F443286

General Info

Members Datasets Scaffolds Average Seq Length
435 350 378 98

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100575800|Ga0068855_1005758002
Length 97
Sequence MIVAFRDAWLRAFFVEDLRSRRIPSDLEGRLFRKLQMIDDATTDQDLRTAGNHFERLRGNVAGYHSIRVNRQWRLIFRWNSQRGEAADLYLDDHSYR

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2512875024 Mesorhizobium loti R88b Isolate Nodule
3 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
4 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
5 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
6 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
7 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
8 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
9 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
10 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
11 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
12 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
13 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
14 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
15 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
16 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
17 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
18 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
19 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
20 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
21 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
22 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
23 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
24 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
25 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
26 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
27 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
28 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
29 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
30 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
31 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
32 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
33 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
34 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
35 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
36 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
37 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
38 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
39 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
40 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
41 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
42 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
43 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
44 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
45 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
46 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
47 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
48 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
49 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
50 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
51 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
52 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
56 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
57 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
58 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
59 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
60 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
61 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
62 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
63 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
64 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
65 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
66 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
67 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
70 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
71 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
72 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
73 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
74 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
79 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
80 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
81 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
82 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
83 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
84 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
85 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
86 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
87 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
88 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
89 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
92 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
93 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
94 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
95 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
96 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
97 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
98 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
99 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
100 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
101 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
102 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
103 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
104 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
105 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
106 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
107 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
108 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
109 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
110 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
111 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
112 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
113 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
114 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
118 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
119 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
120 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
121 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
122 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
123 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
124 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
125 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
126 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
127 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
128 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
129 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
130 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
131 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
132 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
133 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
134 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
135 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
136 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
137 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
138 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
