F443171

General Info

Members Datasets Scaffolds Average Seq Length
434 230 868 68

Family's Representative Sequence

Representative Sequence 3300046681|Ga0495647_0179570|Ga0495647_0179570_440_667
Length 75
Sequence MDVASLADLLHETSGRHGSFEAVAPAHDWWDWYAAYMNAREGGSTPEEASASAGRYMAEVKHVVVSPQGQASPDE

Samples

Sample ID Description Type Environment
1 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
130 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
147 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
148 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
149 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
150 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
151 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
155 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
160 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
161 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
162 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
163 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
179 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
185 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
186 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
208 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
209 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
210 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
211 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0.69
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.92
Nodule 0
Rhizoplane 7.6
Rhizosphere 83.41
Stem 0
Stem Tuber 0
Unclassified 5.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495647_0179570 3300046681 Bacteria 920
2 JGI25407J50210_10079752 3300003373 Bacteria 814
3 Ga0070666_10692897 3300005335 Bacteria 747
4 Ga0068868_100330493 3300005338 Bacteria 1301
5 Ga0070661_100778162 3300005344 Bacteria 784
6 Ga0070668_100094860 3300005347 Bacteria 2356
7 Ga0070674_100068036 3300005356 Bacteria 2507
8 Ga0070674_100239305 3300005356 Unclassified 1420
9 Ga0070673_100775603 3300005364 Bacteria 884
10 Ga0070688_100219479 3300005365 Bacteria 1339
11 Ga0070659_100437207 3300005366 Bacteria 1108
12 Ga0070667_100566268 3300005367 Bacteria 1045
13 Ga0070709_10642553 3300005434 Bacteria 821
14 Ga0070713_101682498 3300005436 Bacteria 616
15 Ga0070701_10694554 3300005438 Bacteria 684
16 Ga0070711_100098902 3300005439 Bacteria 2119
17 Ga0070705_100325028 3300005440 Bacteria 1112
18 Ga0070694_100813129 3300005444 Bacteria 767
19 Ga0070694_101086141 3300005444 Bacteria 667
20 Ga0070678_100062179 3300005456 Bacteria 2756
21 Ga0070678_100655264 3300005456 Bacteria 942
22 Ga0070685_10020115 3300005466 Bacteria 3611
23 Ga0070684_100620586 3300005535 Bacteria 1006
24 Ga0070684_102202825 3300005535 Bacteria 520
25 Ga0068853_102373633 3300005539 Bacteria 514
26 Ga0070686_100064271 3300005544 Bacteria 2380
27 Ga0070686_101933779 3300005544 Bacteria 504
28 Ga0070696_100780922 3300005546 Bacteria 785
29 Ga0070665_100534704 3300005548 Bacteria 1184
30 Ga0070665_102018998 3300005548 Bacteria 582
31 Ga0070704_100151909 3300005549 Bacteria 1821
32 Ga0070704_101178387 3300005549 Bacteria 698
33 Ga0070704_102148263 3300005549 Bacteria 519
34 Ga0068857_101662167 3300005577 Bacteria 624
35 Ga0068856_101452884 3300005614 Bacteria 700
36 Ga0070702_100441679 3300005615 Bacteria 941
37 Ga0068852_101221821 3300005616 Bacteria 773
38 Ga0068859_100158494 3300005617 Bacteria 2342
39 Ga0068861_100188357 3300005719 Bacteria 1723
40 Ga0068870_10468788 3300005840 Unclassified 833
41 Ga0068863_101534775 3300005841 Unclassified 675
42 Ga0068858_101915588 3300005842 Bacteria 586
43 Ga0068860_101814579 3300005843 Bacteria 632
44 Ga0068862_100357738 3300005844 Bacteria 1356
45 Ga0068862_100621782 3300005844 Bacteria 1039
46 Ga0081455_10005852 3300005937 Bacteria 13378
