 Ga0495626_0002809 3300048091 Bacteria 11660
362 Ga0495626_0002836 3300048091 Bacteria 11585
363 Ga0496102_0000519 3300048905 Bacteria 42011
364 Ga0496103_0001796 3300048906 Bacteria 14004
365 Ga0496104_0124997 3300048907 Bacteria 2469
366 Ga0496105_0022293 3300048908 Bacteria 5129
367 Ga0496106_0067157 3300048909 Bacteria 2733
368 Ga0496111_0180700 3300048914 Bacteria 1568
369 Ga0496116_0000427 3300048919 Bacteria 59167
370 Ga0496116_0022457 3300048919 Bacteria 4728
371 Ga0496117_0000679 3300048920 Bacteria 54406
372 Ga0496117_0011811 3300048920 Bacteria 7775
373 Ga0496119_0001431 3300048922 Bacteria 28804
374 Ga0496119_0008611 3300048922 Bacteria 8931
375 Ga0496120_0001617 3300048923 Bacteria 26127
376 Ga0496120_0015014 3300048923 Bacteria 5127
377 Ga0496121_0001685 3300048924 Bacteria 36349
378 Ga0496121_0026838 3300048924 Bacteria 5409
379 Ga0496122_0007463 3300048925 Bacteria 12140
380 Ga0496124_0002357 3300048927 Bacteria 24921
381 Ga0496124_0003020 3300048927 Bacteria 21031
382 Ga0496124_0028385 3300048927 Bacteria 5007
383 Ga0496124_0298045 3300048927 Bacteria 1166
384 Ga0496125_0003005 3300048928 Bacteria 21097
385 Ga0496125_0010025 3300048928 Bacteria 9626
386 Ga0496126_0042249 3300048929 Bacteria 4211
387 Ga0495678_000569 3300049459 Bacteria 35204
388 Ga0495678_000891 3300049459 Bacteria 26572
389 Ga0495678_000928 3300049459 Bacteria 25623
390 Ga0495678_000960 3300049459 Bacteria 24945
391 Ga0495678_003060 3300049459 Bacteria 10617
392 Ga0495682_0000536 3300049460 Bacteria 26226
393 Ga0495682_0000651 3300049460 Bacteria 23215
394 Ga0495682_0000878 3300049460 Bacteria 18647
395 Ga0495682_0002981 3300049460 Bacteria 7727
396 Ga0495682_0007016 3300049460 Bacteria 4515
397 Ga0495682_0011151 3300049460 Bacteria 3463
398 Ga0501032_0050921 3300049569 Bacteria 2792
399 Ga0501034_0000665 3300049571 Bacteria 52406
400 nmdc:mga0k408_1165_c1 3300050493 Bacteria 14375
401 nmdc:mga08x19_136305_c1 3300050514 Bacteria 1655
402 Ga0500647_0114953 3300053091 Bacteria 1277
403 Ga0500641_0076060 3300053096 Bacteria 1420
404 Ga0530510_0094817 3300061734 Bacteria 2180
405 2511268371 2511231006 Bacteria 6794709
406 2511314699 2511231014 Bacteria 6462302
407 2511323025 2511231015 Bacteria 6598026
408 2511324136 2511231016 Bacteria 6704427
409 2511362931 2511231022 Bacteria 6719296
410 2512324055 2512047018 Bacteria 6663241
411 2583793727 2582580891 Bacteria 6800976
412 2624490950 2623620446 Bacteria 6500345
413 2644188637 2643221633 Bacteria 6733554
414 2671125961 2667528176 Bacteria 6724917
415 2718635210 2718217725 Bacteria 5758958
416 2739288878 2738543020 Bacteria 5718238
417 2739294190 2738543021 Bacteria 5718241
418 2765585386 2765235841 Bacteria 6137024
419 2808941464 2808606379 Bacteria 5022697
420 2839099589 2839094727 Bacteria 5534556
421 2852663077 2852657418 Bacteria 6472974
422 2860340871 2860339153 Bacteria 6846989
423 2880234571 2880230671 Bacteria 6140320
424 2904521298 2904518522 Bacteria 6068986
425 2919157459 2919155634 Bacteria 4860545
426 2919388046 2919385768 Bacteria 5897293
427 2919701942 2919697872 Bacteria 6553725
428 2931396614 2931396565 Bacteria 7251677
429 2969308723 2969304461 Bacteria 6601805
430 3007624865 3007619802 Bacteria 6411688
