F443313

General Info

Members Datasets Scaffolds Average Seq Length
435 209 429 301

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10209914|Ga0105240_102099143
Length 307
Sequence MPHIPISYKDKVVIITGAGGGLGRAHALEFAKRGAKVVVNDLGGALDGTGGNSAAAEAVVKEIKDAGGEAIANGASVTDDAGVAHLVKQTMDTWGRIDVLIANAGILRDKSFSKMEMRDFEAVMNVHLMGTVKPAHAIWPIMKAQKYGRIVVTTSSTGLYGNFGQTNYGAAKMSLVGFMNSLKLEGDKDNIKVNAIWPVAATRMTENLMPPAVSELLKPEYVSPAVAFLASDEAPTGVIMTAAAGVFAVAQLVETDGVNLGHKASADDVADHFKQIADFSTSGKHYNQGGEQNMKFFAKIQEPPAVG

Samples

Sample ID Description Type Environment
1 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
2 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
3 2643221640 Caulobacter sp. Root342 Isolate Unclassified
4 2643221642 Caulobacter sp. Root343 Isolate Unclassified
5 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
6 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
79 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
80 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
81 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
136 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
164 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
177 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
204 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
205 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
206 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
207 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 0
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.83
Nodule 0
Rhizoplane 0.23
Rhizosphere 91.72
Stem 0
Stem Tuber 0
Unclassified 3.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000526 3300003215 Bacteria 24044
2 Ga0055530_10007107 3300003791 Bacteria 4800
3 Ga0055531_10002462 3300003794 Bacteria 12374
4 Ga0065165_1014044 3300005262 Bacteria 3133
5 Ga0070658_10001580 3300005327 Bacteria 19269
6 Ga0070658_10016145 3300005327 Bacteria 5974
7 Ga0070658_10127818 3300005327 Bacteria 2116
8 Ga0070658_10300900 3300005327 Bacteria 1368
9 Ga0070676_10007423 3300005328 Bacteria 5887
10 Ga0070683_100039915 3300005329 Bacteria 4312
11 Ga0070690_100061378 3300005330 Bacteria 2421
12 Ga0068869_100001709 3300005334 Bacteria 13109
13 Ga0068869_100138390 3300005334 Bacteria 1878
14 Ga0068869_100169866 3300005334 Bacteria 1703
15 Ga0070666_10002182 3300005335 Bacteria 11893
16 Ga0070666_10164702 3300005335 Bacteria 1550
17 Ga0070666_10216839 3300005335 Bacteria 1349
18 Ga0070680_100000120 3300005336 Bacteria 46266
19 Ga0070680_100000428 3300005336 Bacteria 28662
20 Ga0068868_100009116 3300005338 Bacteria 7125
21 Ga0068868_100117833 3300005338 Bacteria 2163
22 Ga0068868_100188905 3300005338 Bacteria 1713
23 Ga0070660_100058184 3300005339 Bacteria 2996
24 Ga0070660_100123799 3300005339 Bacteria 2065
25 Ga0070660_100230037 3300005339 Bacteria 1508
26 Ga0070660_100516206 3300005339 Bacteria 995
27 Ga0070691_10003284 3300005341 Bacteria 7251
28 Ga0070661_100000300 3300005344 Bacteria 39901
29 Ga0070661_100036838 3300005344 Bacteria 3556
30 Ga0070668_100016416 3300005347 Bacteria 5536
31 Ga0070675_100058662 3300005354 Bacteria 3175
32 Ga0070673_100093806 3300005364 Bacteria 2459
33 Ga0070659_100000056 3300005366 Bacteria 88478
34 Ga0070659_100002457 3300005366 Bacteria 13173
35 Ga0070659_100006567 3300005366 Bacteria 8397
36 Ga0070659_100114360 3300005366 Bacteria 2180
37 Ga0070667_100057419 3300005367 Bacteria 3290
38 Ga0070667_100117998 3300005367 Bacteria 2306
39 Ga0070711_100009422 3300005439 Bacteria 6015
40 Ga0070663_100153813 3300005455 Bacteria 1766
41 Ga0070678_100005783 3300005456 Bacteria 7194
42 Ga0070681_10000005 3300005458 Bacteria 183053
43 Ga0070681_10024276 3300005458 Bacteria 6103
44 Ga0070681_10233092 3300005458 Bacteria 1755
45 Ga0068867_100013145 3300005459 Bacteria 5860
46 Ga0068867_100022140 3300005459 Bacteria 4541
47 Ga0070679_100000862 3300005530 Bacteria 26344
48 Ga0070679_100003839 3300005530 Bacteria 13800
49 Ga0070679_100048085 3300005530 Bacteria 4251
50 Ga0070684_100066169 3300005535 Bacteria 3172
51 Ga0070684_100097922 3300005535 Bacteria 2616
52 Ga0068853_100056354 3300005539 Bacteria 3389
53 Ga0068853_100121566 3300005539 Bacteria 2330
54 Ga0068853_100211088 3300005539 Bacteria 1769
55 Ga0070696_100245755 3300005546 Bacteria 1351
56 Ga0070693_100281417 3300005547 Bacteria 1114
57 Ga0070665_100000015 3300005548 Bacteria 462744
58 Ga0070665_100005863 3300005548 Bacteria 12596
59 Ga0070665_100015589 3300005548 Bacteria 7636
60 Ga0070665_100033337 3300005548 Bacteria 5183
61 Ga0070665_100080090 3300005548 Bacteria 3271
62 Ga0068855_100000337 3300005563 Bacteria 58374
63 Ga0068855_100011417 3300005563 Bacteria 10730
64 Ga0068855_100055332 3300005563 Bacteria 4661
65 Ga0068855_100061169 3300005563 Bacteria 4400
66 Ga0068855_100064884 3300005563 Bacteria 4258
67 Ga0068855_100073432 3300005563 Bacteria 3974
68 Ga0070664_100047410 3300005564 Bacteria 3630
69 Ga0068857_100105286 3300005577 Bacteria 2533
70 Ga0068857_100277354 3300005577 Bacteria 1541
71 Ga0068857_100523111 3300005577 Bacteria 1115
72 Ga0068852_100009608 3300005616 Bacteria 7187
73 Ga0068852_100110813 3300005616 Bacteria 2495
74 Ga0068852_100251175 3300005616 Bacteria 1694
75 Ga0068859_100163912 3300005617 Bacteria 2302
76 Ga0068859_100439589 3300005617 Bacteria 1401
77 Ga0068864_100088377 3300005618 Bacteria 2729
78 Ga0068866_10075291 3300005718 Bacteria 1797
79 Ga0068851_10059924 3300005834 Bacteria 1948
80 Ga0068870_10021373 3300005840 Bacteria 3164
81 Ga0068863_100285885 3300005841 Bacteria 1598
82 Ga0068858_100040329 3300005842 Bacteria 4330
83 Ga0068858_100088123 3300005842 Bacteria 2888
84 Ga0068860_100031659 3300005843 Bacteria 5084
85 Ga0068860_100088542 3300005843 Bacteria 2947
86 Ga0068862_100036186 3300005844 Bacteria 4184
87 Ga0068862_100188534 3300005844 Bacteria 1854
88 Ga0070712_100029674 3300006175 Bacteria 3668
89 Ga0097621_100006312 3300006237 Bacteria 8409
90 Ga0097621_100009210 3300006237 Bacteria 7160
91 Ga0097621_100016533 3300006237 Bacteria 5579
92 Ga0097621_100134869 3300006237 Unclassified 2105
93 Ga0068871_100000115 3300006358 Bacteria 49397
94 Ga0068871_100054115 3300006358 Unclassified 3255
95 Ga0068871_100144183 3300006358 Bacteria 2027
96 Ga0068865_100006065 3300006881 Bacteria 7369
97 Ga0068865_100295963 3300006881 Bacteria 1293
98 Ga0097620_100163914 3300006931 Bacteria 2302
99 Ga0097620_100439588 3300006931 Bacteria 1401
100 Ga0105240_10000320 3300009093 Bacteria 91422
101 Ga0105240_10007270 3300009093 Bacteria 16118
102 Ga0105240_10017405 3300009093 Bacteria 9687
103 Ga0105240_10096592 3300009093 Bacteria 3601
104 Ga0105240_10107667 3300009093 Bacteria 3379
105 Ga0105240_10165445 3300009093 Bacteria 2624
106 Ga0105240_10195599 3300009093 Bacteria 2375
107 Ga0105240_10209914 3300009093 Bacteria 2276
108 Ga0105240_10268233 3300009093 Bacteria 1967
109 Ga0105240_10529631 3300009093 Bacteria 1306
110 Ga0105241_10005337 3300009174 Bacteria 9494
