F443184

General Info

Members Datasets Scaffolds Average Seq Length
434 256 868 127

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0454408|Ga0501033_0454408_380_781
Length 133
Sequence VKRAGILNRHLAGALAELGHGDGVLVCDVGMPIPSGPRVVDLAFRAGVPAFAEVLDGLLEELVVEGALAAEEADAANPAAAALLRHRFADLGPGLELVPHARLKELSAGARLVVRTGEARPYANVLLRCGVFF

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
13 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
14 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
15 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
21 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
22 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
23 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
24 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
25 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
31 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
32 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
33 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
34 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
35 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
36 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
37 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
38 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
39 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
40 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
41 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
42 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
43 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
44 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
45 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
46 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
47 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
48 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
49 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
50 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
51 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
52 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
53 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
54 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
55 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
56 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
57 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
58 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
59 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
60 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
61 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
62 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
63 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
64 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
65 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
66 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
67 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
68 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
69 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
77 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
78 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
79 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
80 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
81 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
82 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
83 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
84 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
85 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
95 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
96 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
97 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
98 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
99 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
100 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
101 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
102 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
103 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
109 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
110 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
111 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
112 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
113 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
119 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
120 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
121 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
122 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
123 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
124 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
125 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
126 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
127 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
133 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
134 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
135 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
136 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