431 3007870299 3007866637 Bacteria 5899198
432 8019773107 8019769354 Bacteria 6924660
433 8019779323 8019775933 Bacteria 6858656
434 8029996850 8029995093 Bacteria 5990776
435 8056155079 8056155041 Bacteria 6486948
436 Ga0182008_10099705
437 MRS2a_Contig_1671
438 MRS2a_Contig_57
439 SwRhRL2b_contig_839902
440 JGI24735J21928_10002131
441 JGI24735J21928_10002701
442 Ga0055536_1000300
443 Ga0055530_10000434
444 Ga0055540_1001268
445 Ga0065714_10001429
446 Ga0065714_10002369
447 Ga0065714_10007797
448 Ga0065714_10009129
449 Ga0065714_10064948
450 Ga0065714_10066241
451 Ga0065714_10078135
452 Ga0065714_10094560
453 Ga0065714_10116700
454 Ga0065714_10140201
455 Ga0065704_10070365
456 Ga0065712_10121393
457 Ga0065715_10006120
458 Ga0070658_10193409
459 Ga0070683_100141243
460 Ga0070690_100003691
461 Ga0070670_100029748
462 Ga0070673_100005836
463 Ga0070688_100020635
464 Ga0070707_100093297
465 Ga0070672_100158488
466 Ga0068856_100005136
467 Ga0068859_100032076
468 Ga0068858_100177163
469 Ga0075362_10015465
470 Ga0075362_10040514
471 Ga0075366_10000811
472 Ga0097620_100032076
473 Ga0079104_1000955
474 Ga0105251_10000242
475 Ga0105251_10000844
476 Ga0105251_10001035
477 Ga0105251_10001051
478 Ga0105251_10001638
479 Ga0105251_10011534
480 Ga0105251_10054316
481 Ga0105251_10054322
482 Ga0105244_10000638
483 Ga0105244_10002706
484 Ga0105244_10007477
485 Ga0105244_10015723
486 Ga0105244_10036943
487 Ga0105250_10000358
488 Ga0105250_10004315
489 Ga0105250_10007613
490 Ga0111539_10206803
491 Ga0105243_10000971
492 Ga0157373_10000216
493 Ga0157373_10000380
494 Ga0157373_10000684
495 Ga0157373_10003694
496 Ga0157371_10005883
497 Ga0157371_10019996
498 Ga0157371_10033740
499 Ga0157370_10090031
500 Ga0157370_10178417
501 Ga0157369_10016134
502 Ga0163162_10001789
503 Ga0163162_10003212
504 Ga0163162_10025481
505 Ga0157375_10000664
506 Ga0157375_10007922
507 Ga0182008_10000895
508 Ga0182008_10001910
509 Ga0182008_10010159
510 Ga0182008_10024591
511 Ga0182006_1001142
512 Ga0182007_10000296
513 Ga0182007_10006652
514 Ga0182007_10040255
515 Ga0163161_10139162
516 Ga0213872_10000377
517 Ga0209676_1000006
518 Ga0209050_1000260
519 Ga0209051_1000163
520 Ga0207696_1007488
521 Ga0207655_1000857
522 Ga0207655_1002467
523 Ga0207655_1005471
524 Ga0207655_1023385
525 Ga0207713_1000444
526 Ga0207713_1000874
527 Ga0207713_1000922
528 Ga0207713_1000968
529 Ga0207713_1001664
530 Ga0207713_1002700
531 Ga0207713_1002702
532 Ga0207713_1004123
533 Ga0207705_10078515
534 Ga0207650_10038822
535 Ga0207670_10080192
536 Ga0207661_10217516
537 Ga0207651_10009708
538 Ga0207702_10014311
539 Ga0209281_1000902
540 Ga0207428_10067919
541 Ga0265327_10001921
542 Ga0307412_10019510
543 Ga0436361_0328269
544 Ga0439438_000275
545 Ga0439438_000596
546 Ga0439438_001039
547 Ga0439438_003934
548 Ga0439447_000245
549 Ga0439447_000384
550 Ga0439447_011308
551 Ga0439447_024333
552 Ga0439466_0000299
553 Ga0439466_0000791
554 Ga0439466_0001066
555 Ga0439466_0001163
556 Ga0439466_0001858
557 Ga0439466_0002388
558 Ga0439466_0004559
559 Ga0439466_0006811
560 Ga0439466_0025631
561 Ga0439466_0039701
562 Ga0439432_000110
563 Ga0439432_000124
564 Ga0439432_000253
565 Ga0439432_003903
566 Ga0439432_016413
567 Ga0439451_000014