111 Ga0105241_10055683 3300009174 Bacteria 3030
112 Ga0105242_10137565 3300009176 Bacteria 2116
113 Ga0105248_10000001 3300009177 Bacteria 1881304
114 Ga0105248_10358714 3300009177 Bacteria 1641
115 Ga0105237_10040086 3300009545 Bacteria 4724
116 Ga0105237_10098350 3300009545 Bacteria 2917
117 Ga0105237_10387552 3300009545 Bacteria 1402
118 Ga0105238_10004811 3300009551 Bacteria 13364
119 Ga0105238_10007449 3300009551 Bacteria 10965
120 Ga0105238_10073413 3300009551 Bacteria 3416
121 Ga0105238_10079197 3300009551 Bacteria 3276
122 Ga0105238_10156236 3300009551 Bacteria 2256
123 Ga0105249_10123234 3300009553 Bacteria 2466
124 Ga0105028_102393 3300009993 Bacteria 1971
125 Ga0105239_10006797 3300010375 Bacteria 13202
126 Ga0105239_10009929 3300010375 Bacteria 10687
127 Ga0105239_10053779 3300010375 Bacteria 4415
128 Ga0105239_10059404 3300010375 Bacteria 4196
129 Ga0105239_10095038 3300010375 Bacteria 3293
130 Ga0105239_10282886 3300010375 Bacteria 1867
131 Ga0105246_10005111 3300011119 Bacteria 7981
132 Ga0105246_10337063 3300011119 Bacteria 1231
133 Ga0157373_10062898 3300013100 Bacteria 2628
134 Ga0157371_10256629 3300013102 Bacteria 1260
135 Ga0157370_10040491 3300013104 Bacteria 4499
136 Ga0157370_10066583 3300013104 Bacteria 3406
137 Ga0157370_10109029 3300013104 Bacteria 2588
138 Ga0157370_10343858 3300013104 Bacteria 1375
139 Ga0157369_10018590 3300013105 Bacteria 7791
140 Ga0157369_10185154 3300013105 Bacteria 2190
141 Ga0157378_10052582 3300013297 Bacteria 3624
142 Ga0157378_10067673 3300013297 Bacteria 3201
143 Ga0163162_10070223 3300013306 Bacteria 3554
144 Ga0163162_10465550 3300013306 Bacteria 1396
145 Ga0157372_10015354 3300013307 Bacteria 8207
146 Ga0157372_10043272 3300013307 Bacteria 4985
147 Ga0157372_10109469 3300013307 Bacteria 3164
148 Ga0157372_10577327 3300013307 Bacteria 1310
149 Ga0157375_10047955 3300013308 Bacteria 4175
150 Ga0163163_10000016 3300014325 Bacteria 213966
151 Ga0163163_10073838 3300014325 Bacteria 3402
152 Ga0163163_10185401 3300014325 Bacteria 2129
153 Ga0157379_10000131 3300014968 Bacteria 53172
154 Ga0157379_10170632 3300014968 Bacteria 1964
155 Ga0157376_10025125 3300014969 Bacteria 4688
156 Ga0157376_10301686 3300014969 Bacteria 1516
157 Ga0157376_10454247 3300014969 Bacteria 1250
158 Ga0163161_10028835 3300017792 Bacteria 3944
159 Ga0213876_10000180 3300021384 Bacteria 65389
160 Ga0207427_103637 3300025231 Bacteria 3093
161 Ga0209233_1000006 3300025261 Bacteria 1473685
162 Ga0209233_1011918 3300025261 Bacteria 2544
163 Ga0209676_1000099 3300025292 Bacteria 230048
164 Ga0209758_1000032 3300025297 Bacteria 481623
165 Ga0209050_1001739 3300025298 Bacteria 21672
166 Ga0209257_1001124 3300025304 Bacteria 34483
167 Ga0209257_1008439 3300025304 Bacteria 5855
168 Ga0207656_10030093 3300025321 Bacteria 2240
169 Ga0207642_10051353 3300025899 Bacteria 1865
170 Ga0207680_10019727 3300025903 Bacteria 3612
171 Ga0207680_10071251 3300025903 Bacteria 2154
172 Ga0207680_10392971 3300025903 Bacteria 979
173 Ga0207645_10034067 3300025907 Bacteria 3272
174 Ga0207643_10017660 3300025908 Bacteria 3903
175 Ga0207643_10271260 3300025908 Bacteria 1050
176 Ga0207705_10000176 3300025909 Bacteria 67914
177 Ga0207705_10003684 3300025909 Bacteria 11657
178 Ga0207705_10103190 3300025909 Bacteria 2100
179 Ga0207705_10287767 3300025909 Bacteria 1259
180 Ga0207654_10007327 3300025911 Bacteria 5557
181 Ga0207707_10000005 3300025912 Bacteria 382024
182 Ga0207707_10008670 3300025912 Bacteria 8824
183 Ga0207707_10022042 3300025912 Bacteria 5568
184 Ga0207707_10177354 3300025912 Bacteria 1861
185 Ga0207695_10000227 3300025913 Bacteria 150546
186 Ga0207695_10001525 3300025913 Bacteria 38311
187 Ga0207695_10003426 3300025913 Bacteria 22378
188 Ga0207695_10019398 3300025913 Bacteria 7831
189 Ga0207695_10027489 3300025913 Bacteria 6333
190 Ga0207695_10060473 3300025913 Bacteria 3921
191 Ga0207695_10081153 3300025913 Bacteria 3283
192 Ga0207695_10175747 3300025913 Bacteria 2064
193 Ga0207695_10197511 3300025913 Bacteria 1927
194 Ga0207695_10473898 3300025913 Bacteria 1134
195 Ga0207671_10137151 3300025914 Bacteria 1882
196 Ga0207693_10031800 3300025915 Bacteria 4170
197 Ga0207660_10000225 3300025917 Bacteria 36445
198 Ga0207660_10000859 3300025917 Bacteria 20037
199 Ga0207660_10001363 3300025917 Bacteria 16372
200 Ga0207657_10000129 3300025919 Bacteria 75856
201 Ga0207657_10002111 3300025919 Bacteria 21491
202 Ga0207657_10008562 3300025919 Bacteria 10367
203 Ga0207657_10028100 3300025919 Bacteria 5139
204 Ga0207657_10178409 3300025919 Bacteria 1718
205 Ga0207649_10000078 3300025920 Bacteria 82996
206 Ga0207652_10000167 3300025921 Bacteria 71212
207 Ga0207652_10000860 3300025921 Bacteria 28771
208 Ga0207652_10012563 3300025921 Bacteria 6844
209 Ga0207652_10013970 3300025921 Bacteria 6502
210 Ga0207652_10106022 3300025921 Bacteria 2487
211 Ga0207694_10000005 3300025924 Bacteria 823704
212 Ga0207694_10012744 3300025924 Bacteria 6334
213 Ga0207694_10053049 3300025924 Bacteria 3143
214 Ga0207694_10063569 3300025924 Bacteria 2875
215 Ga0207694_10077230 3300025924 Bacteria 2609
216 Ga0207694_10081429 3300025924 Bacteria 2543
217 Ga0207694_10176043 3300025924 Bacteria 1734
218 Ga0207659_10034938 3300025926 Bacteria 3471
219 Ga0207687_10059896 3300025927 Bacteria 2684
220 Ga0207700_10049515 3300025928 Bacteria 3126
221 Ga0207690_10000104 3300025932 Bacteria 68527
222 Ga0207690_10025255 3300025932 Bacteria 3728
223 Ga0207690_10115337 3300025932 Bacteria 1941
224 Ga0207686_10063385 3300025934 Bacteria 2350
225 Ga0207709_10006393 3300025935 Bacteria 6614
226 Ga0207669_10499506 3300025937 Bacteria 973
227 Ga0207704_10007033 3300025938 Bacteria 5287
228 Ga0207711_10000002 3300025941 Bacteria 1228676
229 Ga0207711_10081176 3300025941 Bacteria 2833
230 Ga0207711_10203125 3300025941 Bacteria 1809
231 Ga0207689_10011356 3300025942 Bacteria 7637
232 Ga0207689_10165439 3300025942 Bacteria 1822
233 Ga0207661_10150823 3300025944 Bacteria 2009
234 Ga0207679_10229927 3300025945 Bacteria 1565
235 Ga0207667_10000011 3300025949 Bacteria 447785
236 Ga0207667_10064990 3300025949 Bacteria 3807
237 Ga0207667_10093308 3300025949 Bacteria 3108
238 Ga0207667_10095865 3300025949 Bacteria 3062
239 Ga0207667_10116933 3300025949 Bacteria 2748
240 Ga0207651_10037620 3300025960 Bacteria 3172
241 Ga0207668_10014113 3300025972 Bacteria 4940
242 Ga0207658_10078392 3300025986 Bacteria 2524
243 Ga0207658_10080715 3300025986 Bacteria 2492
244 Ga0207658_10344433 3300025986 Bacteria 1296
245 Ga0207677_10006599 3300026023 Bacteria 6367
246 Ga0207677_10010453 3300026023 Bacteria 5252
247 Ga0207703_10028432 3300026035 Bacteria 4407
248 Ga0207703_10030181 3300026035 Bacteria 4283
249 Ga0207639_10038442 3300026041 Bacteria 3559
250 Ga0207639_10186464 3300026041 Bacteria 1769
251 Ga0207639_10338629 3300026041 Bacteria 1340
252 Ga0207678_10128520 3300026067 Bacteria 2161
253 Ga0207708_10071841 3300026075 Bacteria 2651
