F443212

General Info

Members Datasets Scaffolds Average Seq Length
434 263 868 193

Family's Representative Sequence

Representative Sequence 3300054114|Ga0501084_0889876|Ga0501084_0889876_16_696
Length 226
Sequence MEKAGMKYTGLVLRGGPEEAESVRHSYLILRDDWRRPVREDLPRCDWTGASEAMLRYHDDEWGVPQHDDATLFEFLTLEGAQAGLSWATILARREGYRRAFAGWNIETVAAFTDEDAERLLQDTGIIRNRAKVTSTITNARAALEVRREFGSLDAYLWSFVGGRPIRNAWRALSELPAESAESKAMSRDLQKRGFRFVGPTICYAFMQATGMVNDHIVTCFRYAEV

Samples

Sample ID Description Type Environment
1 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
164 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
165 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
166 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
167 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
168 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
183 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
184 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
185 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
186 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
187 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
190 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
201 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
202 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
203 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
207 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
253 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
254 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
255 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
256 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
257 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
262 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
263 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 0.92
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 4.15
Rhizosphere 95.39
Stem 0
Stem Tuber 0
Unclassified 0.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501084_0889876 3300054114 Bacteria 749
2 JGI24743J22301_10020658 3300001991 Bacteria 1255
3 JGI24751J29686_10002833 3300002459 Bacteria 3495
4 JGI25407J50210_10035522 3300003373 Bacteria 1284
5 Ga0070658_10003287 3300005327 Bacteria 13339
6 Ga0070676_10242287 3300005328 Bacteria 1200
7 Ga0070676_10389628 3300005328 Bacteria 967
8 Ga0070690_100055092 3300005330 Bacteria 2546
9 Ga0070690_100169663 3300005330 Bacteria 1501
10 Ga0070670_100034107 3300005331 Bacteria 4381
11 Ga0068869_100056212 3300005334 Bacteria 2870
12 Ga0070666_10700824 3300005335 Bacteria 743
13 Ga0070680_100012273 3300005336 Bacteria 6653
14 Ga0070682_100006187 3300005337 Bacteria 6707
15 Ga0068868_100036989 3300005338 Bacteria 3782
16 Ga0068868_100296590 3300005338 Bacteria 1372
17 Ga0068868_100688225 3300005338 Bacteria 914
18 Ga0070660_100026923 3300005339 Bacteria 4285
19 Ga0070689_100093707 3300005340 Bacteria 2371
20 Ga0070691_10008804 3300005341 Bacteria 4619
21 Ga0070687_100041804 3300005343 Bacteria 2319
22 Ga0070692_10033068 3300005345 Bacteria 2605
23 Ga0070692_10051190 3300005345 Bacteria 2147
24 Ga0070668_100415409 3300005347 Bacteria 1151
25 Ga0070669_100002477 3300005353 Bacteria 13373
26 Ga0070669_100129302 3300005353 Bacteria 1936
27 Ga0070675_100008437 3300005354 Bacteria 7997
28 Ga0070675_100078308 3300005354 Bacteria 2752
29 Ga0070673_100048733 3300005364 Bacteria 3305
30 Ga0070673_100322650 3300005364 Bacteria 1364
31 Ga0070688_100048377 3300005365 Bacteria 2642
32 Ga0070659_100111448 3300005366 Bacteria 2209
33 Ga0070667_100297756 3300005367 Bacteria 1452
34 Ga0070709_10007003 3300005434 Bacteria 6162
35 Ga0070713_100033896 3300005436 Bacteria 4096
36 Ga0070711_100099704 3300005439 Bacteria 2111
37 Ga0070705_100781492 3300005440 Bacteria 758
38 Ga0070700_100001359 3300005441 Bacteria 12155
39 Ga0070700_100238251 3300005441 Bacteria 1299
40 Ga0070663_100016604 3300005455 Bacteria 4787
41 Ga0070678_100007413 3300005456 Bacteria 6505
42 Ga0070662_100154002 3300005457 Bacteria 1792
43 Ga0070681_10053687 3300005458 Bacteria 4016
44 Ga0068867_100202320 3300005459 Bacteria 1590
45 Ga0068867_100990333 3300005459 Bacteria 761
46 Ga0070707_100136690 3300005468 Bacteria 2384
47 Ga0070698_100091188 3300005471 Bacteria 3030
48 Ga0070684_100018691 3300005535 Bacteria 5716
49 Ga0070684_100029074 3300005535 Bacteria 4680