139 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
140 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
141 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
142 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
143 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
144 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
145 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
146 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
149 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
150 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
151 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
152 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
153 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
154 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
155 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
156 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
157 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
158 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
159 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
215 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
216 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
217 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
220 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
221 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
222 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
223 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
224 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
225 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
229 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
234 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
235 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
236 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
237 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
238 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
239 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
240 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
241 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
242 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
243 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
246 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
247 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
251 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
254 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
255 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
256 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
257 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
258 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
259 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
260 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
261 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
262 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
263 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
264 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
267 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
273 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
274 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
275 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
276 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
277 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
278 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
279 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
280 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
281 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
282 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
283 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
284 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
285 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
286 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
287 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
288 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
289 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
290 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
291 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
292 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
293 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
294 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
298 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
299 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
300 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
301 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
302 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
303 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
304 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
308 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
309 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
312 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
313 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
314 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
315 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
316 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
319 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
322 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
323 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
324 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
325 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
326 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
327 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
328 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
329 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
330 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
331 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
332 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
333 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
334 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
335 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
336 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
337 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
338 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
339 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
340 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
341 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
342 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
343 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
344 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
345 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
346 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
347 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
348 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
349 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
350 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.9
Metatranscriptomes 0
Isolates 13.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.26
Nodule 10.8
Rhizoplane 5.06
Rhizosphere 64.14
Stem 0
Stem Tuber 0
Unclassified 8.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10022750 3300001991 Bacteria 1203
2 JGI24738J21930_10078107 3300002075 Bacteria 691
3 JGI24034J26672_10027823 3300002239 Bacteria 911
4 rootH2_10041771 3300003320 Bacteria 1357
5 JGI25407J50210_10157967 3300003373 Bacteria 558