254 Ga0207702_10121562 3300026078 Bacteria 2338
255 Ga0207702_10248647 3300026078 Bacteria 1669
256 Ga0207702_10339878 3300026078 Bacteria 1434
257 Ga0207641_10025816 3300026088 Bacteria 4845
258 Ga0207641_10100380 3300026088 Bacteria 2549
259 Ga0207648_10033092 3300026089 Bacteria 4560
260 Ga0207674_10082953 3300026116 Bacteria 3205
261 Ga0207674_10091013 3300026116 Bacteria 3041
262 Ga0207674_10315025 3300026116 Bacteria 1514
263 Ga0207674_10329407 3300026116 Bacteria 1477
264 Ga0207675_100110911 3300026118 Bacteria 2588
265 Ga0207683_10006132 3300026121 Bacteria 10297
266 Ga0207683_10452748 3300026121 Bacteria 1183
267 Ga0207698_10010990 3300026142 Bacteria 5851
268 Ga0207698_10053241 3300026142 Bacteria 3105
269 Ga0209999_1001803 3300027543 Bacteria 3716
270 Ga0209983_1003232 3300027665 Bacteria 3495
271 Ga0268266_10000005 3300028379 Bacteria 1448194
272 Ga0268266_10001112 3300028379 Bacteria 33635
273 Ga0268266_10005719 3300028379 Bacteria 11523
274 Ga0268266_10014379 3300028379 Bacteria 6807
275 Ga0268266_10074735 3300028379 Bacteria 2943
276 Ga0268266_10088464 3300028379 Bacteria 2710
277 Ga0268266_10160643 3300028379 Bacteria 2032
278 Ga0268265_10026810 3300028380 Bacteria 4103
279 Ga0268265_10086661 3300028380 Bacteria 2489
280 Ga0268264_10247472 3300028381 Bacteria 1654
281 Ga0265338_10000005 3300028800 Bacteria 571137
282 Ga0265338_10033015 3300028800 Bacteria 5034
283 Ga0265338_10093984 3300028800 Bacteria 2468
284 Ga0307511_10002785 3300030521 Bacteria 18154
285 Ga0265332_10045556 3300031238 Bacteria 1890
286 Ga0265325_10000010 3300031241 Bacteria 172391
287 Ga0265329_10021417 3300031242 Bacteria 2172
288 Ga0265339_10000795 3300031249 Bacteria 24360
289 Ga0265339_10147135 3300031249 Bacteria 1194
290 Ga0265331_10000011 3300031250 Bacteria 308171
291 Ga0265331_10000506 3300031250 Bacteria 36469
292 Ga0265331_10002615 3300031250 Bacteria 12085
293 Ga0265331_10110498 3300031250 Bacteria 1261
294 Ga0265327_10000007 3300031251 Bacteria 678515
295 Ga0265327_10000550 3300031251 Bacteria 64087
296 Ga0265316_10131069 3300031344 Bacteria 1888
297 Ga0307513_10000303 3300031456 Bacteria 70737
298 Ga0307513_10009475 3300031456 Bacteria 12315
299 Ga0265313_10002887 3300031595 Bacteria 14391
300 Ga0265313_10018877 3300031595 Bacteria 3858
301 Ga0265313_10030107 3300031595 Bacteria 2799
302 Ga0265314_10011597 3300031711 Bacteria 7259
303 Ga0265314_10017097 3300031711 Bacteria 5702
304 Ga0265314_10020998 3300031711 Bacteria 5033
305 Ga0265314_10045152 3300031711 Bacteria 3117
306 Ga0265314_10051281 3300031711 Bacteria 2875
307 Ga0265314_10164556 3300031711 Bacteria 1346
308 Ga0265314_10192496 3300031711 Bacteria 1212
309 Ga0265342_10073471 3300031712 Bacteria 1989
310 Ga0265342_10073909 3300031712 Bacteria 1982
311 Ga0265342_10094231 3300031712 Bacteria 1713
312 Ga0373931_0092344 3300035691 Bacteria 1688
313 Ga0373947_0039997 3300035725 Bacteria 2792
314 Ga0373925_0169905 3300037068 Bacteria 1721
315 Ga0395899_0034038 3300037312 Bacteria 3825
316 Ga0395900_0013150 3300037418 Bacteria 8458
317 Ga0395900_0023010 3300037418 Bacteria 6378
318 Ga0395898_0054770 3300037466 Bacteria 3891
319 Ga0395898_0110112 3300037466 Bacteria 2640
320 Ga0395905_0037085 3300037471 Bacteria 4578
321 Ga0395905_0051348 3300037471 Bacteria 3862
322 Ga0436365_0508484 3300039437 Bacteria 190091
323 Ga0436363_0825924 3300039450 Bacteria 1908
324 Ga0436363_1573478 3300039450 Bacteria 2515
325 Ga0436363_1694114 3300039450 Bacteria 4161
326 Ga0466964_0060300 3300044706 Bacteria 1578
327 Ga0466957_0086773 3300044842 Bacteria 1956
328 Ga0466960_0185863 3300044901 Bacteria 1129
329 Ga0451576_0211808 3300045051 Bacteria 2024
330 Ga0495629_0012192 3300046459 Bacteria 6228
331 Ga0495580_0013259 3300046472 Bacteria 6301
332 Ga0495582_0075599 3300046473 Bacteria 1866
333 Ga0495664_0137213 3300046477 Bacteria 1482
334 Ga0495606_0186103 3300046507 Bacteria 1194
335 Ga0495652_0103044 3300046529 Bacteria 2311
336 Ga0495586_0084739 3300046535 Bacteria 1745
337 Ga0495587_0264751 3300046536 Bacteria 965
338 Ga0495645_0032514 3300046543 Bacteria 3806
339 Ga0495622_0002281 3300046557 Bacteria 9330
340 Ga0495668_0033110 3300046616 Bacteria 2905
341 Ga0495658_0001569 3300046683 Bacteria 11924
342 Ga0495672_0164389 3300047320 Bacteria 1138
343 Ga0495681_0048516 3300047470 Bacteria 2012
344 Ga0496115_0003862 3300048918 Bacteria 10804
345 Ga0496121_0003690 3300048924 Bacteria 21494
346 Ga0496122_0064617 3300048925 Bacteria 2661
347 Ga0495682_0001167 3300049460 Bacteria 15069
348 Ga0501032_0006860 3300049569 Bacteria 8348
349 Ga0501033_0002531 3300049570 Bacteria 15473
350 Ga0501033_0004911 3300049570 Bacteria 10641
351 Ga0501033_0028633 3300049570 Bacteria 4184
352 Ga0501033_0042324 3300049570 Bacteria 3396
353 Ga0501033_0111164 3300049570 Bacteria 1994
354 Ga0501033_0250093 3300049570 Bacteria 1256
355 Ga0501034_0001907 3300049571 Bacteria 26379
356 Ga0501036_0006200 3300049572 Bacteria 9703
357 Ga0501036_0010560 3300049572 Bacteria 7628
358 Ga0501036_0030965 3300049572 Bacteria 4521
359 Ga0501036_0102484 3300049572 Bacteria 2421
360 Ga0501037_0002268 3300049573 Bacteria 13893
361 Ga0501038_0055936 3300049574 Bacteria 3388
362 Ga0501038_0088089 3300049574 Bacteria 2606
363 Ga0501039_0014104 3300049575 Bacteria 6118
364 Ga0501043_0006384 3300049579 Bacteria 9469
365 Ga0501043_0020126 3300049579 Bacteria 5237
366 Ga0501043_0025535 3300049579 Bacteria 4636
367 Ga0501043_0190633 3300049579 Bacteria 1594
368 Ga0501046_0001650 3300049580 Bacteria 21369
369 Ga0501046_0041407 3300049580 Bacteria 3676
370 Ga0501046_0078241 3300049580 Bacteria 2558
371 Ga0501047_0001643 3300049581 Bacteria 21798
372 Ga0501047_0001899 3300049581 Bacteria 20092
373 Ga0501047_0002583 3300049581 Bacteria 17234
374 Ga0501047_0005483 3300049581 Bacteria 11937
375 Ga0501047_0009833 3300049581 Bacteria 9038
376 Ga0501047_0020311 3300049581 Bacteria 6379
377 Ga0501047_0022691 3300049581 Bacteria 6024
378 Ga0501047_0023477 3300049581 Bacteria 5921
379 Ga0501047_0093544 3300049581 Bacteria 2885
380 Ga0501047_0178957 3300049581 Bacteria 1987
381 Ga0501047_0525058 3300049581 Bacteria 1009
382 Ga0501048_0004835 3300049582 Bacteria 10269
383 Ga0501067_0012986 3300049583 Bacteria 4611
384 Ga0501067_0029438 3300049583 Bacteria 3043
385 Ga0501068_0034114 3300049584 Bacteria 3034
386 Ga0501069_0003859 3300049585 Bacteria 7720
387 Ga0501070_0007811 3300049586 Bacteria 9067
388 Ga0501070_0011754 3300049586 Bacteria 7395
389 Ga0501070_0205522 3300049586 Bacteria 1617
390 Ga0501072_0009648 3300049588 Bacteria 7343
391 Ga0501072_0075467 3300049588 Bacteria 2667
392 Ga0501073_0018810 3300049589 Bacteria 4992
393 Ga0501073_0036812 3300049589 Bacteria 3475
394 Ga0501073_0303649 3300049589 Bacteria 1101
395 Ga0501074_0027610 3300049590 Bacteria 4115
396 Ga0501074_0140487 3300049590 Bacteria 1727
397 Ga0501079_0008217 3300049741 Bacteria 7912