50 Ga0068853_100532545 3300005539 Bacteria 1111
51 Ga0070672_100075720 3300005543 Bacteria 2687
52 Ga0070672_100880119 3300005543 Bacteria 791
53 Ga0070686_100817442 3300005544 Bacteria 752
54 Ga0070696_100000672 3300005546 Bacteria 21890
55 Ga0070696_100321309 3300005546 Bacteria 1191
56 Ga0070696_100767723 3300005546 Bacteria 791
57 Ga0070693_100008547 3300005547 Bacteria 5056
58 Ga0070665_100010226 3300005548 Bacteria 9491
59 Ga0070665_100102071 3300005548 Bacteria 2872
60 Ga0070665_100577522 3300005548 Bacteria 1137
61 Ga0070704_100144849 3300005549 Bacteria 1860
62 Ga0070704_100521965 3300005549 Bacteria 1034
63 Ga0070704_100686497 3300005549 Bacteria 907
64 Ga0068855_100118656 3300005563 Bacteria 3030
65 Ga0070664_100124315 3300005564 Bacteria 2262
66 Ga0068857_100017766 3300005577 Bacteria 6234
67 Ga0068854_100520983 3300005578 Bacteria 1004
68 Ga0068856_100042035 3300005614 Bacteria 4495
69 Ga0068856_100752052 3300005614 Bacteria 995
70 Ga0068856_100912932 3300005614 Bacteria 897
71 Ga0070702_100012505 3300005615 Bacteria 4255
72 Ga0068852_100009067 3300005616 Bacteria 7366
73 Ga0068852_101292650 3300005616 Unclassified 751
74 Ga0068859_100324376 3300005617 Bacteria 1634
75 Ga0068859_100604507 3300005617 Bacteria 1190
76 Ga0068864_100010763 3300005618 Bacteria 7560
77 Ga0068864_100018929 3300005618 Bacteria 5757
78 Ga0068864_100037100 3300005618 Bacteria 4157
79 Ga0068864_100042149 3300005618 Bacteria 3906
80 Ga0068866_10052643 3300005718 Bacteria 2078
81 Ga0068866_10064481 3300005718 Bacteria 1913
82 Ga0068866_10125657 3300005718 Bacteria 1451
83 Ga0068861_100002139 3300005719 Bacteria 12782
84 Ga0068861_100151992 3300005719 Bacteria 1900
85 Ga0068861_100241133 3300005719 Bacteria 1537
86 Ga0068861_100300220 3300005719 Bacteria 1391
87 Ga0068851_10015246 3300005834 Bacteria 3660
88 Ga0068870_10003104 3300005840 Bacteria 7008
89 Ga0068870_10103905 3300005840 Bacteria 1611
90 Ga0068870_10143648 3300005840 Bacteria 1399
91 Ga0068870_10161336 3300005840 Bacteria 1330
92 Ga0068863_100050336 3300005841 Bacteria 3949
93 Ga0068863_100109691 3300005841 Bacteria 2627
94 Ga0068863_100202857 3300005841 Bacteria 1908
95 Ga0068863_100964433 3300005841 Bacteria 854
96 Ga0068858_100061094 3300005842 Bacteria 3483
97 Ga0068858_100119884 3300005842 Bacteria 2460
98 Ga0068860_100247663 3300005843 Bacteria 1734
99 Ga0068862_100003743 3300005844 Bacteria 12974
100 Ga0068862_100060478 3300005844 Bacteria 3254
101 Ga0068862_100468261 3300005844 Bacteria 1191
102 Ga0081455_10104591 3300005937 Bacteria 2264
103 Ga0081455_10125589 3300005937 Bacteria 2014
104 Ga0081455_10143023 3300005937 Bacteria 1855
105 Ga0081538_10000187 3300005981 Bacteria 67952
106 Ga0081538_10123439 3300005981 Bacteria 1238
107 Ga0081540_1136953 3300005983 Bacteria 989
108 Ga0081539_10027366 3300005985 Bacteria 3613
109 Ga0070712_100248872 3300006175 Bacteria 1419
110 Ga0070712_100255983 3300006175 Bacteria 1401
111 Ga0070712_100426842 3300006175 Bacteria 1100
112 Ga0097621_100039853 3300006237 Bacteria 3775
113 Ga0068871_100160366 3300006358 Bacteria 1923
114 Ga0068871_100180771 3300006358 Bacteria 1812
115 Ga0075428_100154186 3300006844 Bacteria 2495
116 Ga0075428_101242068 3300006844 Bacteria 785
117 Ga0075430_100454731 3300006846 Bacteria 1057
118 Ga0075433_10019058 3300006852 Bacteria 5708
119 Ga0075433_10046110 3300006852 Bacteria 3790
120 Ga0075433_10072914 3300006852 Bacteria 3019
121 Ga0075433_10167614 3300006852 Bacteria 1954
122 Ga0075433_10253482 3300006852 Bacteria 1561
123 Ga0075434_100023900 3300006871 Bacteria 5965
124 Ga0075434_100145609 3300006871 Bacteria 2389
125 Ga0075434_100165913 3300006871 Bacteria 2228
126 Ga0075434_100351490 3300006871 Bacteria 1495
127 Ga0075434_100443931 3300006871 Bacteria 1319
128 Ga0075434_100927415 3300006871 Bacteria 885
129 Ga0075429_100057868 3300006880 Bacteria 3375
130 Ga0068865_100114129 3300006881 Bacteria 1998
131 Ga0075436_100007073 3300006914 Bacteria 7681
132 Ga0097620_100324398 3300006931 Bacteria 1634
133 Ga0097620_100604515 3300006931 Bacteria 1190
134 Ga0075435_100022015 3300007076 Bacteria 4913
135 Ga0075435_100042489 3300007076 Bacteria 3637
136 Ga0075435_100081870 3300007076 Bacteria 2652
137 Ga0075435_100309829 3300007076 Bacteria 1351
138 Ga0075435_100950164 3300007076 Bacteria 750
139 Ga0111539_10053625 3300009094 Bacteria 4800