6 Ga0055526_1028198 3300003771 Bacteria 1706
7 Ga0070676_10119041 3300005328 Bacteria 1655
8 Ga0070683_100730979 3300005329 Bacteria 948
9 Ga0070690_100107571 3300005330 Bacteria 1856
10 Ga0070670_100240418 3300005331 Bacteria 1576
11 Ga0068869_100730354 3300005334 Bacteria 846
12 Ga0070666_10060417 3300005335 Bacteria 2565
13 Ga0070680_100419078 3300005336 Bacteria 1142
14 Ga0070680_100539255 3300005336 Bacteria 1000
15 Ga0070680_101482098 3300005336 Bacteria 588
16 Ga0068868_100153406 3300005338 Bacteria 1898
17 Ga0070660_100237308 3300005339 Bacteria 1484
18 Ga0070689_100483905 3300005340 Bacteria 1058
19 Ga0070661_100059976 3300005344 Bacteria 2791
20 Ga0070692_10254910 3300005345 Bacteria 1052
21 Ga0070668_100380241 3300005347 Bacteria 1201
22 Ga0070668_100741503 3300005347 Bacteria 869
23 Ga0070675_100135900 3300005354 Bacteria 2098
24 Ga0070671_100517254 3300005355 Bacteria 1027
25 Ga0070674_100602669 3300005356 Bacteria 928
26 Ga0070673_100040996 3300005364 Bacteria 3555
27 Ga0070659_101176733 3300005366 Bacteria 677
28 Ga0070705_101194658 3300005440 Bacteria 626
29 Ga0070700_100108499 3300005441 Bacteria 1841
30 Ga0070694_100509035 3300005444 Bacteria 959
31 Ga0070663_100026558 3300005455 Bacteria 3923
32 Ga0070678_100062026 3300005456 Bacteria 2758
33 Ga0070662_100048712 3300005457 Bacteria 3053
34 Ga0070681_10028806 3300005458 Bacteria 5581
35 Ga0068867_101050479 3300005459 Bacteria 741
36 Ga0070698_100000110 3300005471 Bacteria 69016
37 Ga0070699_100386231 3300005518 Bacteria 1264
38 Ga0070699_102011759 3300005518 Bacteria 528
39 Ga0070679_100438004 3300005530 Bacteria 1252
40 Ga0070679_100505756 3300005530 Bacteria 1152
41 Ga0068853_100369717 3300005539 Bacteria 1337
42 Ga0068853_100473987 3300005539 Bacteria 1179
43 Ga0070672_100228855 3300005543 Bacteria 1561
44 Ga0070686_100171620 3300005544 Bacteria 1534
45 Ga0070695_100215920 3300005545 Bacteria 1379
46 Ga0070693_100019690 3300005547 Bacteria 3544
47 Ga0070665_100056527 3300005548 Bacteria 3934
48 Ga0070665_102374686 3300005548 Bacteria 533
49 Ga0070704_100096845 3300005549 Bacteria 2213
50 Ga0068855_100053277 3300005563 Bacteria 4760
51 Ga0068855_100575800 3300005563 Bacteria 1216
52 Ga0070664_100012188 3300005564 Bacteria 6987
53 Ga0068857_100087153 3300005577 Bacteria 2792
54 Ga0068857_100135590 3300005577 Bacteria 2222
55 Ga0068854_100254781 3300005578 Bacteria 1403
56 Ga0068856_100029105 3300005614 Bacteria 5396
57 Ga0068856_100928336 3300005614 Bacteria 889
58 Ga0070702_100155447 3300005615 Bacteria 1473
59 Ga0068852_100049346 3300005616 Bacteria 3600
60 Ga0068859_100008778 3300005617 Bacteria 10203
61 Ga0068859_100431918 3300005617 Bacteria 1413
62 Ga0068864_100078725 3300005618 Bacteria 2885
63 Ga0068866_10050311 3300005718 Bacteria 2116
64 Ga0068861_100630725 3300005719 Bacteria 987
65 Ga0068870_10087538 3300005840 Bacteria 1734
66 Ga0068863_100380842 3300005841 Bacteria 1377
67 Ga0068858_100582480 3300005842 Bacteria 1084
68 Ga0068860_100169650 3300005843 Bacteria 2107
69 Ga0068860_100192815 3300005843 Bacteria 1972
70 Ga0068860_100402916 3300005843 Bacteria 1353
71 Ga0068862_100102339 3300005844 Bacteria 2507
72 Ga0081455_10860026 3300005937 Bacteria 566
73 Ga0081538_10221982 3300005981 Bacteria 748
74 Ga0081540_1001239 3300005983 Bacteria 22275
75 Ga0081540_1022338 3300005983 Bacteria 3738
76 Ga0081540_1289048 3300005983 Bacteria 565
77 Ga0081539_10117920 3300005985 Bacteria 1323
78 Ga0081539_10181327 3300005985 Bacteria 987
79 Ga0075365_10045048 3300006038 Bacteria 2892
80 Ga0075368_10005174 3300006042 Bacteria 4473
81 Ga0075363_100906878 3300006048 Bacteria 540
82 Ga0075364_10427512 3300006051 Bacteria 904
83 Ga0075432_10377684 3300006058 Bacteria 607
84 Ga0075362_10079321 3300006177 Bacteria 1511
85 Ga0075367_10370689 3300006178 Bacteria 904
86 Ga0075369_10236724 3300006186 Bacteria 846
87 Ga0075366_10398978 3300006195 Bacteria 846
88 Ga0075370_10379782 3300006353 Bacteria 846
89 Ga0068871_100055523 3300006358 Bacteria 3215
90 Ga0075428_100579818 3300006844 Bacteria 1199
91 Ga0075433_10062629 3300006852 Bacteria 3257
92 Ga0075434_100006883 3300006871 Bacteria 10474
93 Ga0097620_100008779 3300006931 Bacteria 10203
94 Ga0097620_100431936 3300006931 Bacteria 1413
95 Ga0075435_100013493 3300007076 Bacteria 6079
96 Ga0075435_101118616 3300007076 Bacteria 689
97 Ga0099794_10013072 3300007265 Bacteria 3603
98 Ga0099795_10252727 3300007788 Bacteria 761
99 Ga0099795_10601942 3300007788 Bacteria 523
100 Ga0105240_10077909 3300009093 Bacteria 4083
101 Ga0111539_10038907 3300009094 Bacteria 5736
102 Ga0111539_11658726 3300009094 Bacteria 741
103 Ga0105245_10524060 3300009098 Bacteria 1204
104 Ga0105245_11036620 3300009098 Bacteria 865
105 Ga0105247_10004927 3300009101 Bacteria 8491
106 Ga0105247_10498638 3300009101 Bacteria 887
107 Ga0105243_10339024 3300009148 Bacteria 1376
108 Ga0105241_10021295 3300009174 Bacteria 4791
109 Ga0105242_10068196 3300009176 Bacteria 2942
110 Ga0105242_12208671 3300009176 Bacteria 596
111 Ga0105248_10182189 3300009177 Bacteria 2367
112 Ga0105248_10275765 3300009177 Bacteria 1893
113 Ga0105248_10468360 3300009177 Bacteria 1420
114 Ga0105248_12371715 3300009177 Bacteria 604
115 Ga0105237_10016885 3300009545 Bacteria 7574
116 Ga0105237_10158654 3300009545 Bacteria 2260
117 Ga0105238_10097234 3300009551 Bacteria 2930
118 Ga0105238_10187339 3300009551 Bacteria 2045
119 Ga0105238_13041341 3300009551 Bacteria 503
120 Ga0105249_10021753 3300009553 Bacteria 5742
121 Ga0105249_10546106 3300009553 Bacteria 1209
122 Ga0099796_10271014 3300010159 Bacteria 711
123 Ga0105239_10266903 3300010375 Bacteria 1924
124 Ga0105239_12953435 3300010375 Bacteria 554
125 Ga0105246_10223100 3300011119 Bacteria 1479
126 Ga0105246_10402996 3300011119 Bacteria 1136
127 Ga0105246_11179281 3300011119 Bacteria 704
128 Ga0157373_10250814 3300013100 Bacteria 1252
129 Ga0157370_10072578 3300013104 Bacteria 3247
130 Ga0157369_10956916 3300013105 Bacteria 877
131 Ga0157374_10026936 3300013296 Bacteria 5178
132 Ga0157378_10371865 3300013297 Bacteria 1401
133 Ga0163162_10091525 3300013306 Bacteria 3125
134 Ga0163162_10993571 3300013306 Bacteria 949
135 Ga0157372_10137592 3300013307 Bacteria 2813
136 Ga0157372_10345995 3300013307 Bacteria 1732
137 Ga0157372_11810617 3300013307 Bacteria 702
138 Ga0157375_10117588 3300013308 Bacteria 2764
139 Ga0163163_10034160 3300014325 Bacteria 4923
140 Ga0157377_10015108 3300014745 Bacteria 3940
141 Ga0157379_10447134 3300014968 Bacteria 1192
142 Ga0157379_12555637 3300014968 Unclassified 511
143 Ga0157376_11031727 3300014969 Bacteria 846
144 Ga0213872_10104472 3300021361 Bacteria 1261
145 Ga0213876_10011066 3300021384 Bacteria 4828
146 Ga0213875_10016511 3300021388 Bacteria 3578
147 Ga0213871_10197375 3300021441 Bacteria 627
148 Ga0209233_1038194 3300025261 Bacteria 1061
149 Ga0209564_1000248 3300025295 Bacteria 116617
150 Ga0207697_10015337 3300025315 Bacteria 3167
151 Ga0207656_10129490 3300025321 Bacteria 1181
152 Ga0207642_11092561 3300025899 Bacteria 516
153 Ga0207710_10064047 3300025900 Bacteria 1674
154 Ga0207688_10209044 3300025901 Bacteria 1172
155 Ga0207680_10262330 3300025903 Bacteria 1196
156 Ga0207645_10007608 3300025907 Bacteria 7636
157 Ga0207643_10018338 3300025908 Bacteria 3833
158 Ga0207684_10326384 3300025910 Bacteria 1322
159 Ga0207654_10100603 3300025911 Bacteria 1781
160 Ga0207707_10131342 3300025912 Bacteria 2190