141 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
142 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
143 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
144 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
145 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
148 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
149 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
150 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
151 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
188 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
189 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
190 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
191 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
192 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
193 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
194 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
195 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
196 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
197 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
198 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
199 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
200 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
201 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
202 2643221548 Streptomyces sp. Root55 Isolate Unclassified
203 2643221578 Streptomyces sp. Root63 Isolate Unclassified
204 2643221647 Streptomyces sp. Root369 Isolate Unclassified
205 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
206 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
207 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
208 2643221714 Streptomyces sp. Root264 Isolate Unclassified
209 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
210 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
211 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
212 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
213 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
214 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
215 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
216 2808606448 Streptomyces sp. 193411 Isolate Unclassified
217 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
218 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
219 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
220 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
221 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
222 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
223 2862574272 Streptomyces sp. AcE210 Isolate Nodule
224 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
225 2867428634 Streptomyces sp. RP5T Isolate Unclassified
226 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
227 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
228 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
229 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
230 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
231 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
232 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
233 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
234 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
235 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
236 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
237 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
238 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
239 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
240 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
241 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
242 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
243 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
244 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
245 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
246 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
247 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
248 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
249 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
250 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
251 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
252 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
253 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
254 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
255 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
256 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 85.25
Metatranscriptomes 1.15
Isolates 13.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.07
Nodule 0.69
Rhizoplane 0.23
Rhizosphere 76.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0454408 3300049570 Bacteria 889
2 JGI24738J21930_10033934 3300002075 Bacteria 1040
3 JGI25153J46596_10113833 3300003215 Bacteria 618
4 rootH1_10032377 3300003316 Bacteria 3311
5 rootH2_10042051 3300003320 Bacteria 2070
6 rootL2_10056401 3300003322 Bacteria 1640
7 rootL2_10078854 3300003322 Bacteria 2794
8 rootH1_10015361 3300003323 Bacteria 6062