140 Ga0111539_10383701 3300009094 Bacteria 1636
141 Ga0105245_10228318 3300009098 Bacteria 1799
142 Ga0105247_10011597 3300009101 Bacteria 5309
143 Ga0114129_10445261 3300009147 Bacteria 1700
144 Ga0114129_10479911 3300009147 Bacteria 1627
145 Ga0114129_11352976 3300009147 Bacteria 880
146 Ga0114129_11767075 3300009147 Bacteria 753
147 Ga0105243_10004163 3300009148 Bacteria 11477
148 Ga0105243_10004743 3300009148 Bacteria 10691
149 Ga0105243_10023228 3300009148 Bacteria 4720
150 Ga0105242_10117791 3300009176 Bacteria 2274
151 Ga0105242_10312652 3300009176 Bacteria 1438
152 Ga0105248_10034307 3300009177 Bacteria 5673
153 Ga0105248_10914393 3300009177 Bacteria 991
154 Ga0105237_10501102 3300009545 Bacteria 1221
155 Ga0105238_10040458 3300009551 Bacteria 4724
156 Ga0105249_10010652 3300009553 Bacteria 8076
157 Ga0105239_10062923 3300010375 Bacteria 4073
158 Ga0105239_10173920 3300010375 Bacteria 2408
159 Ga0105239_10491330 3300010375 Bacteria 1395
160 Ga0105246_10001918 3300011119 Bacteria 12529
161 Ga0157373_10036908 3300013100 Bacteria 3506
162 Ga0157371_10064906 3300013102 Bacteria 2586
163 Ga0157370_10061772 3300013104 Bacteria 3555
164 Ga0157378_10093604 3300013297 Bacteria 2736
165 Ga0157378_10380040 3300013297 Bacteria 1387
166 Ga0157378_11231338 3300013297 Bacteria 788
167 Ga0157375_10064732 3300013308 Bacteria 3642
168 Ga0157375_10248238 3300013308 Bacteria 1940
169 Ga0163163_10029426 3300014325 Bacteria 5283
170 Ga0163163_10620893 3300014325 Bacteria 1144
171 Ga0163163_10957506 3300014325 Bacteria 919
172 Ga0157380_10065918 3300014326 Bacteria 2912
173 Ga0157380_10100444 3300014326 Bacteria 2408
174 Ga0157380_10527973 3300014326 Bacteria 1153
175 Ga0182008_10029493 3300014497 Bacteria 2772
176 Ga0157377_10209429 3300014745 Bacteria 1242
177 Ga0157379_10126898 3300014968 Bacteria 2296
178 Ga0157379_10639174 3300014968 Bacteria 996
179 Ga0157376_10063060 3300014969 Bacteria 3121
180 Ga0157376_10073903 3300014969 Bacteria 2905
181 Ga0197907_11294301 3300020069 Bacteria 2765
182 Ga0206356_11831107 3300020070 Bacteria 1639
183 Ga0206354_10192040 3300020081 Bacteria 1280
184 Ga0224712_10010516 3300022467 Bacteria 2833
185 Ga0207642_10112371 3300025899 Bacteria 1390
186 Ga0207710_10193501 3300025900 Bacteria 1002
187 Ga0207688_10001356 3300025901 Bacteria 12725
188 Ga0207680_10318401 3300025903 Bacteria 1087
189 Ga0207685_10206648 3300025905 Bacteria 926
190 Ga0207645_10175437 3300025907 Bacteria 1406
191 Ga0207645_10234602 3300025907 Bacteria 1211
192 Ga0207645_10251723 3300025907 Bacteria 1169
193 Ga0207643_10000252 3300025908 Bacteria 37454
194 Ga0207643_10087488 3300025908 Bacteria 1812
195 Ga0207643_10104652 3300025908 Bacteria 1662
196 Ga0207705_10030568 3300025909 Bacteria 3843
197 Ga0207654_10033532 3300025911 Bacteria 2847
198 Ga0207671_10367831 3300025914 Bacteria 1142
199 Ga0207693_10269797 3300025915 Bacteria 1334
200 Ga0207660_10053691 3300025917 Bacteria 2873
201 Ga0207662_10126800 3300025918 Bacteria 1606
202 Ga0207657_10012261 3300025919 Bacteria 8468
203 Ga0207649_10002137 3300025920 Bacteria 11192
204 Ga0207652_10025670 3300025921 Bacteria 4900
205 Ga0207681_10000560 3300025923 Bacteria 25447
206 Ga0207694_10042350 3300025924 Bacteria 3512
207 Ga0207650_10009635 3300025925 Bacteria 6604
208 Ga0207650_10080378 3300025925 Bacteria 2471
209 Ga0207659_10012111 3300025926 Bacteria 5471
210 Ga0207659_10046646 3300025926 Bacteria 3061
211 Ga0207687_10016338 3300025927 Bacteria 4874
212 Ga0207664_10312948 3300025929 Bacteria 1384
213 Ga0207644_10321449 3300025931 Bacteria 1251
214 Ga0207706_10035354 3300025933 Bacteria 4443
215 Ga0207686_10019331 3300025934 Bacteria 3872
216 Ga0207686_10496859 3300025934 Bacteria 946
217 Ga0207709_10003990 3300025935 Bacteria 8604
218 Ga0207709_10082756 3300025935 Bacteria 2073
219 Ga0207709_10275300 3300025935 Bacteria 1241
220 Ga0207670_10068110 3300025936 Bacteria 2451
221 Ga0207670_10085503 3300025936 Bacteria 2217
222 Ga0207704_10009250 3300025938 Bacteria 4744
223 Ga0207704_10138523 3300025938 Bacteria 1698
224 Ga0207691_10019836 3300025940 Bacteria 6359
225 Ga0207691_10022185 3300025940 Bacteria 5988
226 Ga0207711_10384489 3300025941 Bacteria 1302
227 Ga0207689_10013862 3300025942 Bacteria 6867
228 Ga0207689_10014949 3300025942 Bacteria 6586
229 Ga0207689_10018985 3300025942 Bacteria 5798