161 Ga0207671_10024603 3300025914 Bacteria 4524
162 Ga0207671_10091078 3300025914 Bacteria 2297
163 Ga0207660_10735743 3300025917 Bacteria 805
164 Ga0207662_10374351 3300025918 Bacteria 961
165 Ga0207657_10255161 3300025919 Bacteria 1397
166 Ga0207649_10821751 3300025920 Bacteria 726
167 Ga0207652_10239395 3300025921 Bacteria 1636
168 Ga0207652_10538865 3300025921 Bacteria 1049
169 Ga0207694_10045686 3300025924 Bacteria 3383
170 Ga0207694_10428000 3300025924 Bacteria 1103
171 Ga0207650_10240163 3300025925 Bacteria 1464
172 Ga0207659_10183647 3300025926 Bacteria 1659
173 Ga0207687_10017061 3300025927 Bacteria 4774
174 Ga0207644_10049385 3300025931 Bacteria 3012
175 Ga0207706_10015757 3300025933 Bacteria 6833
176 Ga0207686_10274699 3300025934 Bacteria 1241
177 Ga0207709_10540463 3300025935 Bacteria 915
178 Ga0207670_10627647 3300025936 Bacteria 884
179 Ga0207691_10104026 3300025940 Bacteria 2531
180 Ga0207711_10060996 3300025941 Bacteria 3251
181 Ga0207689_10092939 3300025942 Bacteria 2478
182 Ga0207689_10384762 3300025942 Bacteria 1168
183 Ga0207679_10078661 3300025945 Bacteria 2512
184 Ga0207667_10244883 3300025949 Bacteria 1834
185 Ga0207651_10071139 3300025960 Bacteria 2464
186 Ga0207712_11220439 3300025961 Bacteria 671
187 Ga0207668_10109602 3300025972 Bacteria 2068
188 Ga0207668_10629707 3300025972 Bacteria 937
189 Ga0207668_11916533 3300025972 Bacteria 534
190 Ga0207640_10158180 3300025981 Bacteria 1673
191 Ga0207658_11869577 3300025986 Unclassified 547
192 Ga0207677_10382711 3300026023 Bacteria 1188
193 Ga0207703_10040460 3300026035 Bacteria 3730
194 Ga0207639_10011994 3300026041 Bacteria 6030
195 Ga0207678_10471573 3300026067 Bacteria 1093
196 Ga0207708_10413591 3300026075 Bacteria 1117
197 Ga0207702_10181927 3300026078 Bacteria 1936
198 Ga0207702_10825700 3300026078 Bacteria 917
199 Ga0207641_10049911 3300026088 Bacteria 3538
200 Ga0207641_10188169 3300026088 Bacteria 1896
201 Ga0207648_10975716 3300026089 Bacteria 793
202 Ga0207674_10045413 3300026116 Bacteria 4519
203 Ga0207674_10135595 3300026116 Bacteria 2424
204 Ga0207675_100039891 3300026118 Bacteria 4381
205 Ga0207675_100134338 3300026118 Bacteria 2346
206 Ga0207683_10017444 3300026121 Bacteria 6119
207 Ga0207698_10423998 3300026142 Bacteria 1277
208 Ga0209588_1002876 3300027671 Bacteria 4729
209 Ga0209813_10105349 3300027866 Bacteria 965
210 Ga0207428_10155564 3300027907 Bacteria 1739
211 Ga0268266_10055955 3300028379 Bacteria 3392
212 Ga0268266_11355779 3300028379 Bacteria 687
213 Ga0268265_10056112 3300028380 Bacteria 2995
214 Ga0268265_10271646 3300028380 Bacteria 1512
215 Ga0268264_10097160 3300028381 Bacteria 2552
216 Ga0265338_10246272 3300028800 Bacteria 1321
217 Ga0265325_10082342 3300031241 Bacteria 1597
218 Ga0265340_10142891 3300031247 Bacteria 1094
219 Ga0265339_10160039 3300031249 Bacteria 1133
220 Ga0265339_10318866 3300031249 Bacteria 738
221 Ga0265316_10347382 3300031344 Bacteria 1074
222 Ga0265316_10867768 3300031344 Bacteria 631
223 Ga0307509_10200431 3300031507 Bacteria 1834
224 Ga0265342_10006071 3300031712 Bacteria 9064
225 Ga0307405_10715548 3300031731 Bacteria 831
226 Ga0307410_10380213 3300031852 Bacteria 1136
227 Ga0307410_10852721 3300031852 Bacteria 778
228 Ga0307409_100989282 3300031995 Bacteria 859
229 Ga0307510_10202233 3300033180 Bacteria 1519
230 Ga0373931_0676929 3300035691 Bacteria 680
231 Ga0373937_0480691 3300036401 Bacteria 1180
232 Ga0436364_0412423 3300037853 Bacteria 1210
233 Ga0436365_0177391 3300039437 Bacteria 10168
234 Ga0436365_1461300 3300039437 Bacteria 1096
235 Ga0436360_0489873 3300039438 Bacteria 666
236 Ga0436361_0524579 3300039447 Bacteria 915
237 Ga0436363_0407663 3300039450 Bacteria 1885
238 Ga0436363_0624123 3300039450 Bacteria 2291
239 Ga0436363_1643446 3300039450 Bacteria 825
240 Ga0436362_0716409 3300039453 Bacteria 502
241 Ga0451789_0789698 3300041443 Bacteria 639
242 Ga0451793_0492855 3300041452 Bacteria 579
243 Ga0451837_0243056 3300041494 Bacteria 2256
244 Ga0451841_0173740 3300041498 Bacteria 2218
245 Ga0451847_0017562 3300041503 Bacteria 1739
246 Ga0451849_0315157 3300041505 Bacteria 2590
247 Ga0451851_0728231 3300041507 Bacteria 1146
248 Ga0451843_0869854 3300041509 Bacteria 860
249 Ga0451855_0201048 3300041511 Bacteria 1917
250 Ga0451853_1494414 3300041512 Bacteria 1402
251 Ga0495617_053559 3300046452 Bacteria 1340
252 Ga0495603_0270146 3300046455 Bacteria 978
253 Ga0495590_0120671 3300046457 Bacteria 939
254 Ga0495638_0014704 3300046460 Bacteria 5279
255 Ga0495638_0035906 3300046460 Bacteria 3158
256 Ga0495638_0226422 3300046460 Bacteria 1042
257 Ga0495605_0097553 3300046474 Bacteria 1354
258 Ga0495584_0025101 3300046491 Bacteria 3021
259 Ga0495585_0053060 3300046492 Bacteria 2244
260 Ga0495596_0030229 3300046500 Bacteria 2169
261 Ga0495607_0139091 3300046501 Bacteria 1254
262 Ga0495607_0405716 3300046501 Bacteria 619
263 Ga0495606_0137136 3300046507 Bacteria 1448
264 Ga0495610_0124744 3300046512 Bacteria 1124
265 Ga0495631_0134941 3300046518 Bacteria 1060
266 Ga0495631_0394439 3300046518 Bacteria 589
267 Ga0495632_0013928 3300046519 Bacteria 4569
268 Ga0495637_0104398 3300046520 Bacteria 1104
269 Ga0495643_0315078 3300046522 Bacteria 709
270 Ga0495648_0000887 3300046524 Bacteria 31432
271 Ga0495648_0124878 3300046524 Bacteria 1377
272 Ga0495654_0202953 3300046530 Bacteria 847
273 Ga0495609_0108942 3300046538 Bacteria 1196
274 Ga0495633_0032435 3300046558 Bacteria 2524
275 Ga0495656_0008612 3300046615 Bacteria 3647
276 Ga0495668_0293783 3300046616 Bacteria 890
277 Ga0495668_0338160 3300046616 Bacteria 826
278 Ga0495611_0358077 3300046648 Bacteria 669
279 Ga0495625_0079173 3300046660 Bacteria 2292
280 Ga0495659_0186166 3300046664 Bacteria 847
281 Ga0495669_0065354 3300046684 Bacteria 1651
282 Ga0495670_0031354 3300046691 Bacteria 2641
283 Ga0495671_0112881 3300046692 Bacteria 1327
284 Ga0495660_0089918 3300046810 Bacteria 1598
285 Ga0495581_0234215 3300047315 Bacteria 1074
286 Ga0495636_0055007 3300047318 Bacteria 1673
287 Ga0495672_0056735 3300047320 Bacteria 2277
288 Ga0495672_0078760 3300047320 Bacteria 1842
289 Ga0495672_0246436 3300047320 Bacteria 869
290 Ga0495672_0255106 3300047320 Bacteria 849
291 Ga0495683_0054162 3300047323 Bacteria 2000
292 Ga0495687_060401 3300047443 Bacteria 1563
293 Ga0495677_0105269 3300047445 Bacteria 1070
294 Ga0495679_112723 3300047446 Bacteria 748
295 Ga0495685_106108 3300047447 Bacteria 926
296 Ga0495673_0000381 3300047469 Bacteria 52869
297 Ga0495673_0153607 3300047469 Bacteria 888
298 Ga0495686_0107877 3300047472 Bacteria 1673
299 Ga0496100_0154853 3300048903 Bacteria 1638
300 Ga0496100_0349921 3300048903 Bacteria 1116
301 Ga0496101_0039655 3300048904 Bacteria 3352
302 Ga0496102_0107438 3300048905 Bacteria 2598
303 Ga0496102_0149070 3300048905 Bacteria 2197
304 Ga0496103_0185223 3300048906 Bacteria 1338
305 Ga0496104_0295232 3300048907 Bacteria 1533
306 Ga0496104_0299415 3300048907 Bacteria 1520
307 Ga0496105_0131771 3300048908 Bacteria 2061
308 Ga0496105_0338520 3300048908 Bacteria 1203
309 Ga0496106_0070662 3300048909 Bacteria 2667
310 Ga0496107_0010521 3300048910 Bacteria 6429
311 Ga0496108_0057259 3300048911 Bacteria 3275
312 Ga0496109_0046905 3300048912 Bacteria 3926
313 Ga0496110_0024713 3300048913 Bacteria 5124
314 Ga0496111_0960738 3300048914 Bacteria 613
315 Ga0496112_0031289 3300048915 Bacteria 5160
316 Ga0496113_0196256 3300048916 Bacteria 1603
317 Ga0496114_0115756 3300048917 Bacteria 2301