568 Ga0439451_000034
569 Ga0439451_004151
570 Ga0439451_007854
571 Ga0439451_013885
572 Ga0439452_000404
573 Ga0439452_000609
574 Ga0439452_003589
575 Ga0439452_011111
576 Ga0439456_000119
577 Ga0439456_000412
578 Ga0439456_009742
579 Ga0439463_003707
580 Ga0450911_001202
581 Ga0450890_000319
582 Ga0450906_000022
583 Ga0450907_008665
584 Ga0439460_0003078
585 Ga0439460_0010507
586 Ga0439440_0000005
587 Ga0453684_0150602
588 Ga0495617_000200
589 Ga0495617_000794
590 Ga0495617_002589
591 Ga0495617_002914
592 Ga0495617_018216
593 Ga0495627_000586
594 Ga0495592_0000531
595 Ga0495590_0000248
596 Ga0495590_0000508
597 Ga0495590_0002700
598 Ga0495590_0003717
599 Ga0495591_001574
600 Ga0495638_0000726
601 Ga0495638_0004298
602 Ga0495638_0008559
603 Ga0495638_0010747
604 Ga0495638_0011407
605 Ga0495653_0000688
606 Ga0495653_0050710
607 Ga0495653_0056066
608 Ga0495653_0069361
609 Ga0495653_0080324
610 Ga0495653_0093976
611 Ga0495650_0001217
612 Ga0495650_0001799
613 Ga0495605_0000672
614 Ga0495605_0000747
615 Ga0495605_0000753
616 Ga0495639_0000020
617 Ga0495639_0047080
618 Ga0495584_0000285
619 Ga0495584_0000486
620 Ga0495584_0005176
621 Ga0495584_0014319
622 Ga0495585_0000121
623 Ga0495585_0000754
624 Ga0495585_0000810
625 Ga0495585_0010050
626 Ga0495585_0042207
627 Ga0495594_0001261
628 Ga0495594_0085285
629 Ga0495607_0000639
630 Ga0495607_0001640
631 Ga0495607_0009839
632 Ga0495607_0022922
633 Ga0495583_0003148
634 Ga0495583_0021085
635 Ga0495610_0000774
636 Ga0495616_0000484
637 Ga0495616_0000598
638 Ga0495616_0000750
639 Ga0495616_0001079
640 Ga0495616_0003336
641 Ga0495620_0000076
642 Ga0495620_0000266
643 Ga0495620_0001795
644 Ga0495628_0053262
645 Ga0495628_0079819
646 Ga0495630_0161781
647 Ga0495631_0045680
648 Ga0495632_0000164
649 Ga0495632_0000481
650 Ga0495632_0000527
651 Ga0495632_0001044
652 Ga0495632_0003678
653 Ga0495632_0083194
654 Ga0495637_0000538
655 Ga0495637_0000598
656 Ga0495637_0000675
657 Ga0495637_0001629
658 Ga0495637_0001828
659 Ga0495637_0003584
660 Ga0495637_0014928
661 Ga0495643_0000102
662 Ga0495643_0000801
663 Ga0495643_0001100
664 Ga0495643_0001350
665 Ga0495643_0007756
666 Ga0495644_0010671
667 Ga0495648_0000447
668 Ga0495648_0001380
669 Ga0495648_0001419
670 Ga0495648_0001939
671 Ga0495648_0002091
672 Ga0495666_0001366
673 Ga0495666_0056397
674 Ga0495666_0056823
675 Ga0495666_0081892
676 Ga0495642_0000096
677 Ga0495642_0000173
678 Ga0495654_0000499
679 Ga0495654_0000642
680 Ga0495654_0001445
681 Ga0495654_0002977
682 Ga0495654_0008310
683 Ga0495586_0028037
684 Ga0495587_0034341
685 Ga0495587_0038636
686 Ga0495587_0124596
687 Ga0495609_0000396
688 Ga0495609_0000661
689 Ga0495609_0000689
690 Ga0495609_0032942
691 Ga0495597_0078156
692 Ga0495645_0013415
693 Ga0495622_0001378
694 Ga0495656_0041343
695 Ga0495668_0015580
696 Ga0495668_0070046
697 Ga0495634_0000578
698 Ga0495634_0008816
699 Ga0495611_0008381
700 Ga0495611_0012517
701 Ga0495625_0001808
702 Ga0495625_0001948
703 Ga0495625_0002521
704 Ga0495625_0002691
705 Ga0495625_0023052
706 Ga0495625_0075407
707 Ga0495635_0011862
708 Ga0495635_0220863
709 Ga0495659_0000827
710 Ga0495659_0000914
711 Ga0495659_0002964
712 Ga0495661_0007415
713 Ga0495661_0038352
714 Ga0495588_0000332