230 Ga0207661_10017102 3300025944 Bacteria 5358
231 Ga0207661_10183502 3300025944 Bacteria 1829
232 Ga0207679_10012227 3300025945 Bacteria 5592
233 Ga0207679_10630512 3300025945 Bacteria 968
234 Ga0207667_10252406 3300025949 Bacteria 1804
235 Ga0207651_10698896 3300025960 Bacteria 893
236 Ga0207712_10094472 3300025961 Bacteria 2209
237 Ga0207668_10186242 3300025972 Bacteria 1641
238 Ga0207640_10671619 3300025981 Bacteria 885
239 Ga0207658_10240676 3300025986 Bacteria 1533
240 Ga0207658_10905477 3300025986 Bacteria 803
241 Ga0207677_10200671 3300026023 Bacteria 1585
242 Ga0207677_10312415 3300026023 Bacteria 1303
243 Ga0207703_10077025 3300026035 Bacteria 2768
244 Ga0207703_10099047 3300026035 Bacteria 2467
245 Ga0207639_10120102 3300026041 Bacteria 2158
246 Ga0207678_10001822 3300026067 Bacteria 19525
247 Ga0207708_10001699 3300026075 Bacteria 16293
248 Ga0207708_10088137 3300026075 Bacteria 2390
249 Ga0207708_10097056 3300026075 Bacteria 2277
250 Ga0207702_10010930 3300026078 Bacteria 7572
251 Ga0207702_10035915 3300026078 Bacteria 4144
252 Ga0207702_10365541 3300026078 Bacteria 1384
253 Ga0207641_10053736 3300026088 Bacteria 3415
254 Ga0207641_10157068 3300026088 Bacteria 2064
255 Ga0207648_10007304 3300026089 Bacteria 10890
256 Ga0207648_10251050 3300026089 Bacteria 1577
257 Ga0207676_10006835 3300026095 Bacteria 8078
258 Ga0207676_10031734 3300026095 Bacteria 3975
259 Ga0207676_10074681 3300026095 Bacteria 2732
260 Ga0207674_10032760 3300026116 Bacteria 5448
261 Ga0207674_10086445 3300026116 Bacteria 3130
262 Ga0207674_10107214 3300026116 Bacteria 2770
263 Ga0207675_100004922 3300026118 Bacteria 12870
264 Ga0207675_100118356 3300026118 Bacteria 2505
265 Ga0207675_100328617 3300026118 Bacteria 1494
266 Ga0207675_101709682 3300026118 Bacteria 649
267 Ga0207683_10000558 3300026121 Bacteria 34428
268 Ga0207683_10123640 3300026121 Bacteria 2324
269 Ga0207698_10004323 3300026142 Bacteria 8645
270 Ga0207428_10022350 3300027907 Bacteria 5339
271 Ga0268266_10000302 3300028379 Bacteria 78763
272 Ga0268266_10127211 3300028379 Bacteria 2275
273 Ga0268265_10003452 3300028380 Bacteria 11365
274 Ga0268265_10406519 3300028380 Bacteria 1260
275 Ga0268264_10184078 3300028381 Bacteria 1899
276 Ga0268264_10246807 3300028381 Bacteria 1657
277 Ga0265325_10119364 3300031241 Bacteria 1273
278 Ga0265327_10044518 3300031251 Bacteria 2366
279 Ga0316579_10051931 3300031691 Bacteria 1919
280 Ga0316576_10025129 3300031727 Bacteria 4167
281 Ga0316576_10290652 3300031727 Bacteria 1223
282 Ga0316576_10417740 3300031727 Bacteria 993
283 Ga0316578_10003346 3300031728 Bacteria 7308
284 Ga0316577_10099339 3300031733 Bacteria 1631
285 Ga0307413_10124369 3300031824 Bacteria 1753
286 Ga0307413_10670610 3300031824 Bacteria 858
287 Ga0307416_100741955 3300032002 Bacteria 1074
288 Ga0307415_100064257 3300032126 Bacteria 2553
289 Ga0316580_10063852 3300032139 Bacteria 1130
290 Ga0316574_0312487 3300035398 Bacteria 998
291 Ga0373931_0205260 3300035691 Bacteria 1179
292 Ga0373937_1106965 3300036401 Bacteria 741
293 Ga0373925_0353950 3300037068 Bacteria 1193
294 Ga0395899_0007609 3300037312 Bacteria 8355
295 Ga0395899_0112666 3300037312 Bacteria 1954
296 Ga0395899_0127197 3300037312 Bacteria 1822
297 Ga0395900_0046543 3300037418 Bacteria 4467
298 Ga0395900_0073620 3300037418 Bacteria 3512
299 Ga0395898_0022059 3300037466 Bacteria 6450
300 Ga0395898_0140389 3300037466 Bacteria 2313
301 Ga0395898_0204308 3300037466 Bacteria 1885
302 Ga0395905_0006682 3300037471 Bacteria 11557
303 Ga0395905_0118857 3300037471 Bacteria 2484
304 Ga0395905_0982442 3300037471 Bacteria 747
305 Ga0395901_0019771 3300038443 Bacteria 6886
306 Ga0395901_0038207 3300038443 Bacteria 4965
307 Ga0395901_0249094 3300038443 Bacteria 1851
308 Ga0436365_0513042 3300039437 Bacteria 1031
309 Ga0439432_119231 3300042006 Bacteria 782
310 Ga0439455_0042317 3300042012 Bacteria 1170
311 Ga0439463_061341 3300042016 Bacteria 961
312 Ga0439458_0008345 3300042157 Bacteria 2306
313 Ga0439459_0038394 3300042438 Bacteria 1007
314 Ga0439464_0093059 3300042439 Bacteria 910
315 Ga0451577_0415514 3300042876 Unclassified 1221
316 Ga0451577_0579126 3300042876 Bacteria 1019
317 Ga0439440_0116832 3300042993 Bacteria 739
318 Ga0453684_0042015 3300044712 Bacteria 6170
319 Ga0453684_0206031 3300044712 Unclassified 2289