398 Ga0501080_0039510 3300049742 Bacteria 4403
399 Ga0501080_0048574 3300049742 Bacteria 3949
400 Ga0501080_0100762 3300049742 Bacteria 2679
401 Ga0501080_0120183 3300049742 Bacteria 2435
402 Ga0501080_0129917 3300049742 Bacteria 2332
403 Ga0501083_0001727 3300049744 Bacteria 14885
404 Ga0501083_0028080 3300049744 Bacteria 3880
405 Ga0501035_0079801 3300049822 Bacteria 2890
406 Ga0501035_0139171 3300049822 Bacteria 2111
407 Ga0501035_0196340 3300049822 Bacteria 1733
408 Ga0501035_0260623 3300049822 Bacteria 1470
409 Ga0501044_0005399 3300049823 Bacteria 14195
410 Ga0501044_0011647 3300049823 Bacteria 9532
411 Ga0501044_0041008 3300049823 Bacteria 4820
412 Ga0501044_0044686 3300049823 Bacteria 4595
413 Ga0501044_0200593 3300049823 Bacteria 1953
414 Ga0501044_0349851 3300049823 Bacteria 1397
415 Ga0501044_0437358 3300049823 Bacteria 1216
416 nmdc:mga0yw44_153329_c1 3300050492 Bacteria 1504
417 nmdc:mga0k408_19274_c1 3300050493 Bacteria 3811
418 Ga0500643_000008 3300053087 Bacteria 457931
419 Ga0500641_0011334 3300053096 Bacteria 3235
420 Ga0500595_001571 3300053119 Bacteria 12071
421 Ga0500595_003949 3300053119 Bacteria 6780
422 Ga0500595_012172 3300053119 Bacteria 3336
423 Ga0500573_0000051 3300053140 Bacteria 95469
424 Ga0500622_0032678 3300053156 Bacteria 2728
425 Ga0501084_0000042 3300054114 Bacteria 100450
426 Ga0501084_0076765 3300054114 Bacteria 2800
427 Ga0501082_0003200 3300060353 Bacteria 14271
428 Ga0501082_0013240 3300060353 Bacteria 7093
429 Ga0501082_0567950 3300060353 Bacteria 992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046536 Ga0495587_0264751 Ga0495587_0264751_47_790 247
2 3300026116 Ga0207674_10315025 Ga0207674_103150251 249
3 3300049581 Ga0501047_0005483 Ga0501047_0005483_11146_11922 257
4 3300025908 Ga0207643_10271260 Ga0207643_102712601 263
5 3300031711 Ga0265314_10051281 Ga0265314_100512812 263
6 3300025913 Ga0207695_10003426 Ga0207695_1000342624 264
7 3300049744 Ga0501083_0028080 Ga0501083_0028080_3038_3862 274
8 3300025261 Ga0209233_1011918 Ga0209233_10119182 282
9 3300025934 Ga0207686_10063385 Ga0207686_100633853 282
10 3300005577 Ga0068857_100523111 Ga0068857_1005231112 284
11 3300049586 Ga0501070_0011754 Ga0501070_0011754_5650_6561 284
12 3300006237 Ga0097621_100134869 Ga0097621_1001348692 285
13 3300006358 Ga0068871_100054115 Ga0068871_1000541154 285
14 3300028800 Ga0265338_10033015 Ga0265338_100330155 285
15 3300031249 Ga0265339_10147135 Ga0265339_101471352 285
16 3300031344 Ga0265316_10131069 Ga0265316_101310692 285
17 3300031711 Ga0265314_10045152 Ga0265314_100451522 285
18 3300031712 Ga0265342_10094231 Ga0265342_100942312 285
19 3300035691 Ga0373931_0092344 Ga0373931_0092344_73_984 285
20 3300049822 Ga0501035_0260623 Ga0501035_0260623_575_1432 285
21 3300009093 Ga0105240_10165445 Ga0105240_101654451 288
22 3300025913 Ga0207695_10175747 Ga0207695_101757471 288
23 3300031456 Ga0307513_10009475 Ga0307513_100094759 288
24 3300026023 Ga0207677_10010453 Ga0207677_100104535 290
25 3300039450 Ga0436363_1694114 Ga0436363_1694114_1119_2030 291
26 3300013306 Ga0163162_10465550 Ga0163162_104655502 292
27 3300039450 Ga0436363_1573478 Ga0436363_1573478_264_1157 296
28 iso_pu_bacteria 2585428106 2587915819 296
29 iso_pu_bacteria 2643221640 2644224318 296
30 iso_pu_bacteria 2643221642 2644234746 296
31 iso_pu_bacteria 2928531327 2928532573 296
32 3300045051 Ga0451576_0211808 Ga0451576_0211808_111_1007 297
33 3300009093 Ga0105240_10529631 Ga0105240_105296312 298
34 3300026078 Ga0207702_10339878 Ga0207702_103398782 298
35 3300003791 Ga0055530_10007107 Ga0055530_100071071 299
36 3300003794 Ga0055531_10002462 Ga0055531_1000246212 299
37 3300005262 Ga0065165_1014044 Ga0065165_10140442 299
38 3300005327 Ga0070658_10300900 Ga0070658_103009001 299
39 3300005336 Ga0070680_100000120 Ga0070680_10000012045 299
40 3300005339 Ga0070660_100230037 Ga0070660_1002300372 299
41 3300005347 Ga0070668_100016416 Ga0070668_1000164162 299
42 3300005366 Ga0070659_100000056 Ga0070659_1000000563 299
43 3300005366 Ga0070659_100002457 Ga0070659_10000245714 299
44 3300005366 Ga0070659_100006567 Ga0070659_1000065677 299
45 3300005458 Ga0070681_10024276 Ga0070681_100242762 299
46 3300005530 Ga0070679_100048085 Ga0070679_1000480851 299
47 3300005539 Ga0068853_100211088 Ga0068853_1002110881 299
48 3300005548 Ga0070665_100000015 Ga0070665_100000015321 299
49 3300005563 Ga0068855_100055332 Ga0068855_1000553322 299
50 3300005564 Ga0070664_100047410 Ga0070664_1000474102 299
51 3300005844 Ga0068862_100036186 Ga0068862_1000361864 299
52 3300005844 Ga0068862_100188534 Ga0068862_1001885342 299
53 3300009093 Ga0105240_10007270 Ga0105240_1000727012 299
54 3300009093 Ga0105240_10107667 Ga0105240_101076673 299
55 3300009093 Ga0105240_10268233 Ga0105240_102682332 299
56 3300025292 Ga0209676_1000099 Ga0209676_1000099166 299
57 3300025298 Ga0209050_1001739 Ga0209050_100173918 299
58 3300025304 Ga0209257_1001124 Ga0209257_100112427 299
59 3300025304 Ga0209257_1008439 Ga0209257_10084393 299
60 3300025909 Ga0207705_10003684 Ga0207705_100036847 299
61 3300025909 Ga0207705_10103190 Ga0207705_101031902 299
62 3300025909 Ga0207705_10287767 Ga0207705_102877672 299
63 3300025913 Ga0207695_10001525 Ga0207695_1000152515 299
64 3300025913 Ga0207695_10081153 Ga0207695_100811533 299
65 3300025913 Ga0207695_10473898 Ga0207695_104738981 299
66 3300025917 Ga0207660_10001363 Ga0207660_1000136318 299
67 3300025919 Ga0207657_10008562 Ga0207657_100085622 299
68 3300025919 Ga0207657_10178409 Ga0207657_101784091 299
69 3300025921 Ga0207652_10012563 Ga0207652_100125633 299
70 3300025924 Ga0207694_10176043 Ga0207694_101760432 299
71 3300025932 Ga0207690_10000104 Ga0207690_1000010432 299
72 3300025932 Ga0207690_10115337 Ga0207690_101153372 299
73 3300025945 Ga0207679_10229927 Ga0207679_102299272 299
74 3300025949 Ga0207667_10093308 Ga0207667_100933081 299
75 3300025972 Ga0207668_10014113 Ga0207668_100141132 299
76 3300026041 Ga0207639_10186464 Ga0207639_101864642 299
77 3300026088 Ga0207641_10100380 Ga0207641_101003801 299
78 3300027543 Ga0209999_1001803 Ga0209999_10018033 299
79 3300027665 Ga0209983_1003232 Ga0209983_10032322 299
80 3300028379 Ga0268266_10000005 Ga0268266_10000005797 299
81 3300028380 Ga0268265_10026810 Ga0268265_100268106 299
82 3300028380 Ga0268265_10086661 Ga0268265_100866612 299
83 3300030521 Ga0307511_10002785 Ga0307511_100027858 299
84 3300031251 Ga0265327_10000550 Ga0265327_1000055024 299
85 3300031456 Ga0307513_10000303 Ga0307513_1000030339 299
86 3300037312 Ga0395899_0034038 Ga0395899_0034038_1080_1985 299
87 3300037418 Ga0395900_0023010 Ga0395900_0023010_124_1029 299
88 3300037466 Ga0395898_0110112 Ga0395898_0110112_1109_2014 299
89 3300037471 Ga0395905_0037085 Ga0395905_0037085_1477_2382 299
90 3300037471 Ga0395905_0051348 Ga0395905_0051348_2846_3751 299
91 3300044706 Ga0466964_0060300 Ga0466964_0060300_481_1386 299
92 3300044901 Ga0466960_0185863 Ga0466960_0185863_144_1046 299
