F443288

General Info

Members Datasets Scaffolds Average Seq Length
435 193 870 271

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100008727|Ga0068856_1000087278
Length 265
Sequence MENFLDAAIEIARQAGQVLLAHRGVGFELKGAYDLVTAADRASEQLIVKLLKERFPQHGIVAEEGGRAEMDAELRWYVDPLDGTTNFAHGFPMWNVTLALARKGEVIAGVIFDPLNRELFAAERGAGARLNLNDSLVATGFPSRKRHQNVNIHFYYQLAMVTHGVRRGGSAALDLAYTACGRLEAFWEFGLNPWDMAAGTLLVEEAGGKVSGMRGETFDLHGKYLLADNGLIHQQTVDLFEDIFQGRYRYDMPGLPAVEWEMQRG

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
101 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
103 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
106 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
107 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
130 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
131 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
132 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
133 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
156 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
193 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.69
Rhizosphere 91.95
Stem 0
Stem Tuber 0
Unclassified 15.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100008727 3300005614 Bacteria 9863
2 Ga0070683_100000001 3300005329 Bacteria 529385
3 Ga0070683_100000661 3300005329 Bacteria 24928
4 Ga0070683_100104879 3300005329 Unclassified 2664
5 Ga0070683_100159618 3300005329 Bacteria 2139
6 Ga0070683_100360961 3300005329 Unclassified 1383
7 Ga0070670_100253362 3300005331 Bacteria 1534
8 Ga0070666_10000985 3300005335 Bacteria 17394
9 Ga0070680_100002278 3300005336 Bacteria 14193
10 Ga0070682_100095606 3300005337 Bacteria 1951
11 Ga0070660_100254663 3300005339 Bacteria 1432
12 Ga0070691_10000195 3300005341 Bacteria 20331
13 Ga0070661_100050874 3300005344 Bacteria 3032
14 Ga0070661_100183467 3300005344 Bacteria 1593
15 Ga0070709_10013208 3300005434 Bacteria 4636
16 Ga0070714_100077423 3300005435 Bacteria 2889
17 Ga0070713_100001096 3300005436 Bacteria 17297
18 Ga0070713_100288215 3300005436 Bacteria 1508
19 Ga0070713_100302247 3300005436 Bacteria 1473
20 Ga0070710_10177798 3300005437 Bacteria 1330
21 Ga0070700_100380525 3300005441 Bacteria 1055
22 Ga0070708_100477602 3300005445 Bacteria 1176
23 Ga0070663_100017623 3300005455 Bacteria 4665
24 Ga0070663_100442020 3300005455 Unclassified 1070
25 Ga0070663_100623549 3300005455 Bacteria 909
26 Ga0070681_10005665 3300005458 Bacteria 12075
27 Ga0070681_10097527 3300005458 Bacteria 2887
28 Ga0068867_100086399 3300005459 Bacteria 2373
29 Ga0068867_100286656 3300005459 Bacteria 1352
30 Ga0070685_10259264 3300005466 Bacteria 1155
31 Ga0070679_100010259 3300005530 Bacteria 8880
32 Ga0070684_100000108 3300005535 Bacteria 54047
33 Ga0070684_100001582 3300005535 Bacteria 16432
34 Ga0070684_100042504 3300005535 Bacteria 3924
35 Ga0070684_100095332 3300005535 Bacteria 2651
36 Ga0068853_100037978 3300005539 Bacteria 4100
37 Ga0070672_100206928 3300005543 Bacteria 1642
38 Ga0070696_100300455 3300005546 Bacteria 1229
39 Ga0070665_100097264 3300005548 Unclassified 2949
40 Ga0070665_100317451 3300005548 Unclassified 1562
41 Ga0070665_100454168 3300005548 Unclassified 1291
42 Ga0070665_100665589 3300005548 Bacteria 1054
43 Ga0068855_100008673 3300005563 Bacteria 12285
44 Ga0068855_100012809 3300005563 Bacteria 10118
45 Ga0068855_100055523 3300005563 Unclassified 4651
46 Ga0068855_100231438 3300005563 Bacteria 2069
47 Ga0070664_100077272 3300005564 Bacteria 2862
48 Ga0070664_100463600 3300005564 Bacteria 1164
49 Ga0068857_100002382 3300005577 Bacteria 15329
50 Ga0068857_100395978 3300005577 Bacteria 1284
51 Ga0068856_100002327 3300005614 Bacteria 19577
52 Ga0068856_100026515 3300005614 Bacteria 5650
53 Ga0068856_100085384 3300005614 Bacteria 3135
54 Ga0068856_100185096 3300005614 Bacteria 2096
55 Ga0068859_100029116 3300005617 Bacteria 5542
56 Ga0068864_100306648 3300005618 Bacteria 1487
57 Ga0068864_100389882 3300005618 Bacteria 1322
58 Ga0068858_100037192 3300005842 Bacteria 4513
59 Ga0068858_100037888 3300005842 Bacteria 4472
60 Ga0068858_100127540 3300005842 Bacteria 2384
61 Ga0068860_100025597 3300005843 Bacteria 5691
62 Ga0068860_100145199 3300005843 Bacteria 2283
63 Ga0068860_100283272 3300005843 Unclassified 1620
64 Ga0081455_10028398 3300005937 Bacteria 5111