320 Ga0451576_1057791 3300045051 Unclassified 850
321 Ga0466967_0178688 3300045976 Bacteria 2001
322 Ga0495638_0000127 3300046460 Bacteria 123576
323 Ga0495641_0063360 3300046461 Bacteria 1666
324 Ga0495582_0191815 3300046473 Bacteria 1166
325 Ga0495582_0424595 3300046473 Bacteria 767
326 Ga0495662_0239118 3300046476 Bacteria 895
327 Ga0495630_0249415 3300046517 Bacteria 1356
328 Ga0495598_0078386 3300046537 Bacteria 1055
329 Ga0495622_0033716 3300046557 Bacteria 2389
330 Ga0495625_0012347 3300046660 Bacteria 6926
331 Ga0495588_0013204 3300046674 Bacteria 3930
332 Ga0495658_0051994 3300046683 Bacteria 2322
333 Ga0495624_0287491 3300046690 Bacteria 992
334 Ga0495581_0028826 3300047315 Bacteria 3218
335 Ga0495676_0090635 3300047321 Bacteria 2288
336 Ga0495676_0335218 3300047321 Bacteria 1014
337 Ga0495615_0168732 3300048090 Bacteria 661
338 Ga0496100_0135982 3300048903 Bacteria 1736
339 Ga0496101_0208510 3300048904 Bacteria 1513
340 Ga0496102_0010950 3300048905 Bacteria 7813
341 Ga0496104_0005657 3300048907 Bacteria 10946
342 Ga0496105_0015166 3300048908 Bacteria 6134
343 Ga0496106_0005516 3300048909 Bacteria 9360
344 Ga0496106_0213449 3300048909 Bacteria 1538
345 Ga0496107_0009898 3300048910 Bacteria 6615
346 Ga0496108_0041137 3300048911 Bacteria 3856
347 Ga0496109_0034297 3300048912 Bacteria 4570
348 Ga0496109_0037231 3300048912 Bacteria 4395
349 Ga0496110_0013247 3300048913 Bacteria 6809
350 Ga0496111_0008718 3300048914 Bacteria 6729
351 Ga0496111_0477865 3300048914 Bacteria 918
352 Ga0496112_0054881 3300048915 Bacteria 3915
353 Ga0496113_0011663 3300048916 Bacteria 5877
354 Ga0496113_0112598 3300048916 Bacteria 2120
355 Ga0496115_0076197 3300048918 Bacteria 2726
356 Ga0501031_0020832 3300049568 Bacteria 4274
357 Ga0501033_0008656 3300049570 Bacteria 7876
358 Ga0501034_0027690 3300049571 Bacteria 5763
359 Ga0501036_0101056 3300049572 Bacteria 2439
360 Ga0501036_0135346 3300049572 Bacteria 2080
361 Ga0501037_0391079 3300049573 Bacteria 954
362 Ga0501038_0107737 3300049574 Bacteria 2311
363 Ga0501039_0010905 3300049575 Bacteria 6926
364 Ga0501039_0099366 3300049575 Bacteria 2271
365 Ga0501040_0005138 3300049576 Bacteria 8464
366 Ga0501040_0201255 3300049576 Bacteria 1414
367 Ga0501041_0001320 3300049577 Bacteria 13654
368 Ga0501042_0004428 3300049578 Bacteria 8959
369 Ga0501043_0073197 3300049579 Bacteria 2691
370 Ga0501046_0006202 3300049580 Bacteria 10614
371 Ga0501047_0016601 3300049581 Bacteria 7028
372 Ga0501048_0008142 3300049582 Bacteria 7931
373 Ga0501048_0216566 3300049582 Bacteria 1358
374 Ga0501067_0025489 3300049583 Bacteria 3278
375 Ga0501068_0006574 3300049584 Bacteria 6413
376 Ga0501068_0198780 3300049584 Bacteria 1271
377 Ga0501068_0379056 3300049584 Bacteria 911
378 Ga0501070_0026562 3300049586 Bacteria 4857
379 Ga0501071_0011648 3300049587 Bacteria 5935
380 Ga0501071_0066022 3300049587 Bacteria 2629
381 Ga0501072_0003095 3300049588 Bacteria 12541
382 Ga0501072_0182575 3300049588 Bacteria 1674
383 Ga0501072_0577442 3300049588 Bacteria 887
384 Ga0501072_0589818 3300049588 Bacteria 876
385 Ga0501073_0003510 3300049589 Bacteria 11776
386 Ga0501074_0007530 3300049590 Bacteria 7876
387 Ga0501075_0051754 3300049591 Bacteria 3088
388 Ga0501075_0135301 3300049591 Bacteria 1877
389 Ga0501076_0001603 3300049592 Bacteria 15225
390 Ga0501076_0023328 3300049592 Bacteria 4768
391 Ga0501076_0118558 3300049592 Bacteria 2143
392 Ga0501077_0009350 3300049593 Bacteria 6087
393 Ga0501077_0196488 3300049593 Bacteria 1281
394 Ga0501077_0438257 3300049593 Bacteria 836
395 Ga0501079_0000463 3300049741 Bacteria 26686
396 Ga0501079_0237859 3300049741 Bacteria 1423
397 Ga0501080_0041911 3300049742 Bacteria 4264
398 Ga0501080_0196454 3300049742 Bacteria 1853
399 Ga0501080_0342892 3300049742 Bacteria 1350
400 Ga0501081_0003073 3300049743 Bacteria 10595
401 Ga0501081_0109637 3300049743 Bacteria 1958
402 Ga0501081_0129681 3300049743 Bacteria 1801
403 Ga0501044_0586376 3300049823 Bacteria 1009
404 Ga0501045_0011895 3300049824 Bacteria 6116
405 nmdc:mga05p37_1337893_c1 3300050507 Bacteria 727
406 nmdc:mga05p37_79778_c1 3300050507 Bacteria 4030
407 nmdc:mga09592_133775_c1 3300050508 Bacteria 2135
408 nmdc:mga0qj67_51836_c1 3300050509 Bacteria 3246
409 nmdc:mga06r32_47226_c1 3300050510 Bacteria 4111
410 nmdc:mga08y16_197853_c1 3300050511 Bacteria 2083