93 3300046616 Ga0495668_0033110 Ga0495668_0033110_703_1608 299
94 3300048918 Ga0496115_0003862 Ga0496115_0003862_7046_7951 299
95 3300049581 Ga0501047_0023477 Ga0501047_0023477_282_1187 299
96 3300050492 nmdc:mga0yw44_153329_c1 nmdc:mga0yw44_153329_c1_306_1208 299
97 3300050493 nmdc:mga0k408_19274_c1 nmdc:mga0k408_19274_c1_1894_2799 299
98 3300053096 Ga0500641_0011334 Ga0500641_0011334_2318_3223 299
99 3300053119 Ga0500595_001571 Ga0500595_001571_3626_4531 299
100 3300053119 Ga0500595_012172 Ga0500595_012172_1499_2401 299
101 3300053156 Ga0500622_0032678 Ga0500622_0032678_1739_2644 299
102 3300049823 Ga0501044_0200593 Ga0501044_0200593_297_1202 300
103 iso_pu_bacteria 2897803580 2897807042 300
104 3300013307 Ga0157372_10109469 Ga0157372_101094693 301
105 3300025912 Ga0207707_10177354 Ga0207707_101773542 301
106 3300025913 Ga0207695_10027489 Ga0207695_100274894 301
107 3300054114 Ga0501084_0000042 Ga0501084_0000042_7313_8218 301
108 3300060353 Ga0501082_0567950 Ga0501082_0567950_44_949 301
109 iso_pu_bacteria 2643221603 2644027167 301
110 3300013307 Ga0157372_10043272 Ga0157372_100432724 302
111 3300048925 Ga0496122_0064617 Ga0496122_0064617_1007_1960 302
112 3300003215 JGI25153J46596_10000526 JGI25153J46596_100005268 303
113 3300005327 Ga0070658_10001580 Ga0070658_1000158013 303
114 3300005327 Ga0070658_10016145 Ga0070658_100161452 303
115 3300005327 Ga0070658_10127818 Ga0070658_101278181 303
116 3300005328 Ga0070676_10007423 Ga0070676_100074238 303
117 3300005329 Ga0070683_100039915 Ga0070683_1000399155 303
118 3300005330 Ga0070690_100061378 Ga0070690_1000613782 303
119 3300005334 Ga0068869_100001709 Ga0068869_1000017092 303
120 3300005334 Ga0068869_100138390 Ga0068869_1001383902 303
121 3300005334 Ga0068869_100169866 Ga0068869_1001698662 303
122 3300005335 Ga0070666_10002182 Ga0070666_1000218212 303
123 3300005335 Ga0070666_10164702 Ga0070666_101647022 303
124 3300005335 Ga0070666_10216839 Ga0070666_102168391 303
125 3300005336 Ga0070680_100000428 Ga0070680_10000042816 303
126 3300005338 Ga0068868_100009116 Ga0068868_1000091166 303
127 3300005338 Ga0068868_100117833 Ga0068868_1001178332 303
128 3300005338 Ga0068868_100188905 Ga0068868_1001889051 303
129 3300005339 Ga0070660_100058184 Ga0070660_1000581842 303
130 3300005339 Ga0070660_100123799 Ga0070660_1001237993 303
131 3300005339 Ga0070660_100516206 Ga0070660_1005162061 303
132 3300005341 Ga0070691_10003284 Ga0070691_100032844 303
133 3300005344 Ga0070661_100000300 Ga0070661_10000030031 303
134 3300005344 Ga0070661_100036838 Ga0070661_1000368383 303
135 3300005354 Ga0070675_100058662 Ga0070675_1000586622 303
136 3300005364 Ga0070673_100093806 Ga0070673_1000938062 303
137 3300005366 Ga0070659_100114360 Ga0070659_1001143601 303
138 3300005367 Ga0070667_100057419 Ga0070667_1000574192 303
139 3300005367 Ga0070667_100117998 Ga0070667_1001179982 303
140 3300005439 Ga0070711_100009422 Ga0070711_1000094224 303
141 3300005455 Ga0070663_100153813 Ga0070663_1001538131 303
142 3300005456 Ga0070678_100005783 Ga0070678_1000057834 303
143 3300005458 Ga0070681_10000005 Ga0070681_1000000547 303
144 3300005458 Ga0070681_10233092 Ga0070681_102330922 303
145 3300005459 Ga0068867_100013145 Ga0068867_1000131454 303
146 3300005459 Ga0068867_100022140 Ga0068867_1000221402 303
147 3300005530 Ga0070679_100000862 Ga0070679_10000086219 303
148 3300005530 Ga0070679_100003839 Ga0070679_1000038393 303
149 3300005535 Ga0070684_100066169 Ga0070684_1000661694 303
150 3300005535 Ga0070684_100097922 Ga0070684_1000979223 303
151 3300005539 Ga0068853_100056354 Ga0068853_1000563545 303
152 3300005539 Ga0068853_100121566 Ga0068853_1001215663 303
153 3300005546 Ga0070696_100245755 Ga0070696_1002457552 303
154 3300005547 Ga0070693_100281417 Ga0070693_1002814171 303
155 3300005548 Ga0070665_100005863 Ga0070665_1000058638 303
156 3300005548 Ga0070665_100015589 Ga0070665_1000155899 303
157 3300005548 Ga0070665_100033337 Ga0070665_1000333374 303
158 3300005548 Ga0070665_100080090 Ga0070665_1000800903 303
159 3300005563 Ga0068855_100000337 Ga0068855_10000033763 303
160 3300005563 Ga0068855_100011417 Ga0068855_1000114172 303
161 3300005563 Ga0068855_100061169 Ga0068855_1000611692 303
162 3300005563 Ga0068855_100064884 Ga0068855_1000648842 303
163 3300005563 Ga0068855_100073432 Ga0068855_1000734323 303
164 3300005577 Ga0068857_100105286 Ga0068857_1001052864 303
165 3300005577 Ga0068857_100277354 Ga0068857_1002773541 303
166 3300005616 Ga0068852_100009608 Ga0068852_1000096083 303
167 3300005616 Ga0068852_100110813 Ga0068852_1001108132 303
168 3300005616 Ga0068852_100251175 Ga0068852_1002511752 303
169 3300005617 Ga0068859_100163912 Ga0068859_1001639122 303
170 3300005617 Ga0068859_100439589 Ga0068859_1004395892 303
171 3300005618 Ga0068864_100088377 Ga0068864_1000883772 303
172 3300005718 Ga0068866_10075291 Ga0068866_100752912 303
173 3300005834 Ga0068851_10059924 Ga0068851_100599241 303
174 3300005840 Ga0068870_10021373 Ga0068870_100213735 303
175 3300005841 Ga0068863_100285885 Ga0068863_1002858852 303
176 3300005842 Ga0068858_100040329 Ga0068858_1000403292 303
177 3300005842 Ga0068858_100088123 Ga0068858_1000881234 303
178 3300005843 Ga0068860_100031659 Ga0068860_1000316596 303
179 3300005843 Ga0068860_100088542 Ga0068860_1000885422 303
180 3300006175 Ga0070712_100029674 Ga0070712_1000296742 303
181 3300006237 Ga0097621_100006312 Ga0097621_1000063128 303
182 3300006237 Ga0097621_100009210 Ga0097621_1000092106 303
183 3300006237 Ga0097621_100016533 Ga0097621_1000165334 303
184 3300006358 Ga0068871_100000115 Ga0068871_1000001155 303
185 3300006358 Ga0068871_100144183 Ga0068871_1001441832 303
186 3300006881 Ga0068865_100006065 Ga0068865_1000060654 303
187 3300006881 Ga0068865_100295963 Ga0068865_1002959631 303
188 3300006931 Ga0097620_100163914 Ga0097620_1001639142 303
189 3300006931 Ga0097620_100439588 Ga0097620_1004395882 303
190 3300009093 Ga0105240_10000320 Ga0105240_1000032092 303
191 3300009093 Ga0105240_10017405 Ga0105240_100174053 303
192 3300009093 Ga0105240_10096592 Ga0105240_100965922 303
193 3300009093 Ga0105240_10195599 Ga0105240_101955992 303
194 3300009093 Ga0105240_10209914 Ga0105240_102099143 303
195 3300009174 Ga0105241_10005337 Ga0105241_100053378 303
196 3300009174 Ga0105241_10055683 Ga0105241_100556833 303
197 3300009176 Ga0105242_10137565 Ga0105242_101375652 303
198 3300009177 Ga0105248_10000001 Ga0105248_10000001148 303
199 3300009177 Ga0105248_10358714 Ga0105248_103587141 303
200 3300009545 Ga0105237_10040086 Ga0105237_100400866 303
201 3300009545 Ga0105237_10098350 Ga0105237_100983504 303
202 3300009545 Ga0105237_10387552 Ga0105237_103875522 303
203 3300009551 Ga0105238_10004811 Ga0105238_100048116 303
204 3300009551 Ga0105238_10007449 Ga0105238_100074495 303
205 3300009551 Ga0105238_10073413 Ga0105238_100734133 303
206 3300009551 Ga0105238_10079197 Ga0105238_100791971 303
207 3300009551 Ga0105238_10156236 Ga0105238_101562363 303
208 3300009553 Ga0105249_10123234 Ga0105249_101232343 303