715 Ga0495588_0071692
716 Ga0495623_0003974
717 Ga0495646_0000141
718 Ga0495646_0002439
719 Ga0495646_0003293
720 Ga0495646_0039256
721 Ga0495669_0010329
722 Ga0495613_0000653
723 Ga0495613_0042100
724 Ga0495624_0000531
725 Ga0495670_0000170
726 Ga0495670_0002412
727 Ga0495670_0041092
728 Ga0495671_0000500
729 Ga0495671_0000501
730 Ga0495671_0001061
731 Ga0495671_0003934
732 Ga0495671_0026188
733 Ga0495671_0107076
734 Ga0495649_0000432
735 Ga0495649_0002018
736 Ga0495649_0002136
737 Ga0495649_0012874
738 Ga0495649_0013172
739 Ga0495589_0000578
740 Ga0495589_0001569
741 Ga0495589_0002103
742 Ga0495589_0005779
743 Ga0495589_0017798
744 Ga0495589_0045093
745 Ga0495600_0000799
746 Ga0495600_0019131
747 Ga0495660_0000547
748 Ga0495660_0110011
749 Ga0495581_0035148
750 Ga0495604_0046768
751 Ga0495636_0000132
752 Ga0495636_0000191
753 Ga0495674_0012454
754 Ga0495672_0000378
755 Ga0495672_0000795
756 Ga0495672_0000938
757 Ga0495672_0001019
758 Ga0495672_0001359
759 Ga0495672_0001962
760 Ga0495672_0019821
761 Ga0495676_0000567
762 Ga0495676_0000691
763 Ga0495680_0000664
764 Ga0495680_0002689
765 Ga0495680_0004075
766 Ga0495680_0037989
767 Ga0495683_0001413
768 Ga0495683_0003760
769 Ga0495683_0005807
770 Ga0495683_0013255
771 Ga0495687_003617
772 Ga0495687_004145
773 Ga0495687_024700
774 Ga0495675_0007945
775 Ga0495677_0000289
776 Ga0495679_007490
777 Ga0495679_007641
778 Ga0495685_005424
779 Ga0495673_0000626
780 Ga0495673_0005939
781 Ga0495673_0007263
782 Ga0495673_0012152
783 Ga0495673_0026462
784 Ga0495673_0105955
785 Ga0495681_0001243
786 Ga0495681_0052444
787 Ga0495684_0000839
788 Ga0495686_0002428
789 Ga0495593_0002585
790 Ga0495593_0062353
791 Ga0495593_0068483
792 Ga0495602_0000857
793 Ga0495626_0000699
794 Ga0495626_0000819
795 Ga0495626_0000843
796 Ga0495626_0002809
797 Ga0495626_0002836
798 Ga0496102_0000519
799 Ga0496103_0001796
800 Ga0496104_0124997
801 Ga0496105_0022293
802 Ga0496106_0067157
803 Ga0496111_0180700
804 Ga0496116_0000427
805 Ga0496116_0022457
806 Ga0496117_0000679
807 Ga0496117_0011811
808 Ga0496119_0001431
809 Ga0496119_0008611
810 Ga0496120_0001617
811 Ga0496120_0015014
812 Ga0496121_0001685
813 Ga0496121_0026838
814 Ga0496122_0007463
815 Ga0496124_0002357
816 Ga0496124_0003020
817 Ga0496124_0028385
818 Ga0496124_0298045
819 Ga0496125_0003005
820 Ga0496125_0010025
821 Ga0496126_0042249
822 Ga0495678_000569
823 Ga0495678_000891
824 Ga0495678_000928
825 Ga0495678_000960
826 Ga0495678_003060
827 Ga0495682_0000536
828 Ga0495682_0000651
829 Ga0495682_0000878
830 Ga0495682_0002981
831 Ga0495682_0007016
832 Ga0495682_0011151
833 Ga0501032_0050921
834 Ga0501034_0000665
835 nmdc:mga0k408_1165_c1
836 nmdc:mga08x19_136305_c1
837 Ga0500647_0114953
838 Ga0500641_0076060
839 Ga0530510_0094817
840 2511268371
841 2511314699
842 2511323025
843 2511324136
844 2511362931
845 2512324055
846 2583793727
847 2624490950
848 2644188637
849 2671125961
850 2718635210
851 2739288878
852 2739294190
853 2765585386
854 2808941464
855 2839099589
856 2852663077
857 2860340871
858 2880234571
859 2904521298
860 2919157459
861 2919388046
862 2919701942
863 2931396614
864 2969308723
865 3007624865
866 3007870299
867 8019773107
868 8019779323
869 8029996850
870 8056155079