9 rootH1_10041793 3300003323 Bacteria 4151
10 Ga0006562J51391_1027451 3300003578 Bacteria 3920
11 Ga0006562J51391_1027452 3300003578 Bacteria 2211
12 Ga0006562J51391_1115102 3300003578 Bacteria 5940
13 Ga0006562J51391_1115105 3300003578 Bacteria 2060
14 Ga0006562J51391_1152979 3300003578 Bacteria 700
15 Ga0070668_102102616 3300005347 Bacteria 521
16 Ga0070709_11012787 3300005434 Bacteria 661
17 Ga0068855_100416178 3300005563 Bacteria 1471
18 Ga0068856_100233895 3300005614 Bacteria 1853
19 Ga0081455_10327561 3300005937 Bacteria 1088
20 Ga0075363_100010456 3300006048 Bacteria 4410
21 Ga0075367_10001800 3300006178 Bacteria 9432
22 Ga0105243_10873220 3300009148 Bacteria 893
23 Ga0105242_10968318 3300009176 Bacteria 856
24 Ga0105239_10421932 3300010375 Bacteria 1511
25 Ga0105246_10001746 3300011119 Bacteria 13005
26 Ga0157372_11268175 3300013307 Bacteria 851
27 Ga0182008_10005624 3300014497 Bacteria 7103
28 Ga0182007_10002128 3300015262 Bacteria 10112
29 Ga0183367_1006 3300015688 Bacteria 648044
30 Ga0209758_1016418 3300025297 Bacteria 3763
31 Ga0207709_10068524 3300025935 Bacteria 2243
32 Ga0207667_10490894 3300025949 Bacteria 1246
33 Ga0207712_10486918 3300025961 Bacteria 1052
34 Ga0207678_10198003 3300026067 Bacteria 1717
35 Ga0207702_10488427 3300026078 Bacteria 1199
36 Ga0209813_10052716 3300027866 Bacteria 1277
37 Ga0307517_10088716 3300028786 Bacteria 2553
38 Ga0307515_10000541 3300028794 Bacteria 88944
39 Ga0307515_10139861 3300028794 Bacteria 2604
40 Ga0307515_10165999 3300028794 Bacteria 2225
41 Ga0307511_10005628 3300030521 Bacteria 12715
42 Ga0307511_10307773 3300030521 Bacteria 710
43 Ga0307512_10001869 3300030522 Bacteria 28236
44 Ga0316180_1078211 3300030736 Bacteria 787
45 Ga0307513_10093571 3300031456 Bacteria 3054
46 Ga0307513_10265802 3300031456 Bacteria 1502
47 Ga0307513_10404778 3300031456 Bacteria 1098
48 Ga0307513_10691961 3300031456 Bacteria 725
49 Ga0307509_10020123 3300031507 Bacteria 7583
50 Ga0307509_10021348 3300031507 Bacteria 7321
51 Ga0307509_10050714 3300031507 Bacteria 4442
52 Ga0307508_10010039 3300031616 Bacteria 8676
53 Ga0307508_10026670 3300031616 Bacteria 5236
54 Ga0307508_10094344 3300031616 Bacteria 2583
55 Ga0307508_10347378 3300031616 Bacteria 1075
56 Ga0307514_10011385 3300031649 Bacteria 7394
57 Ga0307514_10039711 3300031649 Bacteria 3716
58 Ga0307514_10159739 3300031649 Bacteria 1494
59 Ga0307514_10295256 3300031649 Bacteria 913
60 Ga0307514_10361942 3300031649 Bacteria 765
61 Ga0307514_10548584 3300031649 Bacteria 534
62 Ga0307516_10012032 3300031730 Bacteria 9354
63 Ga0307516_10630460 3300031730 Bacteria 727
64 Ga0307518_10096207 3300031838 Bacteria 2124
65 Ga0307518_10482637 3300031838 Bacteria 647
66 Ga0307409_100361691 3300031995 Bacteria 1373
67 Ga0307409_102232848 3300031995 Bacteria 577
68 Ga0307416_103104725 3300032002 Bacteria 556
69 Ga0307411_10699390 3300032005 Bacteria 883
70 Ga0307415_101147268 3300032126 Bacteria 730
71 Ga0307507_10021084 3300033179 Bacteria 7270
72 Ga0307507_10030364 3300033179 Bacteria 5702
73 Ga0307510_10054625 3300033180 Bacteria 4180
74 Ga0307510_10197715 3300033180 Bacteria 1549
75 Ga0307510_10200796 3300033180 Bacteria 1529
76 Ga0307510_10325073 3300033180 Bacteria 994
77 Ga0395900_0418434 3300037418 Bacteria 1301
78 Ga0395898_0013633 3300037466 Bacteria 8362
79 Ga0395898_1286672 3300037466 Bacteria 661
80 Ga0439436_0006262 3300041404 Bacteria 3654
81 Ga0439436_0022788 3300041404 Bacteria 1854
82 Ga0451795_1435310 3300041456 Bacteria 505
83 Ga0451833_1066800 3300041491 Bacteria 576
84 Ga0451841_1023373 3300041498 Bacteria 645
85 Ga0451851_1075388 3300041507 Bacteria 793
86 Ga0451843_1439762 3300041509 Bacteria 925
87 Ga0451853_0267097 3300041512 Bacteria 2612
88 Ga0451853_2399869 3300041512 Bacteria 2292
89 Ga0451853_3848033 3300041512 Bacteria 781
90 Ga0439433_0000374 3300041999 Bacteria 7964
91 Ga0439433_0055792 3300041999 Bacteria 936
92 Ga0439448_0028790 3300042005 Bacteria 1756
93 Ga0439449_0008214 3300042007 Bacteria 3968
94 Ga0439449_0010788 3300042007 Bacteria 3449
95 Ga0439449_0015193 3300042007 Bacteria 2892
96 Ga0439449_0032602 3300042007 Bacteria 1942
97 Ga0439449_0385402 3300042007 Bacteria 531
98 Ga0439450_015228 3300042008 Bacteria 1572
99 Ga0439457_000938 3300042014 Bacteria 8756
100 Ga0439457_035635 3300042014 Bacteria 1107
101 Ga0439462_0007297 3300042015 Bacteria 2763
102 Ga0439462_0150387 3300042015 Bacteria 654
103 Ga0450894_000192 3300042131 Bacteria 11052
104 Ga0450899_000333 3300042135 Bacteria 5189
105 Ga0450902_002248 3300042137 Bacteria 2728
106 Ga0450903_000720 3300042138 Bacteria 6569
107 Ga0450906_000155 3300042145 Bacteria 12702
108 Ga0439458_0004166 3300042157 Bacteria 3338
109 Ga0450909_077452 3300042185 Bacteria 536
110 Ga0466969_0148083 3300044656 Bacteria 1082
111 Ga0466972_0001016 3300044658 Bacteria 13446
112 Ga0466972_0029193 3300044658 Bacteria 2715
113 Ga0466972_0032749 3300044658 Bacteria 2551
114 Ga0466972_0054261 3300044658 Bacteria 1929
115 Ga0466972_0453503 3300044658 Bacteria 602
116 Ga0466965_0006945 3300044683 Bacteria 5180
117 Ga0466965_0064049 3300044683 Bacteria 1840
118 Ga0466965_0079002 3300044683 Bacteria 1662