65 Ga0070717_10009575 3300006028 Bacteria 7287
66 Ga0070717_10068318 3300006028 Bacteria 2958
67 Ga0097621_100040537 3300006237 Unclassified 3745
68 Ga0097621_100556919 3300006237 Bacteria 1044
69 Ga0068871_100047298 3300006358 Bacteria 3469
70 Ga0068871_100048512 3300006358 Unclassified 3429
71 Ga0068871_100116504 3300006358 Unclassified 2253
72 Ga0068871_100407370 3300006358 Bacteria 1212
73 Ga0075430_100264037 3300006846 Unclassified 1425
74 Ga0075431_100115760 3300006847 Bacteria 2767
75 Ga0075431_100223976 3300006847 Bacteria 1918
76 Ga0068865_100153647 3300006881 Bacteria 1748
77 Ga0097620_100029116 3300006931 Bacteria 5542
78 Ga0105240_10000340 3300009093 Bacteria 87388
79 Ga0105240_10001386 3300009093 Bacteria 41666
80 Ga0105240_10008442 3300009093 Bacteria 14733
81 Ga0105240_10011426 3300009093 Bacteria 12368
82 Ga0105240_10186899 3300009093 Bacteria 2439
83 Ga0105240_10192539 3300009093 Unclassified 2397
84 Ga0105240_10314359 3300009093 Bacteria 1787
85 Ga0105245_10002831 3300009098 Bacteria 15586
86 Ga0105245_10024354 3300009098 Bacteria 5314
87 Ga0105245_10070607 3300009098 Bacteria 3170
88 Ga0105245_10082996 3300009098 Bacteria 2932
89 Ga0105245_10127589 3300009098 Bacteria 2383
90 Ga0105245_10598987 3300009098 Bacteria 1128
91 Ga0105241_10004653 3300009174 Bacteria 10140
92 Ga0105241_10133442 3300009174 Bacteria 2013
93 Ga0105241_10271994 3300009174 Unclassified 1444
94 Ga0105242_10015883 3300009176 Bacteria 5849
95 Ga0105242_10377422 3300009176 Bacteria 1317
96 Ga0105248_10009411 3300009177 Bacteria 10756
97 Ga0105248_10049920 3300009177 Bacteria 4691
98 Ga0105248_10055972 3300009177 Bacteria 4424
99 Ga0105248_10078088 3300009177 Bacteria 3722
100 Ga0105248_10107106 3300009177 Bacteria 3152
101 Ga0105248_10151599 3300009177 Bacteria 2615
102 Ga0105248_10211729 3300009177 Bacteria 2184
103 Ga0105248_10655311 3300009177 Bacteria 1185
104 Ga0105237_10006125 3300009545 Bacteria 13445
105 Ga0105237_10007991 3300009545 Bacteria 11516
106 Ga0105237_10026735 3300009545 Bacteria 5897
107 Ga0105237_10044579 3300009545 Unclassified 4466
108 Ga0105237_10060811 3300009545 Bacteria 3778
109 Ga0105238_10013581 3300009551 Bacteria 8224
110 Ga0105238_10023281 3300009551 Bacteria 6313
111 Ga0105238_10024898 3300009551 Bacteria 6099
112 Ga0105238_10041089 3300009551 Bacteria 4684
113 Ga0105238_10061260 3300009551 Bacteria 3766
114 Ga0105238_10506867 3300009551 Bacteria 1208
115 Ga0105238_10865891 3300009551 Bacteria 921
116 Ga0105249_10059565 3300009553 Bacteria 3502
117 Ga0105249_10712859 3300009553 Bacteria 1064
118 Ga0105239_10000747 3300010375 Bacteria 46191
119 Ga0105239_10027727 3300010375 Bacteria 6232
120 Ga0105239_10108873 3300010375 Bacteria 3069
121 Ga0105239_10340885 3300010375 Unclassified 1691
122 Ga0105246_10075912 3300011119 Unclassified 2380
123 Ga0105246_10078313 3300011119 Bacteria 2347
124 Ga0157371_10042429 3300013102 Bacteria 3242
125 Ga0157370_10002862 3300013104 Bacteria 20601
126 Ga0157370_10004212 3300013104 Bacteria 16633
127 Ga0157370_10006287 3300013104 Bacteria 13141
128 Ga0157370_10111568 3300013104 Bacteria 2556
129 Ga0157370_10115655 3300013104 Bacteria 2505
130 Ga0157370_10198893 3300013104 Unclassified 1859
131 Ga0157370_10474409 3300013104 Bacteria 1150
132 Ga0157369_10002365 3300013105 Bacteria 22675
133 Ga0157369_10007008 3300013105 Bacteria 13006
134 Ga0157369_10011155 3300013105 Bacteria 10216
135 Ga0157369_10077468 3300013105 Bacteria 3563
136 Ga0157369_10082479 3300013105 Bacteria 3440
137 Ga0157369_10181967 3300013105 Bacteria 2211
138 Ga0157369_10230517 3300013105 Bacteria 1936
139 Ga0157369_10252257 3300013105 Bacteria 1841
140 Ga0157369_10597426 3300013105 Bacteria 1139
141 Ga0157374_10003700 3300013296 Bacteria 12860
142 Ga0157374_10267900 3300013296 Bacteria 1684
143 Ga0157378_10005222 3300013297 Bacteria 11401
144 Ga0157378_10020809 3300013297 Bacteria 5769
145 Ga0157372_10021116 3300013307 Bacteria 7032
146 Ga0157372_10469401 3300013307 Bacteria 1467
147 Ga0157375_10235556 3300013308 Bacteria 1990
148 Ga0163163_10018511 3300014325 Bacteria 6523
149 Ga0163163_10060346 3300014325 Bacteria 3755
150 Ga0163163_10066463 3300014325 Bacteria 3581
151 Ga0163163_10088376 3300014325 Bacteria 3110
152 Ga0163163_10117857 3300014325 Unclassified 2687