318 Ga0496115_0927355 3300048918 Bacteria 670
319 Ga0496116_0306764 3300048919 Bacteria 752
320 Ga0496117_0096406 3300048920 Bacteria 1887
321 Ga0496118_0023434 3300048921 Bacteria 5361
322 Ga0496120_0001104 3300048923 Bacteria 35202
323 Ga0496120_0207584 3300048923 Bacteria 944
324 Ga0496121_0081845 3300048924 Bacteria 2554
325 Ga0496121_0148918 3300048924 Bacteria 1725
326 Ga0496121_0426203 3300048924 Bacteria 862
327 Ga0496121_0679110 3300048924 Bacteria 623
328 Ga0496125_0191158 3300048928 Bacteria 1351
329 Ga0496126_0148184 3300048929 Bacteria 2013
330 Ga0496126_0488574 3300048929 Bacteria 986
331 Ga0495682_0037211 3300049460 Bacteria 1791
332 Ga0501034_1125962 3300049571 Bacteria 665
333 Ga0501036_0510748 3300049572 Bacteria 1000
334 Ga0501072_0101186 3300049588 Bacteria 2291
335 Ga0501079_0349373 3300049741 Bacteria 1159
336 Ga0501081_0852513 3300049743 Bacteria 686
337 Ga0501044_0156051 3300049823 Bacteria 2262
338 Ga0501044_0262867 3300049823 Bacteria 1664
339 nmdc:mga03683_29182_c1 3300050489 Bacteria 2198
340 nmdc:mga00v17_1110_c1 3300050491 Bacteria 14150
341 nmdc:mga00v17_415310_c1 3300050491 Bacteria 874
342 nmdc:mga0yw44_4615_c1 3300050492 Bacteria 6356
343 nmdc:mga0k408_123333_c1 3300050493 Bacteria 1536
344 nmdc:mga04h51_102513_c1 3300050495 Bacteria 1045
345 nmdc:mga07m45_230110_c1 3300050496 Bacteria 1079
346 nmdc:mga0rr50_68561_c1 3300050513 Bacteria 2698
347 nmdc:mga0a205_24486_c2 3300050515 Bacteria 5435
348 nmdc:mga0sz30_12484_c1 3300050516 Bacteria 3307
349 Ga0495601_0113951 3300053077 Bacteria 1752
350 Ga0500610_0059696 3300053079 Bacteria 1990
351 Ga0500610_0309953 3300053079 Bacteria 691
352 Ga0500578_0244786 3300053086 Bacteria 1082
353 Ga0500643_010017 3300053087 Bacteria 3570
354 Ga0500644_0000598 3300053088 Bacteria 13780
355 Ga0500646_0277294 3300053090 Bacteria 596
356 Ga0500647_0300571 3300053091 Bacteria 686
357 Ga0500651_0048584 3300053093 Bacteria 2666
358 Ga0500651_0252618 3300053093 Bacteria 1025
359 Ga0500641_0000557 3300053096 Bacteria 13479
360 Ga0500641_0017842 3300053096 Bacteria 2662
361 Ga0500641_0118893 3300053096 Bacteria 1138
362 Ga0500650_0177135 3300053098 Bacteria 978
363 Ga0500650_0347816 3300053098 Bacteria 649
364 Ga0500595_091093 3300053119 Bacteria 882
365 Ga0500559_0152339 3300053136 Bacteria 1085
366 Ga0500577_0036666 3300053142 Bacteria 1757
367 Ga0500577_0249722 3300053142 Bacteria 771
368 Ga0500588_0210301 3300053146 Bacteria 723
369 Ga0500588_0224268 3300053146 Bacteria 701
370 Ga0500590_251943 3300053148 Bacteria 701
371 Ga0500603_125953 3300053150 Bacteria 780
372 Ga0500604_0076810 3300053151 Bacteria 1074
373 Ga0500616_0007186 3300053153 Bacteria 7120
374 Ga0500627_0224524 3300053158 Bacteria 837
375 Ga0500627_0356037 3300053158 Bacteria 631
376 Ga0500636_0040369 3300053177 Bacteria 2760
377 Ga0500609_006127 3300053731 Bacteria 1639
378 Ga0501082_0152034 3300060353 Bacteria 2011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2503198000 2503201552 94
2 iso_pu_bacteria 2512875024 2512959309 94
3 iso_pu_bacteria 2513237087 2513589356 94
4 iso_pu_bacteria 2517093000 2517093692 94
5 iso_pu_bacteria 2585427608 2585900322 94
6 iso_pu_bacteria 2643221595 2643984417 94
7 iso_pu_bacteria 2643221627 2644153274 94
8 iso_pu_bacteria 2724679232 2725951016 94
9 iso_pu_bacteria 2757320392 2757570783 94
10 iso_pu_bacteria 2842922631 2842927273 94
11 iso_pu_bacteria 2869169390 2869175670 94
12 iso_pu_bacteria 2869242130 2869245053 94
13 iso_pu_bacteria 2869256925 2869260278 94
14 iso_pu_bacteria 2871435913 2871441448 94
15 iso_pu_bacteria 2871481445 2871481654 94
16 iso_pu_bacteria 2874116593 2874119522 94
17 iso_pu_bacteria 2876377896 2876378890 94
18 iso_pu_bacteria 2876386047 2876389905 94
19 iso_pu_bacteria 2876420981 2876426882 94
20 iso_pu_bacteria 2885305155 2885307349 94
21 iso_pu_bacteria 2885326080 2885327287 94
22 iso_pu_bacteria 2885334103 2885336593 94
23 iso_pu_bacteria 2889010040 2889010715 94
24 iso_pu_bacteria 2906401398 2906405409 94
25 iso_pu_bacteria 2906427513 2906429190 94
26 iso_pu_bacteria 2924710171 2924715492 94
27 iso_pu_bacteria 2924741084 2924745391 94
28 iso_pu_bacteria 2935777560 2935784379 94
29 iso_pu_bacteria 2938014810 2938017953 94
30 iso_pu_bacteria 2958064165 2958064357 94
31 iso_pu_bacteria 2977864932 2977867068 94
32 iso_pu_bacteria 2987652177 2987657950 94
33 iso_pu_bacteria 3005416602 3005423293 94
34 iso_pu_bacteria 8005314921 8005315620 94
35 iso_pu_bacteria 8006984368 8006992323 94
36 iso_pu_bacteria 8006984368 8006993843 94
37 iso_pu_bacteria 8016583857 8016589357 94
38 iso_pu_bacteria 8016613128 8016619479 94
39 iso_pu_bacteria 8019538911 8019541721 94
40 iso_pu_bacteria 8019555841 8019561031 94
41 iso_pu_bacteria 8019565922 8019571118 94
42 iso_pu_bacteria 2937980651 2937982960 95
43 iso_pu_bacteria 2958108152 2958113950 95
44 iso_pu_bacteria 2961183825 2961187002 95
45 iso_pu_bacteria 2968138860 2968140916 95
46 iso_pu_bacteria 2970510686 2970514639 95
47 iso_pu_bacteria 2970532167 2970537881 95
48 iso_pu_bacteria 2970627176 2970630905 95
49 iso_pu_bacteria 2977851361 2977853028 95
50 iso_pu_bacteria 2977898635 2977904927 95
51 iso_pu_bacteria 2977907340 2977911512 95
52 iso_pu_bacteria 2979764755 2979768376 95
53 iso_pu_bacteria 2996386984 2996391428 95
54 iso_pu_bacteria 3004248173 3004251064 95
55 iso_pu_bacteria 3004268573 3004274963 95
56 iso_pu_bacteria 8004312739 8004314875 95
57 iso_pu_bacteria 8004727605 8004734502 95
58 3300031247 Ga0265340_10142891 Ga0265340_101428913 96
59 3300005336 Ga0070680_100419078 Ga0070680_1004190783 97
60 3300005530 Ga0070679_100505756 Ga0070679_1005057563 97
61 3300005563 Ga0068855_100575800 Ga0068855_1005758002 97
62 3300025914 Ga0207671_10091078 Ga0207671_100910783 97
63 3300025917 Ga0207660_10735743 Ga0207660_107357432 97
64 3300025921 Ga0207652_10239395 Ga0207652_102393951 97
65 3300026116 Ga0207674_10135595 Ga0207674_101355953 97
66 3300048903 Ga0496100_0349921 Ga0496100_0349921_46_354 97
67 3300048907 Ga0496104_0295232 Ga0496104_0295232_737_1030 97
68 3300048908 Ga0496105_0131771 Ga0496105_0131771_574_867 97
69 3300048914 Ga0496111_0960738 Ga0496111_0960738_288_581 97
70 3300001991 JGI24743J22301_10022750 JGI24743J22301_100227502 98
71 3300002075 JGI24738J21930_10078107 JGI24738J21930_100781072 98
72 3300002239 JGI24034J26672_10027823 JGI24034J26672_100278232 98
73 3300003320 rootH2_10041771 rootH2_100417713 98
74 3300003373 JGI25407J50210_10157967 JGI25407J50210_101579671 98
75 3300003771 Ga0055526_1028198 Ga0055526_10281982 98
76 3300005328 Ga0070676_10119041 Ga0070676_101190412 98
77 3300005329 Ga0070683_100730979 Ga0070683_1007309792 98
78 3300005330 Ga0070690_100107571 Ga0070690_1001075712 98
79 3300005331 Ga0070670_100240418 Ga0070670_1002404182 98
80 3300005334 Ga0068869_100730354 Ga0068869_1007303542 98
81 3300005335 Ga0070666_10060417 Ga0070666_100604172 98
82 3300005336 Ga0070680_100539255 Ga0070680_1005392553 98
83 3300005336 Ga0070680_101482098 Ga0070680_1014820981 98
84 3300005338 Ga0068868_100153406 Ga0068868_1001534062 98
85 3300005339 Ga0070660_100237308 Ga0070660_1002373083 98
86 3300005340 Ga0070689_100483905 Ga0070689_1004839052 98
87 3300005344 Ga0070661_100059976 Ga0070661_1000599762 98
88 3300005345 Ga0070692_10254910 Ga0070692_102549102 98
89 3300005347 Ga0070668_100380241 Ga0070668_1003802412 98
90 3300005347 Ga0070668_100741503 Ga0070668_1007415032 98