119 Ga0466965_0598595 3300044683 Bacteria 626
120 Ga0466966_0009137 3300044684 Bacteria 6563
121 Ga0466966_0186926 3300044684 Bacteria 1256
122 Ga0466961_0005533 3300044693 Bacteria 7968
123 Ga0466961_0020626 3300044693 Bacteria 4241
124 Ga0466961_0130619 3300044693 Bacteria 1574
125 Ga0466963_0002312 3300044694 Bacteria 10611
126 Ga0466963_0026745 3300044694 Bacteria 3692
127 Ga0466963_0157494 3300044694 Bacteria 1579
128 Ga0466964_0022499 3300044706 Bacteria 2446
129 Ga0466964_0040571 3300044706 Bacteria 1880
130 Ga0466971_0009115 3300044719 Bacteria 4337
131 Ga0466971_0188436 3300044719 Bacteria 971
132 Ga0466968_0121410 3300044735 Bacteria 1182
133 Ga0466970_0001488 3300044765 Bacteria 11266
134 Ga0466970_0003950 3300044765 Bacteria 7267
135 Ga0466957_0076957 3300044842 Bacteria 2072
136 Ga0466960_0008432 3300044901 Bacteria 4221
137 Ga0466960_0552600 3300044901 Bacteria 679
138 Ga0466960_0943411 3300044901 Bacteria 528
139 Ga0466959_0004028 3300045049 Bacteria 9764
140 Ga0466958_0004295 3300045836 Bacteria 7504
141 Ga0466958_0236594 3300045836 Bacteria 1167
142 Ga0466967_0040080 3300045976 Bacteria 4031
143 Ga0466967_0104595 3300045976 Bacteria 2592
144 Ga0466967_0200345 3300045976 Bacteria 1890
145 Ga0495617_021479 3300046452 Bacteria 2179
146 Ga0495603_0000531 3300046455 Bacteria 21139
147 Ga0495603_0003456 3300046455 Bacteria 9393
148 Ga0495603_0023092 3300046455 Bacteria 3765
149 Ga0495603_0026475 3300046455 Bacteria 3503
150 Ga0495603_0074493 3300046455 Bacteria 1993
151 Ga0495603_0139045 3300046455 Bacteria 1413
152 Ga0495590_0048617 3300046457 Bacteria 1480
153 Ga0495629_0000707 3300046459 Bacteria 27008
154 Ga0495629_0002283 3300046459 Bacteria 14771
155 Ga0495629_0006011 3300046459 Bacteria 9028
156 Ga0495629_0330213 3300046459 Bacteria 1042
157 Ga0495629_0520511 3300046459 Bacteria 800
158 Ga0495638_0046410 3300046460 Bacteria 2729
159 Ga0495638_0368256 3300046460 Bacteria 754
160 Ga0495651_0012456 3300046462 Bacteria 6558
161 Ga0495651_0222480 3300046462 Bacteria 1305
162 Ga0495653_0781349 3300046463 Bacteria 575
163 Ga0495582_0040469 3300046473 Bacteria 2567
164 Ga0495582_0088584 3300046473 Bacteria 1724
165 Ga0495605_0012608 3300046474 Bacteria 4680
166 Ga0495639_0618410 3300046475 Bacteria 557
167 Ga0495662_0003473 3300046476 Bacteria 7984
168 Ga0495662_0032350 3300046476 Bacteria 2526
169 Ga0495664_0088115 3300046477 Bacteria 1865
170 Ga0495664_0097180 3300046477 Bacteria 1772
171 Ga0495584_0449034 3300046491 Bacteria 656
172 Ga0495585_0008411 3300046492 Bacteria 6255
173 Ga0495585_0012882 3300046492 Bacteria 4914
174 Ga0495585_0029855 3300046492 Bacteria 3102
175 Ga0495594_0000260 3300046499 Bacteria 25795
176 Ga0495594_0002727 3300046499 Bacteria 9162
177 Ga0495594_0085355 3300046499 Bacteria 1766
178 Ga0495594_0112504 3300046499 Bacteria 1535
179 Ga0495596_0009287 3300046500 Bacteria 4330
180 Ga0495607_0038172 3300046501 Bacteria 2879
181 Ga0495607_0085290 3300046501 Bacteria 1725
182 Ga0495607_0098230 3300046501 Bacteria 1573
183 Ga0495583_0016696 3300046506 Bacteria 3934
184 Ga0495583_0283445 3300046506 Bacteria 660
185 Ga0495583_0325458 3300046506 Bacteria 608
186 Ga0495583_0356831 3300046506 Bacteria 576
187 Ga0495583_0434954 3300046506 Bacteria 514
188 Ga0495608_0401695 3300046511 Bacteria 838
189 Ga0495616_0009853 3300046513 Bacteria 5560
190 Ga0495618_0015177 3300046514 Bacteria 4700
191 Ga0495618_0111758 3300046514 Bacteria 1749
192 Ga0495620_0006156 3300046515 Bacteria 6614
193 Ga0495628_0018492 3300046516 Bacteria 5770
194 Ga0495628_0032171 3300046516 Bacteria 4237
195 Ga0495632_0541387 3300046519 Bacteria 500
196 Ga0495637_0141399 3300046520 Bacteria 913
197 Ga0495643_0053776 3300046522 Bacteria 2157
198 Ga0495644_0110460 3300046523 Bacteria 1043
199 Ga0495648_0216300 3300046524 Bacteria 948
200 Ga0495666_0303140 3300046526 Bacteria 722
201 Ga0495652_0017915 3300046529 Bacteria 6320
202 Ga0495652_0271219 3300046529 Bacteria 1247
203 Ga0495654_0176228 3300046530 Bacteria 929
204 Ga0495665_0304481 3300046531 Bacteria 816
205 Ga0495640_0040664 3300046533 Bacteria 3254
206 Ga0495640_0053048 3300046533 Bacteria 2781
207 Ga0495587_0004766 3300046536 Bacteria 8907
208 Ga0495609_0048325 3300046538 Bacteria 1902
209 Ga0495597_0259839 3300046542 Bacteria 680
210 Ga0495645_0025262 3300046543 Bacteria 4311
211 Ga0495622_0003092 3300046557 Bacteria 7893
212 Ga0495622_0009499 3300046557 Bacteria 4499
213 Ga0495622_0020377 3300046557 Bacteria 3087
214 Ga0495622_0053141 3300046557 Bacteria 1879
215 Ga0495633_0043965 3300046558 Bacteria 2118
216 Ga0495668_0011865 3300046616 Bacteria 5193
217 Ga0495634_0001005 3300046642 Bacteria 26553
218 Ga0495634_0048371 3300046642 Bacteria 2863
219 Ga0495634_0286956 3300046642 Bacteria 998
220 Ga0495611_0003229 3300046648 Bacteria 7212
221 Ga0495611_0034042 3300046648 Bacteria 2250
222 Ga0495611_0123085 3300046648 Bacteria 1209
223 Ga0495611_0254051 3300046648 Bacteria 814
224 Ga0495611_0284184 3300046648 Bacteria 764
225 Ga0495625_0020564 3300046660 Bacteria 5093
226 Ga0495625_0031424 3300046660 Bacteria 3949
227 Ga0495625_0043039 3300046660 Bacteria 3277