153 Ga0163163_10288957 3300014325 Bacteria 1692
154 Ga0163163_10853983 3300014325 Bacteria 974
155 Ga0163163_10885750 3300014325 Bacteria 956
156 Ga0157380_10129600 3300014326 Unclassified 2150
157 Ga0157380_10473710 3300014326 Bacteria 1209
158 Ga0157379_10148617 3300014968 Unclassified 2113
159 Ga0157376_10102659 3300014969 Bacteria 2502
160 Ga0157376_10202953 3300014969 Bacteria 1825
161 Ga0157376_10215862 3300014969 Bacteria 1774
162 Ga0163161_10245269 3300017792 Bacteria 1394
163 Ga0213872_10000138 3300021361 Bacteria 65490
164 Ga0213874_10005897 3300021377 Bacteria 2876
165 Ga0213876_10003729 3300021384 Bacteria 8638
166 Ga0213876_10047403 3300021384 Bacteria 2272
167 Ga0213876_10101793 3300021384 Bacteria 1523
168 Ga0213876_10142761 3300021384 Unclassified 1273
169 Ga0213875_10000004 3300021388 Bacteria 703388
170 Ga0213875_10004881 3300021388 Bacteria 7277
171 Ga0213875_10007378 3300021388 Bacteria 5682
172 Ga0213875_10037302 3300021388 Unclassified 2290
173 Ga0213875_10056128 3300021388 Bacteria 1844
174 Ga0213875_10100951 3300021388 Bacteria 1346
175 Ga0213875_10146182 3300021388 Unclassified 1107
176 Ga0207699_10011696 3300025906 Unclassified 4442
177 Ga0207699_10181221 3300025906 Bacteria 1416
178 Ga0207654_10002715 3300025911 Bacteria 8982
179 Ga0207654_10006544 3300025911 Bacteria 5862
180 Ga0207654_10206456 3300025911 Bacteria 1296
181 Ga0207707_10047850 3300025912 Bacteria 3724
182 Ga0207695_10004632 3300025913 Bacteria 18649
183 Ga0207695_10009105 3300025913 Bacteria 12329
184 Ga0207695_10015408 3300025913 Bacteria 9001
185 Ga0207695_10066873 3300025913 Bacteria 3689
186 Ga0207695_10100744 3300025913 Bacteria 2884
187 Ga0207695_10145489 3300025913 Bacteria 2315
188 Ga0207671_10031141 3300025914 Bacteria 3977
189 Ga0207671_10108098 3300025914 Bacteria 2114
190 Ga0207671_10182348 3300025914 Bacteria 1634
191 Ga0207663_10417789 3300025916 Bacteria 1029
192 Ga0207657_10038434 3300025919 Bacteria 4260
193 Ga0207657_10147031 3300025919 Bacteria 1922
194 Ga0207657_10367502 3300025919 Bacteria 1133
195 Ga0207649_10176103 3300025920 Unclassified 1494
196 Ga0207649_10182655 3300025920 Bacteria 1469
197 Ga0207652_10020577 3300025921 Bacteria 5437
198 Ga0207652_10128084 3300025921 Bacteria 2262
199 Ga0207652_10237759 3300025921 Bacteria 1642
200 Ga0207694_10007328 3300025924 Bacteria 8370
201 Ga0207694_10013273 3300025924 Bacteria 6203
202 Ga0207694_10071782 3300025924 Bacteria 2706
203 Ga0207694_10078966 3300025924 Unclassified 2580
204 Ga0207687_10001155 3300025927 Bacteria 18001
205 Ga0207687_10003804 3300025927 Bacteria 10149
206 Ga0207687_10010939 3300025927 Bacteria 5929
207 Ga0207687_10016546 3300025927 Bacteria 4845
208 Ga0207687_10156205 3300025927 Bacteria 1745
209 Ga0207700_10031516 3300025928 Bacteria 3768
210 Ga0207664_10006561 3300025929 Bacteria 8015
211 Ga0207690_10033370 3300025932 Bacteria 3310
212 Ga0207686_10006889 3300025934 Bacteria 6119
213 Ga0207686_10009804 3300025934 Bacteria 5204
214 Ga0207686_10109058 3300025934 Bacteria 1863
215 Ga0207686_10111091 3300025934 Bacteria 1849
216 Ga0207670_10015673 3300025936 Bacteria 4535
217 Ga0207711_10007442 3300025941 Bacteria 9164
218 Ga0207711_10009021 3300025941 Bacteria 8337
219 Ga0207711_10056002 3300025941 Bacteria 3387
220 Ga0207711_10249931 3300025941 Bacteria 1628
221 Ga0207711_10435077 3300025941 Bacteria 1221
222 Ga0207661_10000005 3300025944 Bacteria 557888
223 Ga0207661_10088912 3300025944 Unclassified 2569
224 Ga0207661_10286170 3300025944 Bacteria 1474
225 Ga0207679_10162468 3300025945 Unclassified 1830
226 Ga0207679_10170565 3300025945 Bacteria 1791
227 Ga0207679_10406926 3300025945 Bacteria 1198
228 Ga0207679_10644025 3300025945 Archaea 958
229 Ga0207667_10000761 3300025949 Bacteria 41908
230 Ga0207667_10020982 3300025949 Bacteria 7245
231 Ga0207667_10068707 3300025949 Bacteria 3688
232 Ga0207667_10315468 3300025949 Bacteria 1597
233 Ga0207651_10271772 3300025960 Bacteria 1396
234 Ga0207651_10396626 3300025960 Bacteria 1173
235 Ga0207677_10013693 3300026023 Bacteria 4708
236 Ga0207703_10014565 3300026035 Bacteria 6136
237 Ga0207703_10038479 3300026035 Bacteria 3817
238 Ga0207703_10153522 3300026035 Bacteria 2010
239 Ga0207703_10273272 3300026035 Bacteria 1532
240 Ga0207639_10008235 3300026041 Bacteria 7140