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

32

258

0.84

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

33

285

0.83

PF04321

RmlD_sub_bind

RmlD substrate binding domain

30

272

0.83

PF13460

NAD_binding_10

NAD(P)H-binding

36

205

0.83

PF07993

NAD_binding_4

Male sterility protein

75

244

0.81

PF02719

Polysacc_synt_2

Polysaccharide biosynthesis protein

58

282

0.8

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

33

336

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m2p-assembly1.cif.gz_B the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8657 5 317
3m2p-assembly1.cif.gz_A the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8631 3 315
3m2p-assembly2.cif.gz_C the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8605 3 315
3m2p-assembly2.cif.gz_F the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8583 5 317
3m2p-assembly1.cif.gz_B the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8528 5 317
ID Description Score Start End Superfamily
4id9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.86 6 232 3.40.50.720
af_I1JK06_1_360_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8561 1 316 3.40.50.720
2pk3B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8521 5 234 3.40.50.720
af_P9WQP7_5_351_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8484 1 316 3.40.50.720
3eheB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8458 6 232 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q3QFD4-F1-model_v4 deleted 0.9876 61 314
AF-A0A0B8NZT0-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) 0.9765 68 320 GO:0003978
AF-W2TXR6-F1-model_v4 Putative epimerase/dehydratase WbiG 0.973 77 316
AF-A0A7Y2KF59-F1-model_v4 deleted 0.969 6 310
AF-A0A0B8NZT0-F1-model_v4 UDP-glucose 4-epimerase (EC 5.1.3.2) 0.9689 68 320 GO:0003978

Map