228 Ga0495625_0058688 3300046660 Bacteria 2733
229 Ga0495625_0274113 3300046660 Bacteria 1088
230 Ga0495625_0517940 3300046660 Bacteria 727
231 Ga0495635_0024236 3300046663 Bacteria 4230
232 Ga0495635_0245584 3300046663 Bacteria 1207
233 Ga0495661_0013603 3300046665 Bacteria 5463
234 Ga0495588_0002109 3300046674 Bacteria 8533
235 Ga0495588_0009466 3300046674 Bacteria 4503
236 Ga0495657_0001985 3300046675 Bacteria 17443
237 Ga0495657_0076576 3300046675 Bacteria 2172
238 Ga0495657_0130496 3300046675 Bacteria 1574
239 Ga0495599_0360009 3300046678 Bacteria 871
240 Ga0495623_0159427 3300046679 Bacteria 1327
241 Ga0495646_0029076 3300046680 Bacteria 3455
242 Ga0495646_0248268 3300046680 Bacteria 954
243 Ga0495613_0022990 3300046689 Bacteria 4645
244 Ga0495613_0103869 3300046689 Bacteria 2051
245 Ga0495613_0254569 3300046689 Bacteria 1224
246 Ga0495613_0445349 3300046689 Bacteria 878
247 Ga0495613_0459729 3300046689 Bacteria 861
248 Ga0495624_0013886 3300046690 Bacteria 5482
249 Ga0495670_0694701 3300046691 Bacteria 555
250 Ga0495670_0774626 3300046691 Bacteria 523
251 Ga0495671_0001899 3300046692 Bacteria 13419
252 Ga0495671_0226401 3300046692 Bacteria 905
253 Ga0495649_0018821 3300046694 Bacteria 3879
254 Ga0495649_0034524 3300046694 Bacteria 2783
255 Ga0495589_0004123 3300046794 Bacteria 7775
256 Ga0495589_0050139 3300046794 Bacteria 2065
257 Ga0495589_0072388 3300046794 Bacteria 1683
258 Ga0495600_0044056 3300046809 Bacteria 2911
259 Ga0495600_0053776 3300046809 Bacteria 2629
260 Ga0495660_0003952 3300046810 Bacteria 9055
261 Ga0495660_0049972 3300046810 Bacteria 2280
262 Ga0495660_0281959 3300046810 Bacteria 759
263 Ga0495581_0017820 3300047315 Bacteria 4127
264 Ga0495581_0451032 3300047315 Bacteria 749
265 Ga0495604_0000237 3300047317 Bacteria 49264
266 Ga0495604_0105742 3300047317 Bacteria 2059
267 Ga0495604_0245496 3300047317 Bacteria 1222
268 Ga0495636_0003544 3300047318 Bacteria 6052
269 Ga0495636_0097650 3300047318 Bacteria 1281
270 Ga0495636_0373389 3300047318 Bacteria 676
271 Ga0495674_0234659 3300047319 Bacteria 1513
272 Ga0495674_0592711 3300047319 Bacteria 879
273 Ga0495672_0140358 3300047320 Bacteria 1263
274 Ga0495676_0004323 3300047321 Bacteria 12982
275 Ga0495676_0008993 3300047321 Bacteria 9118
276 Ga0495676_0009988 3300047321 Bacteria 8624
277 Ga0495676_0016122 3300047321 Bacteria 6638
278 Ga0495676_0042694 3300047321 Bacteria 3719
279 Ga0495676_0396360 3300047321 Bacteria 916
280 Ga0495676_0533304 3300047321 Bacteria 768
281 Ga0495680_0165555 3300047322 Bacteria 1603
282 Ga0495683_0003480 3300047323 Bacteria 9177
283 Ga0495683_0020847 3300047323 Bacteria 3379
284 Ga0495683_0061458 3300047323 Bacteria 1860
285 Ga0495683_0124720 3300047323 Bacteria 1219
286 Ga0495687_000551 3300047443 Bacteria 44454
287 Ga0495687_003518 3300047443 Bacteria 11288
288 Ga0495687_015321 3300047443 Bacteria 3904
289 Ga0495687_019520 3300047443 Bacteria 3323
290 Ga0495687_055075 3300047443 Bacteria 1664
291 Ga0495687_096986 3300047443 Bacteria 1115
292 Ga0495687_112048 3300047443 Bacteria 1001
293 Ga0495675_0059662 3300047444 Bacteria 2419
294 Ga0495675_0692283 3300047444 Bacteria 571
295 Ga0495677_0016737 3300047445 Bacteria 2660
296 Ga0495677_0328115 3300047445 Bacteria 603
297 Ga0495685_009358 3300047447 Bacteria 3272
298 Ga0495685_041531 3300047447 Bacteria 1572
299 Ga0495685_253658 3300047447 Bacteria 558
300 Ga0495681_0000405 3300047470 Bacteria 33516
301 Ga0495684_0288047 3300047471 Bacteria 1183
302 Ga0495684_0682875 3300047471 Bacteria 683
303 Ga0495686_0061061 3300047472 Bacteria 2342
304 Ga0495593_0014064 3300047673 Bacteria 4555
305 Ga0495593_0116703 3300047673 Bacteria 1360
306 Ga0495602_0049382 3300048088 Bacteria 3769
307 Ga0495602_0626798 3300048088 Bacteria 737
308 Ga0495614_0000983 3300048089 Bacteria 12115
309 Ga0495614_0004229 3300048089 Bacteria 6468
310 Ga0495614_0095959 3300048089 Bacteria 1292
311 Ga0495614_0216615 3300048089 Bacteria 869
312 Ga0495678_028203 3300049459 Bacteria 2373
313 Ga0501031_0010569 3300049568 Bacteria 6009
314 Ga0501032_0649019 3300049569 Bacteria 670
315 Ga0501033_0045225 3300049570 Bacteria 3276
316 Ga0501034_0019007 3300049571 Bacteria 7038
317 Ga0501034_0100328 3300049571 Bacteria 2889
318 Ga0501034_0939196 3300049571 Bacteria 751
319 Ga0501036_0064527 3300049572 Bacteria 3099
320 Ga0501036_0077854 3300049572 Bacteria 2805
321 Ga0501037_0164986 3300049573 Bacteria 1578
322 Ga0501038_0078604 3300049574 Bacteria 2783
323 Ga0501038_0164667 3300049574 Bacteria 1799
324 Ga0501038_0786002 3300049574 Bacteria 708
325 Ga0501039_0013134 3300049575 Bacteria 6330
326 Ga0501039_0105274 3300049575 Bacteria 2203
327 Ga0501042_0057458 3300049578 Bacteria 2776
328 Ga0501043_0005286 3300049579 Bacteria 10439
329 Ga0501043_0010991 3300049579 Bacteria 7089
330 Ga0501046_0009034 3300049580 Bacteria 8640
331 Ga0501046_0133272 3300049580 Bacteria 1883
332 Ga0501046_0686000 3300049580 Bacteria 722
333 Ga0501047_0010964 3300049581 Bacteria 8575
334 Ga0501047_0161679 3300049581 Bacteria 2111
335 Ga0501048_0005432 3300049582 Bacteria 9687
336 Ga0501069_0734413 3300049585 Bacteria 596