241 Ga0207639_10251057 3300026041 Bacteria 1543
242 Ga0207678_10047179 3300026067 Unclassified 3725
243 Ga0207678_10594021 3300026067 Bacteria 970
244 Ga0207702_10013211 3300026078 Bacteria 6867
245 Ga0207702_10021680 3300026078 Bacteria 5319
246 Ga0207702_10021794 3300026078 Bacteria 5306
247 Ga0207702_10028706 3300026078 Bacteria 4626
248 Ga0207702_10283095 3300026078 Bacteria 1568
249 Ga0207648_10031908 3300026089 Bacteria 4654
250 Ga0207648_10084339 3300026089 Unclassified 2771
251 Ga0207648_10309201 3300026089 Bacteria 1418
252 Ga0207674_10003758 3300026116 Bacteria 18521
253 Ga0207674_10003874 3300026116 Bacteria 18238
254 Ga0207674_10044076 3300026116 Bacteria 4597
255 Ga0207675_100349599 3300026118 Bacteria 1449
256 Ga0268266_10336158 3300028379 Bacteria 1417
257 Ga0268266_10371581 3300028379 Unclassified 1347
258 Ga0268264_10030519 3300028381 Bacteria 4418
259 Ga0268264_10113505 3300028381 Unclassified 2377
260 Ga0268264_10275862 3300028381 Unclassified 1573
261 Ga0265323_10000102 3300028653 Bacteria 48958
262 Ga0265338_10127086 3300028800 Bacteria 2021
263 Ga0265324_10035780 3300029957 Bacteria 1728
264 Ga0265770_1010805 3300030878 Bacteria 1330
265 Ga0265330_10041478 3300031235 Bacteria 2041
266 Ga0265332_10133101 3300031238 Bacteria 1043
267 Ga0265320_10004308 3300031240 Bacteria 9353
268 Ga0265329_10015406 3300031242 Bacteria 2670
269 Ga0265339_10094675 3300031249 Bacteria 1561
270 Ga0265331_10017555 3300031250 Bacteria 3727
271 Ga0265316_10006010 3300031344 Bacteria 11672
272 Ga0265316_10009239 3300031344 Bacteria 9078
273 Ga0265316_10028981 3300031344 Bacteria 4559
274 Ga0265316_10252288 3300031344 Bacteria 1295
275 Ga0265316_10260933 3300031344 Bacteria 1270
276 Ga0307509_10272347 3300031507 Bacteria 1460
277 Ga0265313_10002455 3300031595 Bacteria 15995
278 Ga0265314_10000722 3300031711 Bacteria 39958
279 Ga0265314_10002745 3300031711 Bacteria 17599
280 Ga0265314_10008295 3300031711 Bacteria 8914
281 Ga0265342_10011119 3300031712 Bacteria 6179
282 Ga0265342_10056532 3300031712 Bacteria 2325
283 Ga0265342_10133886 3300031712 Bacteria 1387
284 Ga0373934_0022037 3300035086 Bacteria 2455
285 Ga0373923_0014531 3300035111 Unclassified 2959
286 Ga0373923_0033194 3300035111 Bacteria 2089
287 Ga0373923_0127814 3300035111 Bacteria 1140
288 Ga0373945_0021166 3300035116 Unclassified 2233
289 Ga0373953_0052950 3300035117 Bacteria 1644
290 Ga0373954_0012370 3300035118 Unclassified 3793
291 Ga0373954_0017197 3300035118 Bacteria 3244
292 Ga0373954_0019970 3300035118 Bacteria 3025
293 Ga0373955_0064389 3300035172 Unclassified 2032
294 Ga0373955_0157637 3300035172 Unclassified 1338
295 Ga0373924_0110396 3300035410 Unclassified 1188
296 Ga0373935_0042353 3300035692 Bacteria 2863
297 Ga0373935_0100041 3300035692 Bacteria 1910
298 Ga0373935_0203976 3300035692 Bacteria 1368
299 Ga0373927_0000988 3300035695 Bacteria 21649
300 Ga0373927_0044079 3300035695 Bacteria 2887
301 Ga0373933_0017099 3300035724 Bacteria 4067
302 Ga0373933_0080437 3300035724 Bacteria 1997
303 Ga0373947_0053703 3300035725 Bacteria 2430
304 Ga0373947_0058317 3300035725 Unclassified 2339
305 Ga0373947_0259361 3300035725 Bacteria 1151
306 Ga0373937_0013236 3300036401 Bacteria 7266
307 Ga0373937_0019972 3300036401 Bacteria 6000
308 Ga0373937_0054235 3300036401 Bacteria 3678
309 Ga0373937_0247399 3300036401 Unclassified 1681
310 Ga0373937_0253403 3300036401 Bacteria 1659
311 Ga0373937_0302547 3300036401 Bacteria 1512
312 Ga0373925_0123976 3300037068 Unclassified 2008
313 Ga0373925_0210666 3300037068 Bacteria 1548
314 Ga0436364_0107695 3300037853 Unclassified 2986
315 Ga0436364_0255462 3300037853 Unclassified 2955
316 Ga0436364_0261118 3300037853 Bacteria 11517
317 Ga0436364_0389676 3300037853 Unclassified 1398
318 Ga0436364_0522941 3300037853 Bacteria 13905
319 Ga0436364_0611753 3300037853 Bacteria 5155
320 Ga0436364_0748068 3300037853 Bacteria 528910
321 Ga0436364_0816838 3300037853 Bacteria 4338
322 Ga0436364_1103837 3300037853 Bacteria 5987
323 Ga0436364_1279952 3300037853 Bacteria 2465
324 Ga0436364_1287866 3300037853 Bacteria 9278
325 Ga0436365_0310506 3300039437 Bacteria 6228
326 Ga0436365_0611710 3300039437 Bacteria 2769
327 Ga0436365_0723431 3300039437 Bacteria 4832
328 Ga0436365_1097421 3300039437 Unclassified 1429