91 3300005354 Ga0070675_100135900 Ga0070675_1001359002 98
92 3300005355 Ga0070671_100517254 Ga0070671_1005172542 98
93 3300005356 Ga0070674_100602669 Ga0070674_1006026691 98
94 3300005364 Ga0070673_100040996 Ga0070673_1000409965 98
95 3300005366 Ga0070659_101176733 Ga0070659_1011767331 98
96 3300005440 Ga0070705_101194658 Ga0070705_1011946582 98
97 3300005441 Ga0070700_100108499 Ga0070700_1001084992 98
98 3300005444 Ga0070694_100509035 Ga0070694_1005090352 98
99 3300005455 Ga0070663_100026558 Ga0070663_1000265586 98
100 3300005456 Ga0070678_100062026 Ga0070678_1000620262 98
101 3300005457 Ga0070662_100048712 Ga0070662_1000487123 98
102 3300005458 Ga0070681_10028806 Ga0070681_100288064 98
103 3300005459 Ga0068867_101050479 Ga0068867_1010504791 98
104 3300005471 Ga0070698_100000110 Ga0070698_10000011052 98
105 3300005518 Ga0070699_100386231 Ga0070699_1003862312 98
106 3300005518 Ga0070699_102011759 Ga0070699_1020117591 98
107 3300005530 Ga0070679_100438004 Ga0070679_1004380042 98
108 3300005539 Ga0068853_100369717 Ga0068853_1003697172 98
109 3300005539 Ga0068853_100473987 Ga0068853_1004739872 98
110 3300005543 Ga0070672_100228855 Ga0070672_1002288551 98
111 3300005544 Ga0070686_100171620 Ga0070686_1001716202 98
112 3300005545 Ga0070695_100215920 Ga0070695_1002159201 98
113 3300005547 Ga0070693_100019690 Ga0070693_1000196904 98
114 3300005548 Ga0070665_100056527 Ga0070665_1000565271 98
115 3300005548 Ga0070665_102374686 Ga0070665_1023746862 98
116 3300005549 Ga0070704_100096845 Ga0070704_1000968453 98
117 3300005563 Ga0068855_100053277 Ga0068855_1000532773 98
118 3300005564 Ga0070664_100012188 Ga0070664_1000121886 98
119 3300005577 Ga0068857_100087153 Ga0068857_1000871534 98
120 3300005577 Ga0068857_100135590 Ga0068857_1001355903 98
121 3300005578 Ga0068854_100254781 Ga0068854_1002547811 98
122 3300005614 Ga0068856_100029105 Ga0068856_1000291054 98
123 3300005614 Ga0068856_100928336 Ga0068856_1009283363 98
124 3300005615 Ga0070702_100155447 Ga0070702_1001554473 98
125 3300005616 Ga0068852_100049346 Ga0068852_1000493465 98
126 3300005617 Ga0068859_100008778 Ga0068859_1000087788 98
127 3300005617 Ga0068859_100431918 Ga0068859_1004319182 98
128 3300005618 Ga0068864_100078725 Ga0068864_1000787254 98
129 3300005718 Ga0068866_10050311 Ga0068866_100503112 98
130 3300005719 Ga0068861_100630725 Ga0068861_1006307252 98
131 3300005840 Ga0068870_10087538 Ga0068870_100875382 98
132 3300005841 Ga0068863_100380842 Ga0068863_1003808422 98
133 3300005842 Ga0068858_100582480 Ga0068858_1005824802 98
134 3300005843 Ga0068860_100169650 Ga0068860_1001696502 98
135 3300005843 Ga0068860_100192815 Ga0068860_1001928153 98
136 3300005843 Ga0068860_100402916 Ga0068860_1004029163 98
137 3300005844 Ga0068862_100102339 Ga0068862_1001023392 98
138 3300005937 Ga0081455_10860026 Ga0081455_108600262 98
139 3300005981 Ga0081538_10221982 Ga0081538_102219822 98
140 3300005983 Ga0081540_1001239 Ga0081540_100123913 98
141 3300005983 Ga0081540_1022338 Ga0081540_10223384 98
142 3300005983 Ga0081540_1289048 Ga0081540_12890481 98
143 3300005985 Ga0081539_10117920 Ga0081539_101179202 98
144 3300005985 Ga0081539_10181327 Ga0081539_101813272 98
145 3300006038 Ga0075365_10045048 Ga0075365_100450485 98
146 3300006042 Ga0075368_10005174 Ga0075368_100051744 98
147 3300006048 Ga0075363_100906878 Ga0075363_1009068782 98
148 3300006051 Ga0075364_10427512 Ga0075364_104275122 98
149 3300006058 Ga0075432_10377684 Ga0075432_103776842 98
150 3300006177 Ga0075362_10079321 Ga0075362_100793213 98
151 3300006178 Ga0075367_10370689 Ga0075367_103706892 98
152 3300006186 Ga0075369_10236724 Ga0075369_102367242 98
153 3300006195 Ga0075366_10398978 Ga0075366_103989782 98
154 3300006353 Ga0075370_10379782 Ga0075370_103797822 98
155 3300006358 Ga0068871_100055523 Ga0068871_1000555232 98
156 3300006844 Ga0075428_100579818 Ga0075428_1005798182 98
157 3300006852 Ga0075433_10062629 Ga0075433_100626292 98
158 3300006871 Ga0075434_100006883 Ga0075434_1000068834 98
159 3300006931 Ga0097620_100008779 Ga0097620_1000087798 98
160 3300006931 Ga0097620_100431936 Ga0097620_1004319362 98
161 3300007076 Ga0075435_100013493 Ga0075435_1000134936 98
162 3300007076 Ga0075435_101118616 Ga0075435_1011186162 98
163 3300007265 Ga0099794_10013072 Ga0099794_100130722 98
164 3300007788 Ga0099795_10252727 Ga0099795_102527272 98
165 3300007788 Ga0099795_10601942 Ga0099795_106019422 98
166 3300009093 Ga0105240_10077909 Ga0105240_100779094 98
167 3300009094 Ga0111539_10038907 Ga0111539_100389075 98
168 3300009094 Ga0111539_11658726 Ga0111539_116587262 98
169 3300009098 Ga0105245_10524060 Ga0105245_105240602 98
170 3300009098 Ga0105245_11036620 Ga0105245_110366201 98
171 3300009101 Ga0105247_10004927 Ga0105247_100049279 98
172 3300009101 Ga0105247_10498638 Ga0105247_104986382 98
173 3300009148 Ga0105243_10339024 Ga0105243_103390242 98
174 3300009174 Ga0105241_10021295 Ga0105241_100212958 98
175 3300009176 Ga0105242_10068196 Ga0105242_100681962 98
176 3300009176 Ga0105242_12208671 Ga0105242_122086712 98
177 3300009177 Ga0105248_10182189 Ga0105248_101821894 98
178 3300009177 Ga0105248_10275765 Ga0105248_102757652 98
179 3300009177 Ga0105248_10468360 Ga0105248_104683603 98
180 3300009177 Ga0105248_12371715 Ga0105248_123717152 98
181 3300009545 Ga0105237_10016885 Ga0105237_100168853 98
182 3300009545 Ga0105237_10158654 Ga0105237_101586544 98
183 3300009551 Ga0105238_10097234 Ga0105238_100972344 98
184 3300009551 Ga0105238_10187339 Ga0105238_101873392 98
185 3300009551 Ga0105238_13041341 Ga0105238_130413411 98
186 3300009553 Ga0105249_10021753 Ga0105249_100217533 98
187 3300009553 Ga0105249_10546106 Ga0105249_105461062 98
188 3300010159 Ga0099796_10271014 Ga0099796_102710141 98
189 3300010375 Ga0105239_10266903 Ga0105239_102669032 98
190 3300010375 Ga0105239_12953435 Ga0105239_129534351 98
191 3300011119 Ga0105246_10223100 Ga0105246_102231003 98
192 3300011119 Ga0105246_10402996 Ga0105246_104029962 98
193 3300011119 Ga0105246_11179281 Ga0105246_111792812 98
194 3300013100 Ga0157373_10250814 Ga0157373_102508142 98
195 3300013104 Ga0157370_10072578 Ga0157370_100725783 98
196 3300013105 Ga0157369_10956916 Ga0157369_109569162 98
197 3300013296 Ga0157374_10026936 Ga0157374_100269367 98
198 3300013297 Ga0157378_10371865 Ga0157378_103718652 98
199 3300013306 Ga0163162_10091525 Ga0163162_100915254 98
200 3300013306 Ga0163162_10993571 Ga0163162_109935712 98
201 3300013307 Ga0157372_10137592 Ga0157372_101375923 98
202 3300013307 Ga0157372_10345995 Ga0157372_103459952 98
203 3300013307 Ga0157372_11810617 Ga0157372_118106171 98
204 3300013308 Ga0157375_10117588 Ga0157375_101175885 98
205 3300014325 Ga0163163_10034160 Ga0163163_100341605 98
206 3300014745 Ga0157377_10015108 Ga0157377_100151084 98
207 3300014968 Ga0157379_10447134 Ga0157379_104471342 98
208 3300014968 Ga0157379_12555637 Ga0157379_125556371 98
209 3300014969 Ga0157376_11031727 Ga0157376_110317272 98
210 3300021361 Ga0213872_10104472 Ga0213872_101044722 98
211 3300021384 Ga0213876_10011066 Ga0213876_100110663 98
212 3300021388 Ga0213875_10016511 Ga0213875_100165113 98
213 3300021441 Ga0213871_10197375 Ga0213871_101973751 98
214 3300025261 Ga0209233_1038194 Ga0209233_10381942 98
215 3300025295 Ga0209564_1000248 Ga0209564_100024827 98
216 3300025315 Ga0207697_10015337 Ga0207697_100153374 98
217 3300025321 Ga0207656_10129490 Ga0207656_101294902 98
218 3300025899 Ga0207642_11092561 Ga0207642_110925612 98