209 3300009993 Ga0105028_102393 Ga0105028_1023932 303
210 3300010375 Ga0105239_10006797 Ga0105239_1000679713 303
211 3300010375 Ga0105239_10009929 Ga0105239_1000992911 303
212 3300010375 Ga0105239_10053779 Ga0105239_100537795 303
213 3300010375 Ga0105239_10059404 Ga0105239_100594043 303
214 3300010375 Ga0105239_10095038 Ga0105239_100950382 303
215 3300010375 Ga0105239_10282886 Ga0105239_102828861 303
216 3300011119 Ga0105246_10005111 Ga0105246_100051116 303
217 3300011119 Ga0105246_10337063 Ga0105246_103370632 303
218 3300013100 Ga0157373_10062898 Ga0157373_100628981 303
219 3300013102 Ga0157371_10256629 Ga0157371_102566292 303
220 3300013104 Ga0157370_10040491 Ga0157370_100404913 303
221 3300013104 Ga0157370_10066583 Ga0157370_100665832 303
222 3300013104 Ga0157370_10109029 Ga0157370_101090292 303
223 3300013104 Ga0157370_10343858 Ga0157370_103438582 303
224 3300013105 Ga0157369_10018590 Ga0157369_100185904 303
225 3300013105 Ga0157369_10185154 Ga0157369_101851543 303
226 3300013297 Ga0157378_10052582 Ga0157378_100525822 303
227 3300013297 Ga0157378_10067673 Ga0157378_100676731 303
228 3300013306 Ga0163162_10070223 Ga0163162_100702234 303
229 3300013307 Ga0157372_10015354 Ga0157372_100153548 303
230 3300013307 Ga0157372_10577327 Ga0157372_105773272 303
231 3300013308 Ga0157375_10047955 Ga0157375_100479554 303
232 3300014325 Ga0163163_10000016 Ga0163163_1000001627 303
233 3300014325 Ga0163163_10073838 Ga0163163_100738382 303
234 3300014325 Ga0163163_10185401 Ga0163163_101854012 303
235 3300014968 Ga0157379_10000131 Ga0157379_100001318 303
236 3300014968 Ga0157379_10170632 Ga0157379_101706322 303
237 3300014969 Ga0157376_10025125 Ga0157376_100251252 303
238 3300014969 Ga0157376_10301686 Ga0157376_103016862 303
239 3300014969 Ga0157376_10454247 Ga0157376_104542471 303
240 3300017792 Ga0163161_10028835 Ga0163161_100288352 303
241 3300021384 Ga0213876_10000180 Ga0213876_1000018014 303
242 3300025231 Ga0207427_103637 Ga0207427_1036373 303
243 3300025261 Ga0209233_1000006 Ga0209233_10000061265 303
244 3300025297 Ga0209758_1000032 Ga0209758_100003265 303
245 3300025321 Ga0207656_10030093 Ga0207656_100300932 303
246 3300025899 Ga0207642_10051353 Ga0207642_100513532 303
247 3300025903 Ga0207680_10019727 Ga0207680_100197272 303
248 3300025903 Ga0207680_10071251 Ga0207680_100712512 303
249 3300025903 Ga0207680_10392971 Ga0207680_103929711 303
250 3300025907 Ga0207645_10034067 Ga0207645_100340672 303
251 3300025908 Ga0207643_10017660 Ga0207643_100176606 303
252 3300025909 Ga0207705_10000176 Ga0207705_1000017629 303
253 3300025911 Ga0207654_10007327 Ga0207654_100073278 303
254 3300025912 Ga0207707_10000005 Ga0207707_10000005206 303
255 3300025912 Ga0207707_10008670 Ga0207707_1000867010 303
256 3300025912 Ga0207707_10022042 Ga0207707_100220425 303
257 3300025913 Ga0207695_10000227 Ga0207695_10000227149 303
258 3300025913 Ga0207695_10019398 Ga0207695_100193988 303
259 3300025913 Ga0207695_10060473 Ga0207695_100604732 303
260 3300025913 Ga0207695_10197511 Ga0207695_101975112 303
261 3300025914 Ga0207671_10137151 Ga0207671_101371512 303
262 3300025915 Ga0207693_10031800 Ga0207693_100318002 303
263 3300025917 Ga0207660_10000225 Ga0207660_100002256 303
264 3300025917 Ga0207660_10000859 Ga0207660_1000085921 303
265 3300025919 Ga0207657_10000129 Ga0207657_1000012911 303
266 3300025919 Ga0207657_10002111 Ga0207657_1000211127 303
267 3300025919 Ga0207657_10028100 Ga0207657_100281002 303
268 3300025920 Ga0207649_10000078 Ga0207649_1000007812 303
269 3300025921 Ga0207652_10000167 Ga0207652_1000016752 303
270 3300025921 Ga0207652_10000860 Ga0207652_1000086025 303
271 3300025921 Ga0207652_10013970 Ga0207652_100139702 303
272 3300025921 Ga0207652_10106022 Ga0207652_101060222 303
273 3300025924 Ga0207694_10000005 Ga0207694_10000005593 303
274 3300025924 Ga0207694_10012744 Ga0207694_100127446 303
275 3300025924 Ga0207694_10053049 Ga0207694_100530494 303
276 3300025924 Ga0207694_10063569 Ga0207694_100635691 303
277 3300025924 Ga0207694_10077230 Ga0207694_100772302 303
278 3300025924 Ga0207694_10081429 Ga0207694_100814292 303
279 3300025926 Ga0207659_10034938 Ga0207659_100349385 303
280 3300025927 Ga0207687_10059896 Ga0207687_100598962 303
281 3300025928 Ga0207700_10049515 Ga0207700_100495152 303
282 3300025932 Ga0207690_10025255 Ga0207690_100252554 303
283 3300025935 Ga0207709_10006393 Ga0207709_100063939 303
284 3300025937 Ga0207669_10499506 Ga0207669_104995061 303
285 3300025938 Ga0207704_10007033 Ga0207704_100070335 303
286 3300025941 Ga0207711_10000002 Ga0207711_10000002849 303
287 3300025941 Ga0207711_10081176 Ga0207711_100811762 303
288 3300025941 Ga0207711_10203125 Ga0207711_102031252 303
289 3300025942 Ga0207689_10011356 Ga0207689_100113565 303
290 3300025942 Ga0207689_10165439 Ga0207689_101654392 303
291 3300025944 Ga0207661_10150823 Ga0207661_101508232 303
292 3300025949 Ga0207667_10000011 Ga0207667_100000112 303
293 3300025949 Ga0207667_10064990 Ga0207667_100649901 303
294 3300025949 Ga0207667_10095865 Ga0207667_100958651 303
295 3300025949 Ga0207667_10116933 Ga0207667_101169332 303
296 3300025960 Ga0207651_10037620 Ga0207651_100376203 303
297 3300025986 Ga0207658_10078392 Ga0207658_100783921 303
298 3300025986 Ga0207658_10080715 Ga0207658_100807151 303
299 3300025986 Ga0207658_10344433 Ga0207658_103444331 303
300 3300026023 Ga0207677_10006599 Ga0207677_100065992 303
301 3300026035 Ga0207703_10028432 Ga0207703_100284325 303
302 3300026035 Ga0207703_10030181 Ga0207703_100301813 303
303 3300026041 Ga0207639_10038442 Ga0207639_100384425 303
304 3300026041 Ga0207639_10338629 Ga0207639_103386292 303
305 3300026067 Ga0207678_10128520 Ga0207678_101285202 303
306 3300026075 Ga0207708_10071841 Ga0207708_100718414 303
307 3300026078 Ga0207702_10121562 Ga0207702_101215622 303
308 3300026078 Ga0207702_10248647 Ga0207702_102486472 303
309 3300026088 Ga0207641_10025816 Ga0207641_100258167 303
310 3300026089 Ga0207648_10033092 Ga0207648_100330924 303
311 3300026116 Ga0207674_10082953 Ga0207674_100829531 303
312 3300026116 Ga0207674_10091013 Ga0207674_100910134 303
313 3300026116 Ga0207674_10329407 Ga0207674_103294072 303
314 3300026118 Ga0207675_100110911 Ga0207675_1001109112 303
315 3300026121 Ga0207683_10006132 Ga0207683_100061326 303
316 3300026121 Ga0207683_10452748 Ga0207683_104527482 303
317 3300026142 Ga0207698_10010990 Ga0207698_100109904 303
318 3300026142 Ga0207698_10053241 Ga0207698_100532413 303
319 3300028379 Ga0268266_10001112 Ga0268266_100011123 303
320 3300028379 Ga0268266_10005719 Ga0268266_100057197 303
321 3300028379 Ga0268266_10014379 Ga0268266_100143795 303
322 3300028379 Ga0268266_10074735 Ga0268266_100747354 303
323 3300028379 Ga0268266_10088464 Ga0268266_100884641 303
324 3300028379 Ga0268266_10160643 Ga0268266_101606431 303
325 3300028381 Ga0268264_10247472 Ga0268264_102474722 303
326 3300028800 Ga0265338_10000005 Ga0265338_1000000557 303