329 Ga0436365_1478444 3300039437 Unclassified 2799
330 Ga0436360_0186118 3300039438 Bacteria 2897
331 Ga0436360_0284038 3300039438 Unclassified 1305
332 Ga0436360_0412445 3300039438 Unclassified 984
333 Ga0436360_1176879 3300039438 Bacteria 17743
334 Ga0436361_0472229 3300039447 Bacteria 4184
335 Ga0436361_1089336 3300039447 Bacteria 150546
336 Ga0436363_0814445 3300039450 Bacteria 2497
337 Ga0436363_1110161 3300039450 Bacteria 2875
338 Ga0436363_1146269 3300039450 Unclassified 1379
339 Ga0436362_0097696 3300039453 Bacteria 9529
340 Ga0436362_0633342 3300039453 Unclassified 4351
341 Ga0466966_0256803 3300044684 Unclassified 1052
342 Ga0466961_0127156 3300044693 Bacteria 1598
343 Ga0466963_0187045 3300044694 Bacteria 1447
344 Ga0453684_0430861 3300044712 Bacteria 1471
345 Ga0453684_0452366 3300044712 Unclassified 1429
346 Ga0466957_0110703 3300044842 Bacteria 1741
347 Ga0466967_0166845 3300045976 Bacteria 2070
348 Ga0495592_0013340 3300046454 Bacteria 6254
349 Ga0495629_0304717 3300046459 Bacteria 1091
350 Ga0495651_0138205 3300046462 Bacteria 1770
351 Ga0495651_0152931 3300046462 Bacteria 1661
352 Ga0495580_0001157 3300046472 Bacteria 23178
353 Ga0495580_0001569 3300046472 Bacteria 20092
354 Ga0495580_0058233 3300046472 Unclassified 2718
355 Ga0495580_0059764 3300046472 Bacteria 2679
356 Ga0495580_0089079 3300046472 Bacteria 2148
357 Ga0495580_0134578 3300046472 Bacteria 1714
358 Ga0495582_0046525 3300046473 Unclassified 2390
359 Ga0495664_0139971 3300046477 Unclassified 1467
360 Ga0495594_0082135 3300046499 Bacteria 1800
361 Ga0495652_0137714 3300046529 Bacteria 1924
362 Ga0495652_0417022 3300046529 Unclassified 947
363 Ga0495665_0010848 3300046531 Bacteria 4930
364 Ga0495586_0274923 3300046535 Bacteria 963
365 Ga0495587_0010690 3300046536 Bacteria 5828
366 Ga0495587_0165155 3300046536 Bacteria 1259
367 Ga0495645_0135080 3300046543 Bacteria 1726
368 Ga0495645_0264010 3300046543 Bacteria 1139
369 Ga0495667_0063553 3300046559 Bacteria 2416
370 Ga0495667_0289147 3300046559 Bacteria 1040
371 Ga0495635_0032571 3300046663 Bacteria 3616
372 Ga0495588_0223804 3300046674 Bacteria 993
373 Ga0495599_0011604 3300046678 Bacteria 5419
374 Ga0495599_0151888 3300046678 Bacteria 1434
375 Ga0495623_0122348 3300046679 Bacteria 1565
376 Ga0495613_0028594 3300046689 Bacteria 4147
377 Ga0495613_0423609 3300046689 Bacteria 905
378 Ga0495604_0114179 3300047317 Bacteria 1965
379 Ga0495636_0145810 3300047318 Bacteria 1060
380 Ga0495674_0007240 3300047319 Bacteria 10618
381 Ga0495674_0138596 3300047319 Bacteria 2046
382 Ga0495674_0155155 3300047319 Unclassified 1918
383 Ga0495675_0110404 3300047444 Bacteria 1717
384 Ga0495675_0124977 3300047444 Bacteria 1601
385 Ga0495675_0171561 3300047444 Unclassified 1332
386 Ga0495684_0006455 3300047471 Bacteria 9108
387 Ga0495684_0040263 3300047471 Bacteria 3583
388 Ga0495684_0054433 3300047471 Unclassified 3052
389 Ga0495684_0146932 3300047471 Bacteria 1765
390 Ga0495593_0117667 3300047673 Bacteria 1354
391 Ga0495602_0011355 3300048088 Bacteria 9215
392 Ga0495602_0097170 3300048088 Bacteria 2427
393 Ga0496104_0226746 3300048907 Bacteria 1781
394 Ga0496112_0085246 3300048915 Bacteria 3126
395 Ga0496115_0200073 3300048918 Bacteria 1650
396 Ga0501031_0002404 3300049568 Bacteria 11899
397 Ga0501032_0001442 3300049569 Bacteria 18893
398 Ga0501033_0011646 3300049570 Bacteria 6725
399 Ga0501034_0009063 3300049571 Bacteria 10451
400 Ga0501034_0025597 3300049571 Bacteria 6008
401 Ga0501034_0268152 3300049571 Unclassified 1649
402 Ga0501036_0003143 3300049572 Bacteria 13168
403 Ga0501037_0007680 3300049573 Bacteria 7894
404 Ga0501038_0002019 3300049574 Bacteria 18735
405 Ga0501038_0129464 3300049574 Bacteria 2074
406 Ga0501043_0021675 3300049579 Bacteria 5037
407 Ga0501046_0002097 3300049580 Bacteria 18895
408 Ga0501046_0054687 3300049580 Bacteria 3139
409 Ga0501047_0004792 3300049581 Bacteria 12731
410 Ga0501047_0011424 3300049581 Bacteria 8404
411 Ga0501047_0015979 3300049581 Bacteria 7157
412 Ga0501047_0071096 3300049581 Unclassified 3350
413 Ga0501048_0034671 3300049582 Unclassified 3639
414 Ga0501067_0004599 3300049583 Bacteria 7636
415 Ga0501068_0007206 3300049584 Bacteria 6157
416 Ga0501069_0009988 3300049585 Bacteria 5017
417 Ga0501070_0004017 3300049586 Bacteria 12639