411 nmdc:mga08y16_5861_c1 3300050511 Bacteria 12873
412 nmdc:mga0n895_14278_c1 3300050512 Bacteria 7207
413 nmdc:mga0n895_227373_c1 3300050512 Bacteria 1894
414 nmdc:mga0n895_675939_c1 3300050512 Bacteria 1030
415 nmdc:mga0rr50_139861_c1 3300050513 Bacteria 1946
416 nmdc:mga0rr50_655911_c1 3300050513 Bacteria 895
417 nmdc:mga0rr50_8525_c1 3300050513 Bacteria 6385
418 nmdc:mga0rr50_9839_c1 3300050513 Bacteria 6039
419 nmdc:mga08x19_173152_c1 3300050514 Bacteria 1471
420 nmdc:mga0a205_134813_c1 3300050515 Bacteria 2370
421 nmdc:mga0a205_619010_c1 3300050515 Bacteria 935
422 nmdc:mga0a205_76533_c1 3300050515 Bacteria 3234
423 nmdc:mga0a205_9224_c1 3300050515 Bacteria 9008
424 nmdc:mga0a205_96911_c1 3300050515 Bacteria 2849
425 Ga0500616_0001077 3300053153 Bacteria 28519
426 Ga0501084_0000009 3300054114 Bacteria 194961
427 Ga0501084_0001180 3300054114 Bacteria 20409
428 Ga0501084_0134538 3300054114 Bacteria 2081
429 Ga0501082_0000139 3300060353 Bacteria 59897
430 Ga0501082_0037640 3300060353 Bacteria 4172
431 Ga0530510_0001194 3300061734 Bacteria 17283
432 Ga0530510_0012163 3300061734 Bacteria 6039
433 2791913958 2791354901 Bacteria 8322202
434 8001785256 8001781756 Bacteria 9586736
435 Ga0501084_0889876
436 JGI24743J22301_10020658
437 JGI24751J29686_10002833
438 JGI25407J50210_10035522
439 Ga0070658_10003287
440 Ga0070676_10242287
441 Ga0070676_10389628
442 Ga0070690_100055092
443 Ga0070690_100169663
444 Ga0070670_100034107
445 Ga0068869_100056212
446 Ga0070666_10700824
447 Ga0070680_100012273
448 Ga0070682_100006187
449 Ga0068868_100036989
450 Ga0068868_100296590
451 Ga0068868_100688225
452 Ga0070660_100026923
453 Ga0070689_100093707
454 Ga0070691_10008804
455 Ga0070687_100041804
456 Ga0070692_10033068
457 Ga0070692_10051190
458 Ga0070668_100415409
459 Ga0070669_100002477
460 Ga0070669_100129302
461 Ga0070675_100008437
462 Ga0070675_100078308
463 Ga0070673_100048733
464 Ga0070673_100322650
465 Ga0070688_100048377
466 Ga0070659_100111448
467 Ga0070667_100297756
468 Ga0070709_10007003
469 Ga0070713_100033896
470 Ga0070711_100099704
471 Ga0070705_100781492
472 Ga0070700_100001359
473 Ga0070700_100238251
474 Ga0070663_100016604
475 Ga0070678_100007413
476 Ga0070662_100154002
477 Ga0070681_10053687
478 Ga0068867_100202320
479 Ga0068867_100990333
480 Ga0070707_100136690
481 Ga0070698_100091188
482 Ga0070684_100018691
483 Ga0070684_100029074
484 Ga0068853_100532545
485 Ga0070672_100075720
486 Ga0070672_100880119
487 Ga0070686_100817442
488 Ga0070696_100000672
489 Ga0070696_100321309
490 Ga0070696_100767723
491 Ga0070693_100008547
492 Ga0070665_100010226
493 Ga0070665_100102071
494 Ga0070665_100577522
495 Ga0070704_100144849
496 Ga0070704_100521965
497 Ga0070704_100686497
498 Ga0068855_100118656
499 Ga0070664_100124315
500 Ga0068857_100017766
501 Ga0068854_100520983
502 Ga0068856_100042035
503 Ga0068856_100752052
504 Ga0068856_100912932
505 Ga0070702_100012505
506 Ga0068852_100009067
507 Ga0068852_101292650
508 Ga0068859_100324376
509 Ga0068859_100604507
510 Ga0068864_100010763
511 Ga0068864_100018929
512 Ga0068864_100037100
513 Ga0068864_100042149
514 Ga0068866_10052643
515 Ga0068866_10064481
516 Ga0068866_10125657
517 Ga0068861_100002139
518 Ga0068861_100151992
519 Ga0068861_100241133
520 Ga0068861_100300220
521 Ga0068851_10015246
522 Ga0068870_10003104
523 Ga0068870_10103905
524 Ga0068870_10143648
525 Ga0068870_10161336
526 Ga0068863_100050336
527 Ga0068863_100109691
528 Ga0068863_100202857
529 Ga0068863_100964433
530 Ga0068858_100061094
531 Ga0068858_100119884
532 Ga0068860_100247663
533 Ga0068862_100003743
534 Ga0068862_100060478
535 Ga0068862_100468261
536 Ga0081455_10104591
537 Ga0081455_10125589
538 Ga0081455_10143023
539 Ga0081538_10000187
540 Ga0081538_10123439
541 Ga0081540_1136953
542 Ga0081539_10027366
543 Ga0070712_100248872
544 Ga0070712_100255983
545 Ga0070712_100426842
546 Ga0097621_100039853
547 Ga0068871_100160366
548 Ga0068871_100180771
549 Ga0075428_100154186
550 Ga0075428_101242068
551 Ga0075430_100454731
552 Ga0075433_10019058
553 Ga0075433_10046110
554 Ga0075433_10072914
555 Ga0075433_10167614
556 Ga0075433_10253482
557 Ga0075434_100023900
558 Ga0075434_100145609
559 Ga0075434_100165913
560 Ga0075434_100351490
561 Ga0075434_100443931
562 Ga0075434_100927415
563 Ga0075429_100057868
564 Ga0068865_100114129
565 Ga0075436_100007073
566 Ga0097620_100324398