327 3300028800 Ga0265338_10093984 Ga0265338_100939842 303
328 3300031238 Ga0265332_10045556 Ga0265332_100455562 303
329 3300031241 Ga0265325_10000010 Ga0265325_10000010127 303
330 3300031242 Ga0265329_10021417 Ga0265329_100214172 303
331 3300031249 Ga0265339_10000795 Ga0265339_1000079510 303
332 3300031250 Ga0265331_10000011 Ga0265331_10000011164 303
333 3300031250 Ga0265331_10000506 Ga0265331_1000050615 303
334 3300031250 Ga0265331_10002615 Ga0265331_100026155 303
335 3300031250 Ga0265331_10110498 Ga0265331_101104982 303
336 3300031251 Ga0265327_10000007 Ga0265327_1000000736 303
337 3300031595 Ga0265313_10002887 Ga0265313_100028879 303
338 3300031595 Ga0265313_10018877 Ga0265313_100188775 303
339 3300031595 Ga0265313_10030107 Ga0265313_100301073 303
340 3300031711 Ga0265314_10011597 Ga0265314_100115976 303
341 3300031711 Ga0265314_10017097 Ga0265314_100170973 303
342 3300031711 Ga0265314_10020998 Ga0265314_100209985 303
343 3300031711 Ga0265314_10164556 Ga0265314_101645562 303
344 3300031711 Ga0265314_10192496 Ga0265314_101924961 303
345 3300031712 Ga0265342_10073471 Ga0265342_100734711 303
346 3300031712 Ga0265342_10073909 Ga0265342_100739092 303
347 3300035725 Ga0373947_0039997 Ga0373947_0039997_526_1437 303
348 3300037068 Ga0373925_0169905 Ga0373925_0169905_518_1429 303
349 3300037418 Ga0395900_0013150 Ga0395900_0013150_2610_3521 303
350 3300037466 Ga0395898_0054770 Ga0395898_0054770_1722_2633 303
351 3300039437 Ga0436365_0508484 Ga0436365_0508484_8781_9692 303
352 3300039450 Ga0436363_0825924 Ga0436363_0825924_166_1077 303
353 3300044842 Ga0466957_0086773 Ga0466957_0086773_134_1045 303
354 3300046459 Ga0495629_0012192 Ga0495629_0012192_4474_5385 303
355 3300046472 Ga0495580_0013259 Ga0495580_0013259_1092_2003 303
356 3300046473 Ga0495582_0075599 Ga0495582_0075599_734_1645 303
357 3300046477 Ga0495664_0137213 Ga0495664_0137213_73_984 303
358 3300046507 Ga0495606_0186103 Ga0495606_0186103_205_1116 303
359 3300046529 Ga0495652_0103044 Ga0495652_0103044_486_1397 303
360 3300046535 Ga0495586_0084739 Ga0495586_0084739_289_1200 303
361 3300046543 Ga0495645_0032514 Ga0495645_0032514_810_1721 303
362 3300046557 Ga0495622_0002281 Ga0495622_0002281_1056_1967 303
363 3300046683 Ga0495658_0001569 Ga0495658_0001569_7109_8020 303
364 3300047320 Ga0495672_0164389 Ga0495672_0164389_160_1071 303
365 3300047470 Ga0495681_0048516 Ga0495681_0048516_557_1468 303
366 3300048924 Ga0496121_0003690 Ga0496121_0003690_4415_5326 303
367 3300049460 Ga0495682_0001167 Ga0495682_0001167_5400_6311 303
368 3300049569 Ga0501032_0006860 Ga0501032_0006860_6533_7444 303
369 3300049570 Ga0501033_0002531 Ga0501033_0002531_7838_8749 303
370 3300049570 Ga0501033_0004911 Ga0501033_0004911_734_1645 303
371 3300049570 Ga0501033_0028633 Ga0501033_0028633_2846_3757 303
372 3300049570 Ga0501033_0042324 Ga0501033_0042324_2245_3156 303
373 3300049570 Ga0501033_0111164 Ga0501033_0111164_132_1043 303
374 3300049570 Ga0501033_0250093 Ga0501033_0250093_286_1197 303
375 3300049571 Ga0501034_0001907 Ga0501034_0001907_5142_6053 303
376 3300049572 Ga0501036_0006200 Ga0501036_0006200_5654_6565 303
377 3300049572 Ga0501036_0010560 Ga0501036_0010560_2140_3051 303
378 3300049572 Ga0501036_0030965 Ga0501036_0030965_3374_4285 303
379 3300049572 Ga0501036_0102484 Ga0501036_0102484_777_1688 303
380 3300049573 Ga0501037_0002268 Ga0501037_0002268_3367_4278 303
381 3300049574 Ga0501038_0055936 Ga0501038_0055936_1445_2356 303
382 3300049574 Ga0501038_0088089 Ga0501038_0088089_217_1128 303
383 3300049575 Ga0501039_0014104 Ga0501039_0014104_1802_2713 303
384 3300049579 Ga0501043_0006384 Ga0501043_0006384_2807_3718 303
385 3300049579 Ga0501043_0020126 Ga0501043_0020126_2440_3351 303
386 3300049579 Ga0501043_0025535 Ga0501043_0025535_996_1907 303
387 3300049579 Ga0501043_0190633 Ga0501043_0190633_662_1573 303
388 3300049580 Ga0501046_0001650 Ga0501046_0001650_7445_8356 303
389 3300049580 Ga0501046_0041407 Ga0501046_0041407_868_1779 303
390 3300049580 Ga0501046_0078241 Ga0501046_0078241_1043_1954 303
391 3300049581 Ga0501047_0001643 Ga0501047_0001643_20329_21240 303
392 3300049581 Ga0501047_0001899 Ga0501047_0001899_3358_4269 303
393 3300049581 Ga0501047_0002583 Ga0501047_0002583_7283_8194 303
394 3300049581 Ga0501047_0009833 Ga0501047_0009833_7408_8319 303
395 3300049581 Ga0501047_0020311 Ga0501047_0020311_3523_4434 303
396 3300049581 Ga0501047_0022691 Ga0501047_0022691_1944_2855 303
397 3300049581 Ga0501047_0093544 Ga0501047_0093544_1377_2288 303
398 3300049581 Ga0501047_0178957 Ga0501047_0178957_314_1225 303
399 3300049581 Ga0501047_0525058 Ga0501047_0525058_41_952 303
400 3300049582 Ga0501048_0004835 Ga0501048_0004835_8454_9365 303
401 3300049583 Ga0501067_0012986 Ga0501067_0012986_2272_3183 303
402 3300049583 Ga0501067_0029438 Ga0501067_0029438_1732_2643 303
403 3300049584 Ga0501068_0034114 Ga0501068_0034114_1597_2508 303
404 3300049585 Ga0501069_0003859 Ga0501069_0003859_5547_6458 303
405 3300049586 Ga0501070_0007811 Ga0501070_0007811_2727_3638 303
406 3300049586 Ga0501070_0205522 Ga0501070_0205522_90_1001 303
407 3300049588 Ga0501072_0009648 Ga0501072_0009648_6284_7195 303
408 3300049588 Ga0501072_0075467 Ga0501072_0075467_646_1557 303
409 3300049589 Ga0501073_0018810 Ga0501073_0018810_1429_2340 303
410 3300049589 Ga0501073_0036812 Ga0501073_0036812_1905_2816 303
411 3300049589 Ga0501073_0303649 Ga0501073_0303649_27_938 303
412 3300049590 Ga0501074_0027610 Ga0501074_0027610_3129_4040 303
413 3300049590 Ga0501074_0140487 Ga0501074_0140487_199_1110 303
414 3300049741 Ga0501079_0008217 Ga0501079_0008217_6065_6976 303
415 3300049742 Ga0501080_0039510 Ga0501080_0039510_3065_3976 303
416 3300049742 Ga0501080_0048574 Ga0501080_0048574_2402_3313 303
417 3300049742 Ga0501080_0100762 Ga0501080_0100762_1064_1975 303
418 3300049742 Ga0501080_0120183 Ga0501080_0120183_815_1726 303
419 3300049742 Ga0501080_0129917 Ga0501080_0129917_781_1692 303
420 3300049744 Ga0501083_0001727 Ga0501083_0001727_8218_9129 303
421 3300049822 Ga0501035_0079801 Ga0501035_0079801_277_1188 303
422 3300049822 Ga0501035_0139171 Ga0501035_0139171_815_1726 303
423 3300049822 Ga0501035_0196340 Ga0501035_0196340_194_1105 303
424 3300049823 Ga0501044_0005399 Ga0501044_0005399_1906_2817 303
425 3300049823 Ga0501044_0011647 Ga0501044_0011647_905_1816 303
426 3300049823 Ga0501044_0041008 Ga0501044_0041008_1256_2167 303
427 3300049823 Ga0501044_0044686 Ga0501044_0044686_3077_3988 303
428 3300049823 Ga0501044_0349851 Ga0501044_0349851_393_1304 303
429 3300049823 Ga0501044_0437358 Ga0501044_0437358_164_1075 303
430 3300053087 Ga0500643_000008 Ga0500643_000008_142573_143484 303
431 3300053119 Ga0500595_003949 Ga0500595_003949_530_1441 303
432 3300053140 Ga0500573_0000051 Ga0500573_0000051_56782_57693 303
433 3300054114 Ga0501084_0076765 Ga0501084_0076765_461_1372 303
434 3300060353 Ga0501082_0003200 Ga0501082_0003200_11463_12374 303
435 3300060353 Ga0501082_0013240 Ga0501082_0013240_2633_3544 303