337 Ga0501070_0011738 3300049586 Bacteria 7399
338 Ga0501070_0074095 3300049586 Bacteria 2818
339 Ga0501070_0228570 3300049586 Bacteria 1525
340 Ga0501071_1582547 3300049587 Bacteria 506
341 Ga0501073_0086460 3300049589 Bacteria 2181
342 Ga0501074_0001433 3300049590 Bacteria 15931
343 Ga0501035_0002152 3300049822 Bacteria 19561
344 Ga0501035_0104328 3300049822 Bacteria 2486
345 Ga0501035_0495975 3300049822 Bacteria 1005
346 Ga0501035_0599127 3300049822 Bacteria 898
347 Ga0501044_0003227 3300049823 Bacteria 18356
348 Ga0501044_0086449 3300049823 Bacteria 3167
349 Ga0501044_0148965 3300049823 Bacteria 2323
350 Ga0501044_0160857 3300049823 Bacteria 2222
351 Ga0501044_0589914 3300049823 Bacteria 1005
352 Ga0501044_0721034 3300049823 Bacteria 881
353 Ga0501045_0082042 3300049824 Bacteria 2378
354 nmdc:mga03n38_198930_c1 3300050490 Bacteria 1036
355 nmdc:mga06z11_202100_c1 3300050494 Bacteria 1155
356 nmdc:mga04h51_5012_c1 3300050495 Bacteria 3345
357 nmdc:mga07m45_114380_c1 3300050496 Bacteria 1555
358 Ga0495619_0091595 3300053085 Bacteria 2058
359 Ga0500578_0171187 3300053086 Bacteria 1343
360 Ga0500578_0248610 3300053086 Bacteria 1072
361 Ga0500640_139752 3300053095 Bacteria 942
362 Ga0500553_180257 3300053101 Bacteria 759
363 Ga0500560_001798 3300053107 Bacteria 3867
364 Ga0500572_024459 3300053111 Bacteria 1630
365 Ga0500652_186102 3300053131 Bacteria 849
366 Ga0500573_0079124 3300053140 Bacteria 1870
367 Ga0500600_0110318 3300053149 Bacteria 1436
368 Ga0500600_0223667 3300053149 Bacteria 866
369 Ga0500600_0376296 3300053149 Bacteria 573
370 Ga0500633_0063865 3300053160 Bacteria 1301
371 Ga0500634_0238847 3300053161 Bacteria 765
372 Ga0466962_0007455 3300061719 Bacteria 5249
373 Ga0466962_0040470 3300061719 Bacteria 2231
374 Ga0466962_0125007 3300061719 Bacteria 1242
375 Ga0466962_0478235 3300061719 Bacteria 629
376 2547406962 2547132111 Bacteria 8013147
377 2585309218 2582581313 Bacteria 10042643
378 2585319796 2582581314 Bacteria 11452267
379 2616697686 2616644814 Bacteria 11555299
380 2643762148 2643221548 Bacteria 8053412
381 2643901856 2643221578 Bacteria 9213798
382 2644263232 2643221647 Bacteria 10741251
383 2644408002 2643221673 Bacteria 9196637
384 2644436535 2643221678 Bacteria 9540101
385 2644459074 2643221682 Bacteria 6743283
386 2644625622 2643221714 Bacteria 9015452
387 2784587996 2784132148 Bacteria 8627943
388 2785344138 2784746763 Bacteria 9783172
389 2785368755 2784746768 Bacteria 10036182
390 2786669861 2786546132 Bacteria 10419719
391 2804849034 2802429296 Bacteria 7227771
392 2808841427 2808606359 Bacteria 9866990
393 2808919992 2808606375 Bacteria 9466072
394 2809231601 2808606448 Bacteria 8656184
395 2812358821 2811994879 Bacteria 9313447
396 2812481107 2811994917 Bacteria 7761064
397 2819699450 2818991463 Bacteria 7948711
398 2852641892 2852635781 Bacteria 8251373
399 2862287960 2862281513 Bacteria 9621493
400 2862392966 2862382967 Bacteria 10317375
401 2862579852 2862574272 Bacteria 10567477
402 2863405398 2863404153 Bacteria 9672205
403 2867438029 2867428634 Bacteria 9590268
404 2873153395 2873151551 Bacteria 8625867
405 2875397777 2875391855 Bacteria 7600475
406 2877681758 2877676314 Bacteria 9512378
407 2912720738 2912715099 Bacteria 9460473
408 2912724879 2912723979 Bacteria 8557534
409 2919473564 2919468124 Bacteria 9133025
410 2946046735 2946045630 Bacteria 8527308
411 2946067050 2946064051 Bacteria 8957905
412 2946075355 2946072368 Bacteria 8999607
413 2947230179 2947224130 Bacteria 9938529
414 2954003403 2954002825 Bacteria 9173742
415 2954386906 2954380949 Bacteria 10050426
416 2954676290 2954673503 Bacteria 9685905
417 2954687879 2954682443 Bacteria 9862841
418 2954697716 2954691527 Bacteria 10720516
419 2954704500 2954701450 Bacteria 10834262
420 2954716851 2954711539 Bacteria 10867210
421 2954726799 2954721474 Bacteria 10456478
422 2954734996 2954731030 Bacteria 10243860
423 2954745722 2954740390 Bacteria 10229294
424 2954753868 2954749733 Bacteria 10366972
425 2954764696 2954759201 Bacteria 9358192
426 2966599751 2966598605 Bacteria 7676064
427 2990065797 2990059506 Bacteria 9321252
428 3006501493 3006493962 Bacteria 8825450
429 8008559679 8008558824 Bacteria 10610750
430 8008579420 8008574985 Bacteria 7815457
431 8023631008 8023623736 Bacteria 8593882
432 8025418449 8025413630 Bacteria 7014048
433 8048409354 8048406513 Bacteria 8936924
434 8055179345 8055172936 Bacteria 9305943
435 Ga0501033_0454408
436 JGI24738J21930_10033934
437 JGI25153J46596_10113833
438 rootH1_10032377
439 rootH2_10042051
440 rootL2_10056401
441 rootL2_10078854
442 rootH1_10015361
443 rootH1_10041793
444 Ga0006562J51391_1027451
445 Ga0006562J51391_1027452
446 Ga0006562J51391_1115102
447 Ga0006562J51391_1115105
448 Ga0006562J51391_1152979
449 Ga0070668_102102616
450 Ga0070709_11012787
451 Ga0068855_100416178
452 Ga0068856_100233895
453 Ga0081455_10327561
454 Ga0075363_100010456
455 Ga0075367_10001800
456 Ga0105243_10873220
457 Ga0105242_10968318
458 Ga0105239_10421932
459 Ga0105246_10001746
460 Ga0157372_11268175
461 Ga0182008_10005624
462 Ga0182007_10002128
463 Ga0183367_1006
464 Ga0209758_1016418
465 Ga0207709_10068524