567 Ga0097620_100604515
568 Ga0075435_100022015
569 Ga0075435_100042489
570 Ga0075435_100081870
571 Ga0075435_100309829
572 Ga0075435_100950164
573 Ga0111539_10053625
574 Ga0111539_10383701
575 Ga0105245_10228318
576 Ga0105247_10011597
577 Ga0114129_10445261
578 Ga0114129_10479911
579 Ga0114129_11352976
580 Ga0114129_11767075
581 Ga0105243_10004163
582 Ga0105243_10004743
583 Ga0105243_10023228
584 Ga0105242_10117791
585 Ga0105242_10312652
586 Ga0105248_10034307
587 Ga0105248_10914393
588 Ga0105237_10501102
589 Ga0105238_10040458
590 Ga0105249_10010652
591 Ga0105239_10062923
592 Ga0105239_10173920
593 Ga0105239_10491330
594 Ga0105246_10001918
595 Ga0157373_10036908
596 Ga0157371_10064906
597 Ga0157370_10061772
598 Ga0157378_10093604
599 Ga0157378_10380040
600 Ga0157378_11231338
601 Ga0157375_10064732
602 Ga0157375_10248238
603 Ga0163163_10029426
604 Ga0163163_10620893
605 Ga0163163_10957506
606 Ga0157380_10065918
607 Ga0157380_10100444
608 Ga0157380_10527973
609 Ga0182008_10029493
610 Ga0157377_10209429
611 Ga0157379_10126898
612 Ga0157379_10639174
613 Ga0157376_10063060
614 Ga0157376_10073903
615 Ga0197907_11294301
616 Ga0206356_11831107
617 Ga0206354_10192040
618 Ga0224712_10010516
619 Ga0207642_10112371
620 Ga0207710_10193501
621 Ga0207688_10001356
622 Ga0207680_10318401
623 Ga0207685_10206648
624 Ga0207645_10175437
625 Ga0207645_10234602
626 Ga0207645_10251723
627 Ga0207643_10000252
628 Ga0207643_10087488
629 Ga0207643_10104652
630 Ga0207705_10030568
631 Ga0207654_10033532
632 Ga0207671_10367831
633 Ga0207693_10269797
634 Ga0207660_10053691
635 Ga0207662_10126800
636 Ga0207657_10012261
637 Ga0207649_10002137
638 Ga0207652_10025670
639 Ga0207681_10000560
640 Ga0207694_10042350
641 Ga0207650_10009635
642 Ga0207650_10080378
643 Ga0207659_10012111
644 Ga0207659_10046646
645 Ga0207687_10016338
646 Ga0207664_10312948
647 Ga0207644_10321449
648 Ga0207706_10035354
649 Ga0207686_10019331
650 Ga0207686_10496859
651 Ga0207709_10003990
652 Ga0207709_10082756
653 Ga0207709_10275300
654 Ga0207670_10068110
655 Ga0207670_10085503
656 Ga0207704_10009250
657 Ga0207704_10138523
658 Ga0207691_10019836
659 Ga0207691_10022185
660 Ga0207711_10384489
661 Ga0207689_10013862
662 Ga0207689_10014949
663 Ga0207689_10018985
664 Ga0207661_10017102
665 Ga0207661_10183502
666 Ga0207679_10012227
667 Ga0207679_10630512
668 Ga0207667_10252406
669 Ga0207651_10698896
670 Ga0207712_10094472
671 Ga0207668_10186242
672 Ga0207640_10671619
673 Ga0207658_10240676
674 Ga0207658_10905477
675 Ga0207677_10200671
676 Ga0207677_10312415
677 Ga0207703_10077025
678 Ga0207703_10099047
679 Ga0207639_10120102
680 Ga0207678_10001822
681 Ga0207708_10001699
682 Ga0207708_10088137
683 Ga0207708_10097056
684 Ga0207702_10010930
685 Ga0207702_10035915
686 Ga0207702_10365541
687 Ga0207641_10053736
688 Ga0207641_10157068
689 Ga0207648_10007304
690 Ga0207648_10251050
691 Ga0207676_10006835
692 Ga0207676_10031734
693 Ga0207676_10074681
694 Ga0207674_10032760
695 Ga0207674_10086445
696 Ga0207674_10107214
697 Ga0207675_100004922
698 Ga0207675_100118356
699 Ga0207675_100328617
700 Ga0207675_101709682
701 Ga0207683_10000558
702 Ga0207683_10123640
703 Ga0207698_10004323
704 Ga0207428_10022350
705 Ga0268266_10000302
706 Ga0268266_10127211
707 Ga0268265_10003452
708 Ga0268265_10406519
709 Ga0268264_10184078
710 Ga0268264_10246807
711 Ga0265325_10119364
712 Ga0265327_10044518
713 Ga0316579_10051931
714 Ga0316576_10025129
715 Ga0316576_10290652
716 Ga0316576_10417740
717 Ga0316578_10003346
718 Ga0316577_10099339
719 Ga0307413_10124369
720 Ga0307413_10670610
721 Ga0307416_100741955
722 Ga0307415_100064257
723 Ga0316580_10063852
724 Ga0316574_0312487
725 Ga0373931_0205260
726 Ga0373937_1106965
727 Ga0373925_0353950
728 Ga0395899_0007609
729 Ga0395899_0112666
730 Ga0395899_0127197
731 Ga0395900_0046543
732 Ga0395900_0073620
733 Ga0395898_0022059
734 Ga0395898_0140389
735 Ga0395898_0204308
736 Ga0395905_0006682
737 Ga0395905_0118857
738 Ga0395905_0982442
739 Ga0395901_0019771
740 Ga0395901_0038207
741 Ga0395901_0249094
742 Ga0436365_0513042
743 Ga0439432_119231
744 Ga0439455_0042317
745 Ga0439463_061341
746 Ga0439458_0008345
747 Ga0439459_0038394
748 Ga0439464_0093059
749 Ga0451577_0415514
750 Ga0451577_0579126
751 Ga0439440_0116832
752 Ga0453684_0042015
753 Ga0453684_0206031
754 Ga0451576_1057791
755 Ga0466967_0178688