219 3300025900 Ga0207710_10064047 Ga0207710_100640474 98
220 3300025901 Ga0207688_10209044 Ga0207688_102090442 98
221 3300025903 Ga0207680_10262330 Ga0207680_102623302 98
222 3300025907 Ga0207645_10007608 Ga0207645_100076083 98
223 3300025908 Ga0207643_10018338 Ga0207643_100183384 98
224 3300025910 Ga0207684_10326384 Ga0207684_103263843 98
225 3300025911 Ga0207654_10100603 Ga0207654_101006033 98
226 3300025912 Ga0207707_10131342 Ga0207707_101313423 98
227 3300025914 Ga0207671_10024603 Ga0207671_100246038 98
228 3300025918 Ga0207662_10374351 Ga0207662_103743512 98
229 3300025919 Ga0207657_10255161 Ga0207657_102551612 98
230 3300025920 Ga0207649_10821751 Ga0207649_108217511 98
231 3300025921 Ga0207652_10538865 Ga0207652_105388652 98
232 3300025924 Ga0207694_10045686 Ga0207694_100456863 98
233 3300025924 Ga0207694_10428000 Ga0207694_104280002 98
234 3300025925 Ga0207650_10240163 Ga0207650_102401632 98
235 3300025926 Ga0207659_10183647 Ga0207659_101836472 98
236 3300025927 Ga0207687_10017061 Ga0207687_100170614 98
237 3300025931 Ga0207644_10049385 Ga0207644_100493851 98
238 3300025933 Ga0207706_10015757 Ga0207706_100157573 98
239 3300025934 Ga0207686_10274699 Ga0207686_102746992 98
240 3300025935 Ga0207709_10540463 Ga0207709_105404632 98
241 3300025936 Ga0207670_10627647 Ga0207670_106276471 98
242 3300025940 Ga0207691_10104026 Ga0207691_101040262 98
243 3300025941 Ga0207711_10060996 Ga0207711_100609962 98
244 3300025942 Ga0207689_10092939 Ga0207689_100929392 98
245 3300025942 Ga0207689_10384762 Ga0207689_103847622 98
246 3300025945 Ga0207679_10078661 Ga0207679_100786612 98
247 3300025949 Ga0207667_10244883 Ga0207667_102448832 98
248 3300025960 Ga0207651_10071139 Ga0207651_100711393 98
249 3300025961 Ga0207712_11220439 Ga0207712_112204392 98
250 3300025972 Ga0207668_10109602 Ga0207668_101096022 98
251 3300025972 Ga0207668_10629707 Ga0207668_106297071 98
252 3300025972 Ga0207668_11916533 Ga0207668_119165331 98
253 3300025981 Ga0207640_10158180 Ga0207640_101581802 98
254 3300025986 Ga0207658_11869577 Ga0207658_118695772 98
255 3300026023 Ga0207677_10382711 Ga0207677_103827112 98
256 3300026035 Ga0207703_10040460 Ga0207703_100404606 98
257 3300026041 Ga0207639_10011994 Ga0207639_100119945 98
258 3300026067 Ga0207678_10471573 Ga0207678_104715732 98
259 3300026075 Ga0207708_10413591 Ga0207708_104135912 98
260 3300026078 Ga0207702_10181927 Ga0207702_101819273 98
261 3300026078 Ga0207702_10825700 Ga0207702_108257001 98
262 3300026088 Ga0207641_10049911 Ga0207641_100499116 98
263 3300026088 Ga0207641_10188169 Ga0207641_101881693 98
264 3300026089 Ga0207648_10975716 Ga0207648_109757161 98
265 3300026116 Ga0207674_10045413 Ga0207674_100454132 98
266 3300026118 Ga0207675_100039891 Ga0207675_1000398912 98
267 3300026118 Ga0207675_100134338 Ga0207675_1001343384 98
268 3300026121 Ga0207683_10017444 Ga0207683_100174445 98
269 3300026142 Ga0207698_10423998 Ga0207698_104239982 98
270 3300027671 Ga0209588_1002876 Ga0209588_10028764 98
271 3300027866 Ga0209813_10105349 Ga0209813_101053492 98
272 3300027907 Ga0207428_10155564 Ga0207428_101555643 98
273 3300028379 Ga0268266_10055955 Ga0268266_100559551 98
274 3300028379 Ga0268266_11355779 Ga0268266_113557791 98
275 3300028380 Ga0268265_10056112 Ga0268265_100561122 98
276 3300028380 Ga0268265_10271646 Ga0268265_102716462 98
277 3300028381 Ga0268264_10097160 Ga0268264_100971602 98
278 3300028800 Ga0265338_10246272 Ga0265338_102462722 98
279 3300031241 Ga0265325_10082342 Ga0265325_100823423 98
280 3300031249 Ga0265339_10160039 Ga0265339_101600392 98
281 3300031249 Ga0265339_10318866 Ga0265339_103188661 98
282 3300031344 Ga0265316_10347382 Ga0265316_103473821 98
283 3300031344 Ga0265316_10867768 Ga0265316_108677681 98
284 3300031507 Ga0307509_10200431 Ga0307509_102004313 98
285 3300031712 Ga0265342_10006071 Ga0265342_100060714 98
286 3300031731 Ga0307405_10715548 Ga0307405_107155481 98
287 3300031852 Ga0307410_10380213 Ga0307410_103802132 98
288 3300031852 Ga0307410_10852721 Ga0307410_108527212 98
289 3300031995 Ga0307409_100989282 Ga0307409_1009892822 98
290 3300033180 Ga0307510_10202233 Ga0307510_102022332 98
291 3300035691 Ga0373931_0676929 Ga0373931_0676929_69_365 98
292 3300036401 Ga0373937_0480691 Ga0373937_0480691_582_878 98
293 3300037853 Ga0436364_0412423 Ga0436364_0412423_587_883 98
294 3300039437 Ga0436365_0177391 Ga0436365_0177391_6815_7111 98
295 3300039437 Ga0436365_1461300 Ga0436365_1461300_415_711 98
296 3300039438 Ga0436360_0489873 Ga0436360_0489873_29_325 98
297 3300039447 Ga0436361_0524579 Ga0436361_0524579_214_510 98
298 3300039450 Ga0436363_0407663 Ga0436363_0407663_1514_1810 98
299 3300039450 Ga0436363_0624123 Ga0436363_0624123_636_932 98
300 3300039450 Ga0436363_1643446 Ga0436363_1643446_61_357 98
301 3300039453 Ga0436362_0716409 Ga0436362_0716409_70_366 98
302 3300041443 Ga0451789_0789698 Ga0451789_0789698_80_376 98
303 3300041452 Ga0451793_0492855 Ga0451793_0492855_72_368 98
304 3300041494 Ga0451837_0243056 Ga0451837_0243056_1432_1728 98
305 3300041498 Ga0451841_0173740 Ga0451841_0173740_884_1180 98
306 3300041503 Ga0451847_0017562 Ga0451847_0017562_1255_1551 98
307 3300041505 Ga0451849_0315157 Ga0451849_0315157_852_1148 98
308 3300041507 Ga0451851_0728231 Ga0451851_0728231_283_579 98
309 3300041509 Ga0451843_0869854 Ga0451843_0869854_489_785 98
310 3300041511 Ga0451855_0201048 Ga0451855_0201048_1093_1389 98
311 3300041512 Ga0451853_1494414 Ga0451853_1494414_607_903 98
312 3300046452 Ga0495617_053559 Ga0495617_053559_118_414 98
313 3300046455 Ga0495603_0270146 Ga0495603_0270146_220_516 98
314 3300046457 Ga0495590_0120671 Ga0495590_0120671_377_673 98
315 3300046460 Ga0495638_0014704 Ga0495638_0014704_1417_1713 98
316 3300046460 Ga0495638_0035906 Ga0495638_0035906_43_339 98
317 3300046460 Ga0495638_0226422 Ga0495638_0226422_611_907 98
318 3300046474 Ga0495605_0097553 Ga0495605_0097553_910_1206 98
319 3300046491 Ga0495584_0025101 Ga0495584_0025101_1475_1771 98
320 3300046492 Ga0495585_0053060 Ga0495585_0053060_722_1018 98
321 3300046500 Ga0495596_0030229 Ga0495596_0030229_1035_1331 98
322 3300046501 Ga0495607_0139091 Ga0495607_0139091_413_709 98
323 3300046501 Ga0495607_0405716 Ga0495607_0405716_116_412 98
324 3300046507 Ga0495606_0137136 Ga0495606_0137136_216_512 98
325 3300046512 Ga0495610_0124744 Ga0495610_0124744_569_865 98
326 3300046518 Ga0495631_0134941 Ga0495631_0134941_535_831 98
327 3300046518 Ga0495631_0394439 Ga0495631_0394439_147_443 98
328 3300046519 Ga0495632_0013928 Ga0495632_0013928_827_1123 98
329 3300046520 Ga0495637_0104398 Ga0495637_0104398_509_805 98
330 3300046522 Ga0495643_0315078 Ga0495643_0315078_191_487 98
331 3300046524 Ga0495648_0000887 Ga0495648_0000887_20945_21241 98
332 3300046524 Ga0495648_0124878 Ga0495648_0124878_692_988 98
333 3300046530 Ga0495654_0202953 Ga0495654_0202953_321_617 98
334 3300046538 Ga0495609_0108942 Ga0495609_0108942_229_525 98
335 3300046558 Ga0495633_0032435 Ga0495633_0032435_1206_1502 98
336 3300046615 Ga0495656_0008612 Ga0495656_0008612_2993_3289 98
337 3300046616 Ga0495668_0293783 Ga0495668_0293783_233_529 98
338 3300046616 Ga0495668_0338160 Ga0495668_0338160_21_317 98
339 3300046648 Ga0495611_0358077 Ga0495611_0358077_171_467 98
340 3300046660 Ga0495625_0079173 Ga0495625_0079173_1296_1592 98
341 3300046664 Ga0495659_0186166 Ga0495659_0186166_262_558 98
342 3300046684 Ga0495669_0065354 Ga0495669_0065354_293_589 98
343 3300046691 Ga0495670_0031354 Ga0495670_0031354_671_967 98