418 Ga0501072_0003195 3300049588 Bacteria 12309
419 Ga0501073_0010061 3300049589 Bacteria 6955
420 Ga0501074_0036894 3300049590 Unclassified 3541
421 Ga0501076_0006562 3300049592 Bacteria 8439
422 Ga0501077_0002599 3300049593 Bacteria 10819
423 Ga0501079_0034589 3300049741 Bacteria 3888
424 Ga0501080_0000059 3300049742 Bacteria 72357
425 Ga0501083_0013464 3300049744 Bacteria 5716
426 Ga0501035_0011434 3300049822 Bacteria 8229
427 Ga0501044_0002122 3300049823 Bacteria 22757
428 Ga0501044_0002626 3300049823 Bacteria 20441
429 Ga0501044_0023797 3300049823 Bacteria 6511
430 Ga0501044_0025626 3300049823 Bacteria 6252
431 Ga0501044_0116927 3300049823 Unclassified 2671
432 Ga0501084_0010300 3300054114 Bacteria 7735
433 Ga0501082_0000052 3300060353 Bacteria 83141
434 Ga0501082_0019576 3300060353 Bacteria 5836
435 Ga0530510_0101391 3300061734 Bacteria 2105
436 Ga0068856_100008727
437 Ga0070683_100000001
438 Ga0070683_100000661
439 Ga0070683_100104879
440 Ga0070683_100159618
441 Ga0070683_100360961
442 Ga0070670_100253362
443 Ga0070666_10000985
444 Ga0070680_100002278
445 Ga0070682_100095606
446 Ga0070660_100254663
447 Ga0070691_10000195
448 Ga0070661_100050874
449 Ga0070661_100183467
450 Ga0070709_10013208
451 Ga0070714_100077423
452 Ga0070713_100001096
453 Ga0070713_100288215
454 Ga0070713_100302247
455 Ga0070710_10177798
456 Ga0070700_100380525
457 Ga0070708_100477602
458 Ga0070663_100017623
459 Ga0070663_100442020
460 Ga0070663_100623549
461 Ga0070681_10005665
462 Ga0070681_10097527
463 Ga0068867_100086399
464 Ga0068867_100286656
465 Ga0070685_10259264
466 Ga0070679_100010259
467 Ga0070684_100000108
468 Ga0070684_100001582
469 Ga0070684_100042504
470 Ga0070684_100095332
471 Ga0068853_100037978
472 Ga0070672_100206928
473 Ga0070696_100300455
474 Ga0070665_100097264
475 Ga0070665_100317451
476 Ga0070665_100454168
477 Ga0070665_100665589
478 Ga0068855_100008673
479 Ga0068855_100012809
480 Ga0068855_100055523
481 Ga0068855_100231438
482 Ga0070664_100077272
483 Ga0070664_100463600
484 Ga0068857_100002382
485 Ga0068857_100395978
486 Ga0068856_100002327
487 Ga0068856_100026515
488 Ga0068856_100085384
489 Ga0068856_100185096
490 Ga0068859_100029116
491 Ga0068864_100306648
492 Ga0068864_100389882
493 Ga0068858_100037192
494 Ga0068858_100037888
495 Ga0068858_100127540
496 Ga0068860_100025597
497 Ga0068860_100145199
498 Ga0068860_100283272
499 Ga0081455_10028398
500 Ga0070717_10009575
501 Ga0070717_10068318
502 Ga0097621_100040537
503 Ga0097621_100556919
504 Ga0068871_100047298
505 Ga0068871_100048512
506 Ga0068871_100116504
507 Ga0068871_100407370
508 Ga0075430_100264037
509 Ga0075431_100115760
510 Ga0075431_100223976
511 Ga0068865_100153647
512 Ga0097620_100029116
513 Ga0105240_10000340
514 Ga0105240_10001386
515 Ga0105240_10008442
516 Ga0105240_10011426
517 Ga0105240_10186899
518 Ga0105240_10192539
519 Ga0105240_10314359
520 Ga0105245_10002831
521 Ga0105245_10024354
522 Ga0105245_10070607
523 Ga0105245_10082996
524 Ga0105245_10127589
525 Ga0105245_10598987
526 Ga0105241_10004653
527 Ga0105241_10133442
528 Ga0105241_10271994
529 Ga0105242_10015883
530 Ga0105242_10377422
531 Ga0105248_10009411
532 Ga0105248_10049920
533 Ga0105248_10055972
534 Ga0105248_10078088
535 Ga0105248_10107106
536 Ga0105248_10151599
537 Ga0105248_10211729
538 Ga0105248_10655311
539 Ga0105237_10006125
540 Ga0105237_10007991
541 Ga0105237_10026735
542 Ga0105237_10044579
543 Ga0105237_10060811
544 Ga0105238_10013581
545 Ga0105238_10023281
546 Ga0105238_10024898
547 Ga0105238_10041089
548 Ga0105238_10061260
549 Ga0105238_10506867
550 Ga0105238_10865891
551 Ga0105249_10059565
552 Ga0105249_10712859
553 Ga0105239_10000747
554 Ga0105239_10027727
555 Ga0105239_10108873
556 Ga0105239_10340885
557 Ga0105246_10075912
558 Ga0105246_10078313
559 Ga0157371_10042429
560 Ga0157370_10002862
561 Ga0157370_10004212
562 Ga0157370_10006287
563 Ga0157370_10111568
564 Ga0157370_10115655
565 Ga0157370_10198893
566 Ga0157370_10474409
567 Ga0157369_10002365
568 Ga0157369_10007008
569 Ga0157369_10011155
570 Ga0157369_10077468
571 Ga0157369_10082479
572 Ga0157369_10181967
573 Ga0157369_10230517
574 Ga0157369_10252257
575 Ga0157369_10597426
576 Ga0157374_10003700
577 Ga0157374_10267900
578 Ga0157378_10005222
579 Ga0157378_10020809
580 Ga0157372_10021116