756 Ga0495638_0000127
757 Ga0495641_0063360
758 Ga0495582_0191815
759 Ga0495582_0424595
760 Ga0495662_0239118
761 Ga0495630_0249415
762 Ga0495598_0078386
763 Ga0495622_0033716
764 Ga0495625_0012347
765 Ga0495588_0013204
766 Ga0495658_0051994
767 Ga0495624_0287491
768 Ga0495581_0028826
769 Ga0495676_0090635
770 Ga0495676_0335218
771 Ga0495615_0168732
772 Ga0496100_0135982
773 Ga0496101_0208510
774 Ga0496102_0010950
775 Ga0496104_0005657
776 Ga0496105_0015166
777 Ga0496106_0005516
778 Ga0496106_0213449
779 Ga0496107_0009898
780 Ga0496108_0041137
781 Ga0496109_0034297
782 Ga0496109_0037231
783 Ga0496110_0013247
784 Ga0496111_0008718
785 Ga0496111_0477865
786 Ga0496112_0054881
787 Ga0496113_0011663
788 Ga0496113_0112598
789 Ga0496115_0076197
790 Ga0501031_0020832
791 Ga0501033_0008656
792 Ga0501034_0027690
793 Ga0501036_0101056
794 Ga0501036_0135346
795 Ga0501037_0391079
796 Ga0501038_0107737
797 Ga0501039_0010905
798 Ga0501039_0099366
799 Ga0501040_0005138
800 Ga0501040_0201255
801 Ga0501041_0001320
802 Ga0501042_0004428
803 Ga0501043_0073197
804 Ga0501046_0006202
805 Ga0501047_0016601
806 Ga0501048_0008142
807 Ga0501048_0216566
808 Ga0501067_0025489
809 Ga0501068_0006574
810 Ga0501068_0198780
811 Ga0501068_0379056
812 Ga0501070_0026562
813 Ga0501071_0011648
814 Ga0501071_0066022
815 Ga0501072_0003095
816 Ga0501072_0182575
817 Ga0501072_0577442
818 Ga0501072_0589818
819 Ga0501073_0003510
820 Ga0501074_0007530
821 Ga0501075_0051754
822 Ga0501075_0135301
823 Ga0501076_0001603
824 Ga0501076_0023328
825 Ga0501076_0118558
826 Ga0501077_0009350
827 Ga0501077_0196488
828 Ga0501077_0438257
829 Ga0501079_0000463
830 Ga0501079_0237859
831 Ga0501080_0041911
832 Ga0501080_0196454
833 Ga0501080_0342892
834 Ga0501081_0003073
835 Ga0501081_0109637
836 Ga0501081_0129681
837 Ga0501044_0586376
838 Ga0501045_0011895
839 nmdc:mga05p37_1337893_c1
840 nmdc:mga05p37_79778_c1
841 nmdc:mga09592_133775_c1
842 nmdc:mga0qj67_51836_c1
843 nmdc:mga06r32_47226_c1
844 nmdc:mga08y16_197853_c1
845 nmdc:mga08y16_5861_c1
846 nmdc:mga0n895_14278_c1
847 nmdc:mga0n895_227373_c1
848 nmdc:mga0n895_675939_c1
849 nmdc:mga0rr50_139861_c1
850 nmdc:mga0rr50_655911_c1
851 nmdc:mga0rr50_8525_c1
852 nmdc:mga0rr50_9839_c1
853 nmdc:mga08x19_173152_c1
854 nmdc:mga0a205_134813_c1
855 nmdc:mga0a205_619010_c1
856 nmdc:mga0a205_76533_c1
857 nmdc:mga0a205_9224_c1
858 nmdc:mga0a205_96911_c1
859 Ga0500616_0001077
860 Ga0501084_0000009
861 Ga0501084_0001180
862 Ga0501084_0134538
863 Ga0501082_0000139
864 Ga0501082_0037640
865 Ga0530510_0001194
866 Ga0530510_0012163
867 2791913958
868 8001785256

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03352

Adenine_glyco

Methyladenine glycosylase

47

223

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9391 13 187
4ai5-assembly3.cif.gz_C crystal structure of y16f of 3-methyladenine dna glycosylase i (tag) in complex with 3-methyladenine 0.9319 13 186
4aia-assembly4.cif.gz_D the structural basis of 3-methyladenine recognition by 3- methyladenine dna glycosylase i (tag) from staphylococcus aureus 0.9306 13 186
4ai4-assembly1.cif.gz_A crystal structure of e38q mutant of 3-methyladenine dna glycosylase i from staphylococcus aureus 0.9208 13 186
2ofk-assembly1.cif.gz_A crystal structure of 3-methyladenine dna glycosylase i (tag) 0.9 13 187
ID Description Score Start End Superfamily
af_O05311_6_193_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9621 13 187 1.10.340.30
af_P05100_1_187_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9415 13 186 1.10.340.30
af_Q2FXR7_1_186_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9359 16 186 1.10.340.30
af_C6TKE8_117_301_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9324 13 190 1.10.340.30
af_A0A1D6I4F4_25_202_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8936 21 188 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A838SU34-F1-model_v4 DNA-3-methyladenine glycosylase I 0.996 13 186 GO:0006284
GO:0008725
GO:0046872
AF-A0A1H0C7H2-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9926 13 190 GO:0006284
GO:0008725
GO:0046872
AF-A0A1G7L956-F1-model_v4 DNA-3-methyladenine glycosylase I 0.992 13 190 GO:0006284
GO:0008725
GO:0046872
AF-A0A1H1YTV2-F1-model_v4 DNA-3-methyladenine glycosylase I 0.9916 2 186 GO:0006284
GO:0008725
GO:0046872
AF-A0A2N8LL57-F1-model_v4 deleted 0.9915 22 187

Map