344 3300046692 Ga0495671_0112881 Ga0495671_0112881_574_870 98
345 3300046810 Ga0495660_0089918 Ga0495660_0089918_391_687 98
346 3300047315 Ga0495581_0234215 Ga0495581_0234215_699_995 98
347 3300047318 Ga0495636_0055007 Ga0495636_0055007_350_646 98
348 3300047320 Ga0495672_0056735 Ga0495672_0056735_403_699 98
349 3300047320 Ga0495672_0078760 Ga0495672_0078760_1142_1438 98
350 3300047320 Ga0495672_0246436 Ga0495672_0246436_398_694 98
351 3300047320 Ga0495672_0255106 Ga0495672_0255106_44_340 98
352 3300047323 Ga0495683_0054162 Ga0495683_0054162_878_1174 98
353 3300047443 Ga0495687_060401 Ga0495687_060401_738_1034 98
354 3300047445 Ga0495677_0105269 Ga0495677_0105269_187_483 98
355 3300047446 Ga0495679_112723 Ga0495679_112723_342_638 98
356 3300047447 Ga0495685_106108 Ga0495685_106108_34_330 98
357 3300047469 Ga0495673_0000381 Ga0495673_0000381_44784_45080 98
358 3300047469 Ga0495673_0153607 Ga0495673_0153607_347_643 98
359 3300047472 Ga0495686_0107877 Ga0495686_0107877_722_1018 98
360 3300048903 Ga0496100_0154853 Ga0496100_0154853_1276_1572 98
361 3300048904 Ga0496101_0039655 Ga0496101_0039655_2439_2735 98
362 3300048905 Ga0496102_0107438 Ga0496102_0107438_1077_1373 98
363 3300048905 Ga0496102_0149070 Ga0496102_0149070_648_944 98
364 3300048906 Ga0496103_0185223 Ga0496103_0185223_524_820 98
365 3300048907 Ga0496104_0299415 Ga0496104_0299415_912_1208 98
366 3300048908 Ga0496105_0338520 Ga0496105_0338520_414_710 98
367 3300048909 Ga0496106_0070662 Ga0496106_0070662_1298_1594 98
368 3300048910 Ga0496107_0010521 Ga0496107_0010521_1988_2284 98
369 3300048911 Ga0496108_0057259 Ga0496108_0057259_501_797 98
370 3300048912 Ga0496109_0046905 Ga0496109_0046905_3064_3360 98
371 3300048913 Ga0496110_0024713 Ga0496110_0024713_4594_4890 98
372 3300048915 Ga0496112_0031289 Ga0496112_0031289_2598_2894 98
373 3300048916 Ga0496113_0196256 Ga0496113_0196256_596_892 98
374 3300048917 Ga0496114_0115756 Ga0496114_0115756_1211_1507 98
375 3300048918 Ga0496115_0927355 Ga0496115_0927355_57_353 98
376 3300048919 Ga0496116_0306764 Ga0496116_0306764_380_676 98
377 3300048920 Ga0496117_0096406 Ga0496117_0096406_1023_1319 98
378 3300048921 Ga0496118_0023434 Ga0496118_0023434_4640_4936 98
379 3300048923 Ga0496120_0001104 Ga0496120_0001104_27862_28158 98
380 3300048923 Ga0496120_0207584 Ga0496120_0207584_622_918 98
381 3300048924 Ga0496121_0081845 Ga0496121_0081845_738_1034 98
382 3300048924 Ga0496121_0148918 Ga0496121_0148918_722_1018 98
383 3300048924 Ga0496121_0426203 Ga0496121_0426203_443_739 98
384 3300048924 Ga0496121_0679110 Ga0496121_0679110_127_423 98
385 3300048928 Ga0496125_0191158 Ga0496125_0191158_618_914 98
386 3300048929 Ga0496126_0148184 Ga0496126_0148184_1641_1937 98
387 3300048929 Ga0496126_0488574 Ga0496126_0488574_492_788 98
388 3300049460 Ga0495682_0037211 Ga0495682_0037211_217_513 98
389 3300049571 Ga0501034_1125962 Ga0501034_1125962_211_507 98
390 3300049572 Ga0501036_0510748 Ga0501036_0510748_74_370 98
391 3300049588 Ga0501072_0101186 Ga0501072_0101186_391_687 98
392 3300049741 Ga0501079_0349373 Ga0501079_0349373_564_860 98
393 3300049743 Ga0501081_0852513 Ga0501081_0852513_208_504 98
394 3300049823 Ga0501044_0156051 Ga0501044_0156051_231_527 98
395 3300049823 Ga0501044_0262867 Ga0501044_0262867_626_922 98
396 3300050489 nmdc:mga03683_29182_c1 nmdc:mga03683_29182_c1_1785_2081 98
397 3300050491 nmdc:mga00v17_1110_c1 nmdc:mga00v17_1110_c1_13736_14032 98
398 3300050491 nmdc:mga00v17_415310_c1 nmdc:mga00v17_415310_c1_67_363 98
399 3300050492 nmdc:mga0yw44_4615_c1 nmdc:mga0yw44_4615_c1_5716_6012 98
400 3300050493 nmdc:mga0k408_123333_c1 nmdc:mga0k408_123333_c1_316_612 98
401 3300050495 nmdc:mga04h51_102513_c1 nmdc:mga04h51_102513_c1_434_730 98
402 3300050496 nmdc:mga07m45_230110_c1 nmdc:mga07m45_230110_c1_468_764 98
403 3300050513 nmdc:mga0rr50_68561_c1 nmdc:mga0rr50_68561_c1_1175_1471 98
404 3300050515 nmdc:mga0a205_24486_c2 nmdc:mga0a205_24486_c2_3960_4256 98
405 3300050516 nmdc:mga0sz30_12484_c1 nmdc:mga0sz30_12484_c1_2777_3073 98
406 3300053077 Ga0495601_0113951 Ga0495601_0113951_16_312 98
407 3300053079 Ga0500610_0059696 Ga0500610_0059696_404_700 98
408 3300053079 Ga0500610_0309953 Ga0500610_0309953_44_385 98
409 3300053086 Ga0500578_0244786 Ga0500578_0244786_653_994 98
410 3300053087 Ga0500643_010017 Ga0500643_010017_2772_3068 98
411 3300053088 Ga0500644_0000598 Ga0500644_0000598_10214_10510 98
412 3300053090 Ga0500646_0277294 Ga0500646_0277294_93_389 98
413 3300053091 Ga0500647_0300571 Ga0500647_0300571_319_615 98
414 3300053093 Ga0500651_0048584 Ga0500651_0048584_257_598 98
415 3300053093 Ga0500651_0252618 Ga0500651_0252618_379_678 98
416 3300053096 Ga0500641_0000557 Ga0500641_0000557_3525_3821 98
417 3300053096 Ga0500641_0017842 Ga0500641_0017842_864_1160 98
418 3300053096 Ga0500641_0118893 Ga0500641_0118893_167_463 98
419 3300053098 Ga0500650_0177135 Ga0500650_0177135_393_734 98
420 3300053098 Ga0500650_0347816 Ga0500650_0347816_43_339 98
421 3300053119 Ga0500595_091093 Ga0500595_091093_93_389 98
422 3300053136 Ga0500559_0152339 Ga0500559_0152339_172_468 98
423 3300053142 Ga0500577_0036666 Ga0500577_0036666_279_575 98
424 3300053142 Ga0500577_0249722 Ga0500577_0249722_359_655 98
425 3300053146 Ga0500588_0210301 Ga0500588_0210301_100_396 98
426 3300053146 Ga0500588_0224268 Ga0500588_0224268_82_423 98
427 3300053148 Ga0500590_251943 Ga0500590_251943_64_360 98
428 3300053150 Ga0500603_125953 Ga0500603_125953_180_476 98
429 3300053151 Ga0500604_0076810 Ga0500604_0076810_304_600 98
430 3300053153 Ga0500616_0007186 Ga0500616_0007186_2072_2368 98
431 3300053158 Ga0500627_0224524 Ga0500627_0224524_519_815 98
432 3300053158 Ga0500627_0356037 Ga0500627_0356037_101_397 98
433 3300053177 Ga0500636_0040369 Ga0500636_0040369_1675_1971 98
434 3300053731 Ga0500609_006127 Ga0500609_006127_164_505 98
435 3300060353 Ga0501082_0152034 Ga0501082_0152034_1410_1706 98

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05015

HigB-like_toxin

RelE-like toxin of type II toxin-antitoxin system HigB

3

94

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yzv-assembly2.cif.gz_XY precleavage 70s structure of the p. vulgaris higb deltah92 toxin bound to the aca codon 0.9208 1 93
5iwh-assembly1.cif.gz_A structure of p. vulgaris higb toxin delta h92 0.9051 1 97
4px8-assembly1.cif.gz_A structure of p. vulgaris higb toxin 0.9043 1 97
4yzv-assembly2.cif.gz_XY precleavage 70s structure of the p. vulgaris higb deltah92 toxin bound to the aca codon 0.9018 1 93
5ixl-assembly7.cif.gz_G structure of p. vulgaris higb toxin y91a variant 0.9006 1 97
ID Description Score Start End Superfamily
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.9174 1 94 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8924 4 93 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8649 4 93 3.30.2310.20
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8554 1 94 3.30.2310.20
af_Q54SA7_461_804_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7482 64 92 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A7W7Z6A0-F1-model_v4 Proteic killer suppression protein 0.9902 2 97
AF-Q1NMY5-F1-model_v4 deleted 0.9851 1 97
AF-A0A1M3MGA4-F1-model_v4 Plasmid maintenance system killer protein 0.977 1 97
AF-A0A4Z0IS23-F1-model_v4 deleted 0.9764 1 97
AF-A0A160U8M2-F1-model_v4 deleted 0.9759 2 97

Feature Viewer

pLDDT pTM Quality
93.41 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map