47 Ga0081455_10016000 3300005937 Bacteria 7258
48 Ga0081455_10039364 3300005937 Bacteria 4179
49 Ga0081455_10157286 3300005937 Bacteria 1745
50 Ga0081455_10319754 3300005937 Bacteria 1106
51 Ga0081538_10001372 3300005981 Bacteria 25077
52 Ga0081538_10059374 3300005981 Bacteria 2209
53 Ga0075365_10241224 3300006038 Bacteria 1269
54 Ga0075365_10420998 3300006038 Bacteria 943
55 Ga0075365_10595474 3300006038 Bacteria 782
56 Ga0075368_10232040 3300006042 Bacteria 786
57 Ga0075363_100036989 3300006048 Bacteria 2562
58 Ga0075363_100420792 3300006048 Bacteria 786
59 Ga0075364_10656599 3300006051 Bacteria 716
60 Ga0075432_10094098 3300006058 Bacteria 1100
61 Ga0075432_10165623 3300006058 Bacteria 857
62 Ga0070716_100553834 3300006173 Bacteria 858
63 Ga0070712_100006258 3300006175 Bacteria 7372
64 Ga0070712_100275292 3300006175 Bacteria 1354
65 Ga0070712_101947412 3300006175 Bacteria 515
66 Ga0075367_10139809 3300006178 Bacteria 1500
67 Ga0075367_10155636 3300006178 Bacteria 1420
68 Ga0075428_100012531 3300006844 Bacteria 9429
69 Ga0075428_100409276 3300006844 Bacteria 1453
70 Ga0075428_100674393 3300006844 Bacteria 1102
71 Ga0075428_102450629 3300006844 Bacteria 535
72 Ga0075428_102733675 3300006844 Bacteria 502
73 Ga0075430_100111195 3300006846 Bacteria 2284
74 Ga0075430_100298328 3300006846 Bacteria 1333
75 Ga0075430_101524011 3300006846 Bacteria 549
76 Ga0075431_100065347 3300006847 Bacteria 3757
77 Ga0075431_100132468 3300006847 Bacteria 2571
78 Ga0075431_100430860 3300006847 Bacteria 1317
79 Ga0075431_101479130 3300006847 Bacteria 638
80 Ga0075433_10102673 3300006852 Bacteria 2533
81 Ga0075433_10115192 3300006852 Bacteria 2385
82 Ga0075433_10186047 3300006852 Bacteria 1848
83 Ga0075433_10334951 3300006852 Bacteria 1338
84 Ga0075434_100044043 3300006871 Bacteria 4427
85 Ga0075434_100092762 3300006871 Bacteria 3022
86 Ga0075434_100095012 3300006871 Bacteria 2986
87 Ga0075434_100138038 3300006871 Bacteria 2457
88 Ga0075434_100334384 3300006871 Bacteria 1535
89 Ga0075429_100374473 3300006880 Unclassified 1246
90 Ga0075429_101240521 3300006880 Bacteria 650
91 Ga0068865_100096779 3300006881 Bacteria 2153
92 Ga0068865_100281536 3300006881 Bacteria 1324
93 Ga0097620_100158496 3300006931 Bacteria 2342
94 Ga0075435_100039251 3300007076 Bacteria 3777
95 Ga0075435_101177534 3300007076 Bacteria 671
96 Ga0075435_101502327 3300007076 Bacteria 591
97 Ga0111539_10004337 3300009094 Bacteria 18563
98 Ga0111539_10013510 3300009094 Bacteria 10205
99 Ga0111539_10050481 3300009094 Bacteria 4956
100 Ga0111539_10073225 3300009094 Bacteria 4039
101 Ga0111539_10186746 3300009094 Bacteria 2420
102 Ga0105245_10010043 3300009098 Bacteria 8246
103 Ga0105245_10287277 3300009098 Bacteria 1610
104 Ga0105245_12521989 3300009098 Bacteria 567
105 Ga0105247_10365177 3300009101 Bacteria 1019
106 Ga0105247_10553640 3300009101 Bacteria 846
107 Ga0114129_10007588 3300009147 Bacteria 15442
108 Ga0114129_10072232 3300009147 Bacteria 4810
109 Ga0114129_10181396 3300009147 Bacteria 2864
110 Ga0114129_10668591 3300009147 Bacteria 1338
111 Ga0114129_10972833 3300009147 Bacteria 1071
112 Ga0105243_10295550 3300009148 Bacteria 1466
113 Ga0105241_10667068 3300009174 Bacteria 946
114 Ga0105242_10057849 3300009176 Bacteria 3177
115 Ga0105242_13024068 3300009176 Unclassified 521
116 Ga0105242_13216592 3300009176 Bacteria 507
117 Ga0105248_11114175 3300009177 Bacteria 892
118 Ga0105238_12287095 3300009551 Bacteria 576
119 Ga0105249_10050832 3300009553 Bacteria 3779
120 Ga0105249_10265786 3300009553 Bacteria 1707
121 Ga0105249_11343327 3300009553 Bacteria 786
122 Ga0105249_12120992 3300009553 Bacteria 635
123 Ga0105249_12632004 3300009553 Bacteria 575
124 Ga0105239_10714359 3300010375 Bacteria 1146
125 Ga0105239_10813448 3300010375 Bacteria 1071
126 Ga0105239_10824951 3300010375 Bacteria 1063
127 Ga0157378_11362928 3300013297 Bacteria 752