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

11

212

0.93

PF08659

KR

KR domain

11

195

0.87

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

17

246

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gz6-assembly2.cif.gz_D (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.9451 1 297
3tfo-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9399 8 238
1gz6-assembly2.cif.gz_C (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.9371 3 297
1gz6-assembly1.cif.gz_B (3r)-hydroxyacyl-coa dehydrogenase fragment of rat peroxisomal multifunctional enzyme type 2 0.9371 1 297
7djs-assembly1.cif.gz_C crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9368 8 238
ID Description Score Start End Superfamily
af_P96825_7_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9741 8 282 3.40.50.720
1gz6A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.966 1 245 3.40.50.720
af_P96825_7_283_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9638 8 282 3.40.50.720
2et6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9635 1 248 3.40.50.720
af_Q54N15_5_159_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9604 72 189 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A519JXM6-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9919 1 195 GO:0016491
AF-A0A011UKV7-F1-model_v4 3-oxoacyl-ACP reductase 0.9906 1 297 GO:0016491
AF-A0A525JJP8-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9897 52 299 GO:0016491
AF-A0A3D1JRE5-F1-model_v4 3-oxoacyl-ACP reductase 0.9895 1 297 GO:0016491
AF-A0A7W9VWW5-F1-model_v4 Uncharacterized protein 0.9886 1 297 GO:0016491

Feature Viewer

pLDDT pTM Quality
93.1 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map