581 Ga0157372_10469401
582 Ga0157375_10235556
583 Ga0163163_10018511
584 Ga0163163_10060346
585 Ga0163163_10066463
586 Ga0163163_10088376
587 Ga0163163_10117857
588 Ga0163163_10288957
589 Ga0163163_10853983
590 Ga0163163_10885750
591 Ga0157380_10129600
592 Ga0157380_10473710
593 Ga0157379_10148617
594 Ga0157376_10102659
595 Ga0157376_10202953
596 Ga0157376_10215862
597 Ga0163161_10245269
598 Ga0213872_10000138
599 Ga0213874_10005897
600 Ga0213876_10003729
601 Ga0213876_10047403
602 Ga0213876_10101793
603 Ga0213876_10142761
604 Ga0213875_10000004
605 Ga0213875_10004881
606 Ga0213875_10007378
607 Ga0213875_10037302
608 Ga0213875_10056128
609 Ga0213875_10100951
610 Ga0213875_10146182
611 Ga0207699_10011696
612 Ga0207699_10181221
613 Ga0207654_10002715
614 Ga0207654_10006544
615 Ga0207654_10206456
616 Ga0207707_10047850
617 Ga0207695_10004632
618 Ga0207695_10009105
619 Ga0207695_10015408
620 Ga0207695_10066873
621 Ga0207695_10100744
622 Ga0207695_10145489
623 Ga0207671_10031141
624 Ga0207671_10108098
625 Ga0207671_10182348
626 Ga0207663_10417789
627 Ga0207657_10038434
628 Ga0207657_10147031
629 Ga0207657_10367502
630 Ga0207649_10176103
631 Ga0207649_10182655
632 Ga0207652_10020577
633 Ga0207652_10128084
634 Ga0207652_10237759
635 Ga0207694_10007328
636 Ga0207694_10013273
637 Ga0207694_10071782
638 Ga0207694_10078966
639 Ga0207687_10001155
640 Ga0207687_10003804
641 Ga0207687_10010939
642 Ga0207687_10016546
643 Ga0207687_10156205
644 Ga0207700_10031516
645 Ga0207664_10006561
646 Ga0207690_10033370
647 Ga0207686_10006889
648 Ga0207686_10009804
649 Ga0207686_10109058
650 Ga0207686_10111091
651 Ga0207670_10015673
652 Ga0207711_10007442
653 Ga0207711_10009021
654 Ga0207711_10056002
655 Ga0207711_10249931
656 Ga0207711_10435077
657 Ga0207661_10000005
658 Ga0207661_10088912
659 Ga0207661_10286170
660 Ga0207679_10162468
661 Ga0207679_10170565
662 Ga0207679_10406926
663 Ga0207679_10644025
664 Ga0207667_10000761
665 Ga0207667_10020982
666 Ga0207667_10068707
667 Ga0207667_10315468
668 Ga0207651_10271772
669 Ga0207651_10396626
670 Ga0207677_10013693
671 Ga0207703_10014565
672 Ga0207703_10038479
673 Ga0207703_10153522
674 Ga0207703_10273272
675 Ga0207639_10008235
676 Ga0207639_10251057
677 Ga0207678_10047179
678 Ga0207678_10594021
679 Ga0207702_10013211
680 Ga0207702_10021680
681 Ga0207702_10021794
682 Ga0207702_10028706
683 Ga0207702_10283095
684 Ga0207648_10031908
685 Ga0207648_10084339
686 Ga0207648_10309201
687 Ga0207674_10003758
688 Ga0207674_10003874
689 Ga0207674_10044076
690 Ga0207675_100349599
691 Ga0268266_10336158
692 Ga0268266_10371581
693 Ga0268264_10030519
694 Ga0268264_10113505
695 Ga0268264_10275862
696 Ga0265323_10000102
697 Ga0265338_10127086
698 Ga0265324_10035780
699 Ga0265770_1010805
700 Ga0265330_10041478
701 Ga0265332_10133101
702 Ga0265320_10004308
703 Ga0265329_10015406
704 Ga0265339_10094675
705 Ga0265331_10017555
706 Ga0265316_10006010
707 Ga0265316_10009239
708 Ga0265316_10028981
709 Ga0265316_10252288
710 Ga0265316_10260933
711 Ga0307509_10272347
712 Ga0265313_10002455
713 Ga0265314_10000722
714 Ga0265314_10002745
715 Ga0265314_10008295
716 Ga0265342_10011119
717 Ga0265342_10056532
718 Ga0265342_10133886
719 Ga0373934_0022037
720 Ga0373923_0014531
721 Ga0373923_0033194
722 Ga0373923_0127814
723 Ga0373945_0021166
724 Ga0373953_0052950
725 Ga0373954_0012370
726 Ga0373954_0017197
727 Ga0373954_0019970
728 Ga0373955_0064389
729 Ga0373955_0157637
730 Ga0373924_0110396
731 Ga0373935_0042353
732 Ga0373935_0100041
733 Ga0373935_0203976
734 Ga0373927_0000988
735 Ga0373927_0044079
736 Ga0373933_0017099
737 Ga0373933_0080437
738 Ga0373947_0053703
739 Ga0373947_0058317
740 Ga0373947_0259361
741 Ga0373937_0013236
742 Ga0373937_0019972
743 Ga0373937_0054235
744 Ga0373937_0247399
745 Ga0373937_0253403
746 Ga0373937_0302547
747 Ga0373925_0123976
748 Ga0373925_0210666
749 Ga0436364_0107695
750 Ga0436364_0255462
751 Ga0436364_0261118
752 Ga0436364_0389676
753 Ga0436364_0522941
754 Ga0436364_0611753
755 Ga0436364_0748068
756 Ga0436364_0816838
757 Ga0436364_1103837
758 Ga0436364_1279952
759 Ga0436364_1287866
760 Ga0436365_0310506
761 Ga0436365_0611710
762 Ga0436365_0723431
763 Ga0436365_1097421
764 Ga0436365_1478444
765 Ga0436360_0186118
766 Ga0436360_0284038
767 Ga0436360_0412445