466 Ga0207667_10490894
467 Ga0207712_10486918
468 Ga0207678_10198003
469 Ga0207702_10488427
470 Ga0209813_10052716
471 Ga0307517_10088716
472 Ga0307515_10000541
473 Ga0307515_10139861
474 Ga0307515_10165999
475 Ga0307511_10005628
476 Ga0307511_10307773
477 Ga0307512_10001869
478 Ga0316180_1078211
479 Ga0307513_10093571
480 Ga0307513_10265802
481 Ga0307513_10404778
482 Ga0307513_10691961
483 Ga0307509_10020123
484 Ga0307509_10021348
485 Ga0307509_10050714
486 Ga0307508_10010039
487 Ga0307508_10026670
488 Ga0307508_10094344
489 Ga0307508_10347378
490 Ga0307514_10011385
491 Ga0307514_10039711
492 Ga0307514_10159739
493 Ga0307514_10295256
494 Ga0307514_10361942
495 Ga0307514_10548584
496 Ga0307516_10012032
497 Ga0307516_10630460
498 Ga0307518_10096207
499 Ga0307518_10482637
500 Ga0307409_100361691
501 Ga0307409_102232848
502 Ga0307416_103104725
503 Ga0307411_10699390
504 Ga0307415_101147268
505 Ga0307507_10021084
506 Ga0307507_10030364
507 Ga0307510_10054625
508 Ga0307510_10197715
509 Ga0307510_10200796
510 Ga0307510_10325073
511 Ga0395900_0418434
512 Ga0395898_0013633
513 Ga0395898_1286672
514 Ga0439436_0006262
515 Ga0439436_0022788
516 Ga0451795_1435310
517 Ga0451833_1066800
518 Ga0451841_1023373
519 Ga0451851_1075388
520 Ga0451843_1439762
521 Ga0451853_0267097
522 Ga0451853_2399869
523 Ga0451853_3848033
524 Ga0439433_0000374
525 Ga0439433_0055792
526 Ga0439448_0028790
527 Ga0439449_0008214
528 Ga0439449_0010788
529 Ga0439449_0015193
530 Ga0439449_0032602
531 Ga0439449_0385402
532 Ga0439450_015228
533 Ga0439457_000938
534 Ga0439457_035635
535 Ga0439462_0007297
536 Ga0439462_0150387
537 Ga0450894_000192
538 Ga0450899_000333
539 Ga0450902_002248
540 Ga0450903_000720
541 Ga0450906_000155
542 Ga0439458_0004166
543 Ga0450909_077452
544 Ga0466969_0148083
545 Ga0466972_0001016
546 Ga0466972_0029193
547 Ga0466972_0032749
548 Ga0466972_0054261
549 Ga0466972_0453503
550 Ga0466965_0006945
551 Ga0466965_0064049
552 Ga0466965_0079002
553 Ga0466965_0598595
554 Ga0466966_0009137
555 Ga0466966_0186926
556 Ga0466961_0005533
557 Ga0466961_0020626
558 Ga0466961_0130619
559 Ga0466963_0002312
560 Ga0466963_0026745
561 Ga0466963_0157494
562 Ga0466964_0022499
563 Ga0466964_0040571
564 Ga0466971_0009115
565 Ga0466971_0188436
566 Ga0466968_0121410
567 Ga0466970_0001488
568 Ga0466970_0003950
569 Ga0466957_0076957
570 Ga0466960_0008432
571 Ga0466960_0552600
572 Ga0466960_0943411
573 Ga0466959_0004028
574 Ga0466958_0004295
575 Ga0466958_0236594
576 Ga0466967_0040080
577 Ga0466967_0104595
578 Ga0466967_0200345
579 Ga0495617_021479
580 Ga0495603_0000531
581 Ga0495603_0003456
582 Ga0495603_0023092
583 Ga0495603_0026475
584 Ga0495603_0074493
585 Ga0495603_0139045
586 Ga0495590_0048617
587 Ga0495629_0000707
588 Ga0495629_0002283
589 Ga0495629_0006011
590 Ga0495629_0330213
591 Ga0495629_0520511
592 Ga0495638_0046410
593 Ga0495638_0368256
594 Ga0495651_0012456
595 Ga0495651_0222480
596 Ga0495653_0781349
597 Ga0495582_0040469
598 Ga0495582_0088584
599 Ga0495605_0012608
600 Ga0495639_0618410
601 Ga0495662_0003473
602 Ga0495662_0032350
603 Ga0495664_0088115
604 Ga0495664_0097180
605 Ga0495584_0449034
606 Ga0495585_0008411
607 Ga0495585_0012882
608 Ga0495585_0029855
609 Ga0495594_0000260
610 Ga0495594_0002727
611 Ga0495594_0085355
612 Ga0495594_0112504
613 Ga0495596_0009287
614 Ga0495607_0038172
615 Ga0495607_0085290
616 Ga0495607_0098230
617 Ga0495583_0016696
618 Ga0495583_0283445
619 Ga0495583_0325458
620 Ga0495583_0356831
621 Ga0495583_0434954
622 Ga0495608_0401695
623 Ga0495616_0009853
624 Ga0495618_0015177
625 Ga0495618_0111758
626 Ga0495620_0006156
627 Ga0495628_0018492
628 Ga0495628_0032171
629 Ga0495632_0541387
630 Ga0495637_0141399
631 Ga0495643_0053776
632 Ga0495644_0110460
633 Ga0495648_0216300
634 Ga0495666_0303140
635 Ga0495652_0017915
636 Ga0495652_0271219
637 Ga0495654_0176228
638 Ga0495665_0304481
639 Ga0495640_0040664
640 Ga0495640_0053048
641 Ga0495587_0004766
642 Ga0495609_0048325
643 Ga0495597_0259839
644 Ga0495645_0025262
645 Ga0495622_0003092
646 Ga0495622_0009499
647 Ga0495622_0020377
648 Ga0495622_0053141
649 Ga0495633_0043965
650 Ga0495668_0011865
651 Ga0495634_0001005
652 Ga0495634_0048371
653 Ga0495634_0286956
654 Ga0495611_0003229
655 Ga0495611_0034042
656 Ga0495611_0123085
657 Ga0495611_0254051
658 Ga0495611_0284184
659 Ga0495625_0020564
660 Ga0495625_0031424
661 Ga0495625_0043039
662 Ga0495625_0058688
663 Ga0495625_0274113
664 Ga0495625_0517940
665 Ga0495635_0024236
666 Ga0495635_0245584
667 Ga0495661_0013603
668 Ga0495588_0002109
669 Ga0495588_0009466
670 Ga0495657_0001985
671 Ga0495657_0076576
672 Ga0495657_0130496
673 Ga0495599_0360009
674 Ga0495623_0159427
675 Ga0495646_0029076
676 Ga0495646_0248268
677 Ga0495613_0022990
678 Ga0495613_0103869
679 Ga0495613_0254569
680 Ga0495613_0445349
681 Ga0495613_0459729
682 Ga0495624_0013886
683 Ga0495670_0694701
684 Ga0495670_0774626
685 Ga0495671_0001899
686 Ga0495671_0226401
687 Ga0495649_0018821
688 Ga0495649_0034524
689 Ga0495589_0004123
690 Ga0495589_0050139
691 Ga0495589_0072388
692 Ga0495600_0044056
693 Ga0495600_0053776
694 Ga0495660_0003952
695 Ga0495660_0049972
696 Ga0495660_0281959
697 Ga0495581_0017820
698 Ga0495581_0451032
699 Ga0495604_0000237
700 Ga0495604_0105742
701 Ga0495604_0245496
702 Ga0495636_0003544
703 Ga0495636_0097650
704 Ga0495636_0373389
705 Ga0495674_0234659
706 Ga0495674_0592711
707 Ga0495672_0140358
708 Ga0495676_0004323
709 Ga0495676_0008993
710 Ga0495676_0009988
711 Ga0495676_0016122
712 Ga0495676_0042694
713 Ga0495676_0396360
714 Ga0495676_0533304
715 Ga0495680_0165555
716 Ga0495683_0003480
717 Ga0495683_0020847
718 Ga0495683_0061458
719 Ga0495683_0124720
720 Ga0495687_000551
721 Ga0495687_003518
722 Ga0495687_015321
723 Ga0495687_019520
724 Ga0495687_055075
725 Ga0495687_096986
726 Ga0495687_112048
727 Ga0495675_0059662
728 Ga0495675_0692283
729 Ga0495677_0016737
730 Ga0495677_0328115
731 Ga0495685_009358
732 Ga0495685_041531
733 Ga0495685_253658
734 Ga0495681_0000405
735 Ga0495684_0288047
736 Ga0495684_0682875
737 Ga0495686_0061061
738 Ga0495593_0014064
739 Ga0495593_0116703
740 Ga0495602_0049382
741 Ga0495602_0626798
742 Ga0495614_0000983
743 Ga0495614_0004229
744 Ga0495614_0095959
745 Ga0495614_0216615
746 Ga0495678_028203
747 Ga0501031_0010569
748 Ga0501032_0649019
749 Ga0501033_0045225
750 Ga0501034_0019007
751 Ga0501034_0100328
752 Ga0501034_0939196
753 Ga0501036_0064527
754 Ga0501036_0077854
755 Ga0501037_0164986
756 Ga0501038_0078604
757 Ga0501038_0164667
758 Ga0501038_0786002
759 Ga0501039_0013134
760 Ga0501039_0105274
761 Ga0501042_0057458
762 Ga0501043_0005286
763 Ga0501043_0010991
764 Ga0501046_0009034
765 Ga0501046_0133272
766 Ga0501046_0686000
767 Ga0501047_0010964
768 Ga0501047_0161679
769 Ga0501048_0005432
770 Ga0501069_0734413
771 Ga0501070_0011738
772 Ga0501070_0074095
773 Ga0501070_0228570
774 Ga0501071_1582547
775 Ga0501073_0086460
776 Ga0501074_0001433
777 Ga0501035_0002152
778 Ga0501035_0104328
779 Ga0501035_0495975
780 Ga0501035_0599127
781 Ga0501044_0003227
782 Ga0501044_0086449
783 Ga0501044_0148965
784 Ga0501044_0160857
785 Ga0501044_0589914
786 Ga0501044_0721034
787 Ga0501045_0082042
788 nmdc:mga03n38_198930_c1
789 nmdc:mga06z11_202100_c1
790 nmdc:mga04h51_5012_c1
791 nmdc:mga07m45_114380_c1
792 Ga0495619_0091595
793 Ga0500578_0171187
794 Ga0500578_0248610
795 Ga0500640_139752
796 Ga0500553_180257
797 Ga0500560_001798
798 Ga0500572_024459
799 Ga0500652_186102
800 Ga0500573_0079124
801 Ga0500600_0110318
802 Ga0500600_0223667
803 Ga0500600_0376296
804 Ga0500633_0063865
805 Ga0500634_0238847
806 Ga0466962_0007455
807 Ga0466962_0040470
808 Ga0466962_0125007
809 Ga0466962_0478235
810 2547406962
811 2585309218
812 2585319796
813 2616697686
814 2643762148
815 2643901856
816 2644263232
817 2644408002
818 2644436535
819 2644459074
820 2644625622
821 2784587996
822 2785344138
823 2785368755
824 2786669861
825 2804849034
826 2808841427
827 2808919992
828 2809231601
829 2812358821
830 2812481107
831 2819699450
832 2852641892
833 2862287960
834 2862392966
835 2862579852
836 2863405398
837 2867438029
838 2873153395
839 2875397777
840 2877681758
841 2912720738
842 2912724879
843 2919473564
844 2946046735
845 2946067050
846 2946075355
847 2947230179
848 2954003403
849 2954386906
850 2954676290
851 2954687879
852 2954697716
853 2954704500
854 2954716851
855 2954726799
856 2954734996
857 2954745722
858 2954753868
859 2954764696
860 2966599751
861 2990065797
862 3006501493
863 8008559679
864 8008579420
865 8023631008
866 8025418449
867 8048409354
868 8055179345

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05025

RbsD_FucU

RbsD / FucU transport protein family

1

132

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ogc-assembly1.cif.gz_A the structure of bacillus subtilis rbsd complexed with d-ribose 0.9118 5 129
1ogc-assembly1.cif.gz_A the structure of bacillus subtilis rbsd complexed with d-ribose 0.8785 5 129
3p12-assembly1.cif.gz_D crystal structure of d-ribose pyranase sa240 0.8722 7 127
3mvk-assembly5.cif.gz_D the crystal structure of fucu from bifidobacterium longum to 1.65a 0.8244 9 129
3p12-assembly1.cif.gz_D crystal structure of d-ribose pyranase sa240 0.8222 7 127
ID Description Score Start End Superfamily
1ogcA01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.9263 8 126 3.40.1650.10
1ogcA01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.9045 8 126 3.40.1650.10
3p12A01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8515 8 125 3.40.1650.10
2wcvA01 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.8156 9 126 3.40.1650.10
af_D4ACG8_1_149_3.40.1650.10 Alpha Beta;3-Layer(aba) Sandwich;RbsD-like fold;RbsD-like domain 0.813 11 129 3.40.1650.10
ID Description Score Start End GO Terms
AF-A0A7Z9CVP0-F1-model_v4 deleted 0.9478 61 129
AF-S4MF17-F1-model_v4 D-ribose pyranase (EC 5.4.99.62) 0.9468 40 129 GO:0005829
GO:0016872
GO:0019303
GO:0048029
GO:0062193
AF-A0A396QGB1-F1-model_v4 D-ribose pyranase (EC 5.4.99.62) 0.9364 55 129 GO:0005996
GO:0048029
GO:0062193
AF-A0A370IEQ9-F1-model_v4 D-ribose pyranase (EC 5.4.99.62) 0.9348 11 129 GO:0005829
GO:0016872
GO:0019303
GO:0048029
GO:0062193
AF-A0A1I3HQR8-F1-model_v4 D-ribose pyranase (EC 5.4.99.62) 0.9318 55 129 GO:0005829
GO:0016872
GO:0019303
GO:0048029
GO:0062193

Map