768 Ga0436360_1176879
769 Ga0436361_0472229
770 Ga0436361_1089336
771 Ga0436363_0814445
772 Ga0436363_1110161
773 Ga0436363_1146269
774 Ga0436362_0097696
775 Ga0436362_0633342
776 Ga0466966_0256803
777 Ga0466961_0127156
778 Ga0466963_0187045
779 Ga0453684_0430861
780 Ga0453684_0452366
781 Ga0466957_0110703
782 Ga0466967_0166845
783 Ga0495592_0013340
784 Ga0495629_0304717
785 Ga0495651_0138205
786 Ga0495651_0152931
787 Ga0495580_0001157
788 Ga0495580_0001569
789 Ga0495580_0058233
790 Ga0495580_0059764
791 Ga0495580_0089079
792 Ga0495580_0134578
793 Ga0495582_0046525
794 Ga0495664_0139971
795 Ga0495594_0082135
796 Ga0495652_0137714
797 Ga0495652_0417022
798 Ga0495665_0010848
799 Ga0495586_0274923
800 Ga0495587_0010690
801 Ga0495587_0165155
802 Ga0495645_0135080
803 Ga0495645_0264010
804 Ga0495667_0063553
805 Ga0495667_0289147
806 Ga0495635_0032571
807 Ga0495588_0223804
808 Ga0495599_0011604
809 Ga0495599_0151888
810 Ga0495623_0122348
811 Ga0495613_0028594
812 Ga0495613_0423609
813 Ga0495604_0114179
814 Ga0495636_0145810
815 Ga0495674_0007240
816 Ga0495674_0138596
817 Ga0495674_0155155
818 Ga0495675_0110404
819 Ga0495675_0124977
820 Ga0495675_0171561
821 Ga0495684_0006455
822 Ga0495684_0040263
823 Ga0495684_0054433
824 Ga0495684_0146932
825 Ga0495593_0117667
826 Ga0495602_0011355
827 Ga0495602_0097170
828 Ga0496104_0226746
829 Ga0496112_0085246
830 Ga0496115_0200073
831 Ga0501031_0002404
832 Ga0501032_0001442
833 Ga0501033_0011646
834 Ga0501034_0009063
835 Ga0501034_0025597
836 Ga0501034_0268152
837 Ga0501036_0003143
838 Ga0501037_0007680
839 Ga0501038_0002019
840 Ga0501038_0129464
841 Ga0501043_0021675
842 Ga0501046_0002097
843 Ga0501046_0054687
844 Ga0501047_0004792
845 Ga0501047_0011424
846 Ga0501047_0015979
847 Ga0501047_0071096
848 Ga0501048_0034671
849 Ga0501067_0004599
850 Ga0501068_0007206
851 Ga0501069_0009988
852 Ga0501070_0004017
853 Ga0501072_0003195
854 Ga0501073_0010061
855 Ga0501074_0036894
856 Ga0501076_0006562
857 Ga0501077_0002599
858 Ga0501079_0034589
859 Ga0501080_0000059
860 Ga0501083_0013464
861 Ga0501035_0011434
862 Ga0501044_0002122
863 Ga0501044_0002626
864 Ga0501044_0023797
865 Ga0501044_0025626
866 Ga0501044_0116927
867 Ga0501084_0010300
868 Ga0501082_0000052
869 Ga0501082_0019576
870 Ga0530510_0101391

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00459

Inositol_P

Inositol monophosphatase family

1

245

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lv0-assembly1.cif.gz_B crystal structure of extragenic suppressor protein suhb from bartonella henselae, native 0.9656 5 253
5zhh-assembly1.cif.gz_C structure of inositol monophosphatase from anabaena (nostoc) sp. pcc 7120 0.9637 3 255
5zhh-assembly1.cif.gz_B structure of inositol monophosphatase from anabaena (nostoc) sp. pcc 7120 0.9615 3 255
5zhh-assembly1.cif.gz_A structure of inositol monophosphatase from anabaena (nostoc) sp. pcc 7120 0.9562 3 255
3lv0-assembly1.cif.gz_A crystal structure of extragenic suppressor protein suhb from bartonella henselae, native 0.9557 5 253
ID Description Score Start End Superfamily
5zhhC01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9751 3 136 3.30.540.10
3lv0B01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9604 5 135 3.30.540.10
2pcrB01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9573 2 136 3.30.540.10
2p3nA01 Alpha Beta;2-Layer Sandwich;Fructose-1,6-Bisphosphatase; Chain A, domain 1;Fructose-1,6-Bisphosphatase, subunit A, domain 1 0.9422 1 136 3.30.540.10
af_Q9VUW3_154_278_3.40.190.80 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2; 0.9387 137 258 3.40.190.80
ID Description Score Start End GO Terms
AF-A0A7V8W6I6-F1-model_v4 Inositol-1-monophosphatase (EC 3.1.3.25) 0.9788 3 144 GO:0006020
GO:0007165
GO:0008934
GO:0046872
AF-A0A7Y3KQF3-F1-model_v4 Inositol-1-monophosphatase (EC 3.1.3.25) 0.9755 2 256 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A2V8HKR1-F1-model_v4 Inositol-1-monophosphatase (EC 3.1.3.25) 0.9748 2 259 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A523RJ61-F1-model_v4 Inositol-1-monophosphatase (EC 3.1.3.25) 0.9723 9 253 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872
AF-A0A7V5KHD9-F1-model_v4 Inositol-1-monophosphatase (EC 3.1.3.25) 0.9716 1 259 GO:0006020
GO:0007165
GO:0008934
GO:0046854
GO:0046872

Map