128 Ga0163162_11471420 3300013306 Bacteria 776
129 Ga0163162_11711985 3300013306 Bacteria 718
130 Ga0157372_11538247 3300013307 Bacteria 766
131 Ga0157372_12389205 3300013307 Bacteria 607
132 Ga0157372_12939023 3300013307 Bacteria 545
133 Ga0157372_12987640 3300013307 Unclassified 541
134 Ga0157375_10173313 3300013308 Bacteria 2306
135 Ga0163163_10276943 3300014325 Bacteria 1729
136 Ga0163163_12814094 3300014325 Bacteria 543
137 Ga0157380_10614642 3300014326 Bacteria 1078
138 Ga0157377_10388885 3300014745 Bacteria 947
139 Ga0157377_10613517 3300014745 Bacteria 778
140 Ga0157379_10479378 3300014968 Bacteria 1151
141 Ga0157376_11002974 3300014969 Bacteria 857
142 Ga0157376_11685822 3300014969 Bacteria 669
143 Ga0206356_11695945 3300020070 Bacteria 560
144 Ga0213874_10087302 3300021377 Unclassified 1020
145 Ga0213875_10009148 3300021388 Bacteria 5029
146 Ga0207692_10455919 3300025898 Bacteria 805
147 Ga0207710_10177267 3300025900 Bacteria 1044
148 Ga0207680_10325555 3300025903 Bacteria 1075
149 Ga0207699_10026930 3300025906 Bacteria 3176
150 Ga0207643_10146445 3300025908 Bacteria 1413
151 Ga0207654_10697104 3300025911 Bacteria 729
152 Ga0207693_10005335 3300025915 Bacteria 10739
153 Ga0207693_10129684 3300025915 Bacteria 1982
154 Ga0207693_10397037 3300025915 Bacteria 1078
155 Ga0207663_10163610 3300025916 Bacteria 1574
156 Ga0207649_10365068 3300025920 Bacteria 1072
157 Ga0207659_10809714 3300025926 Bacteria 805
158 Ga0207687_10179247 3300025927 Unclassified 1640
159 Ga0207687_10973205 3300025927 Bacteria 727
160 Ga0207644_11566177 3300025931 Bacteria 553
161 Ga0207690_10117993 3300025932 Bacteria 1922
162 Ga0207690_10856511 3300025932 Bacteria 753
163 Ga0207686_10056362 3300025934 Bacteria 2470
164 Ga0207709_10356626 3300025935 Bacteria 1106
165 Ga0207709_10892235 3300025935 Bacteria 722
166 Ga0207669_10131392 3300025937 Bacteria 1721
167 Ga0207669_10585187 3300025937 Bacteria 905
168 Ga0207704_10111014 3300025938 Bacteria 1854
169 Ga0207704_10395167 3300025938 Bacteria 1089
170 Ga0207704_10605416 3300025938 Bacteria 898
171 Ga0207665_11299560 3300025939 Bacteria 580
172 Ga0207691_11249471 3300025940 Bacteria 615
173 Ga0207661_11911626 3300025944 Bacteria 539
174 Ga0207661_11960147 3300025944 Bacteria 531
175 Ga0207679_10218077 3300025945 Bacteria 1604
176 Ga0207651_10229193 3300025960 Bacteria 1507
177 Ga0207712_10513118 3300025961 Bacteria 1026
178 Ga0207712_10524184 3300025961 Bacteria 1016
179 Ga0207712_10999904 3300025961 Bacteria 742
180 Ga0207668_10879765 3300025972 Bacteria 796
181 Ga0207668_11721652 3300025972 Bacteria 566
182 Ga0207677_10274748 3300026023 Bacteria 1380
183 Ga0207703_10273451 3300026035 Bacteria 1531
184 Ga0207639_12299810 3300026041 Bacteria 500
185 Ga0207708_10536669 3300026075 Bacteria 985
186 Ga0207702_10777677 3300026078 Bacteria 946
187 Ga0207702_10790975 3300026078 Bacteria 937
188 Ga0207702_12196037 3300026078 Bacteria 541
189 Ga0207674_11948601 3300026116 Bacteria 553
190 Ga0207675_100632373 3300026118 Bacteria 1075
191 Ga0207675_101839703 3300026118 Bacteria 624
192 Ga0207683_10079904 3300026121 Bacteria 2900
193 Ga0207698_10510297 3300026142 Bacteria 1172
194 Ga0207698_10927668 3300026142 Bacteria 879
195 Ga0207428_10034894 3300027907 Bacteria 4116
196 Ga0207428_10304630 3300027907 Bacteria 1179
197 Ga0207428_10381732 3300027907 Bacteria 1033
198 Ga0268266_11862121 3300028379 Bacteria 576
199 Ga0268265_12666960 3300028380 Bacteria 505
200 Ga0268264_10812754 3300028381 Bacteria 934
201 Ga0307408_100463879 3300031548 Bacteria 1101
202 Ga0265314_10552110 3300031711 Unclassified 599
203 Ga0307405_10324898 3300031731 Bacteria 1177
204 Ga0307413_10054235 3300031824 Bacteria 2431
205 Ga0307413_10062922 3300031824 Bacteria 2298
206 Ga0307413_10170968 3300031824 Bacteria 1538
207 Ga0307413_11005226 3300031824 Bacteria 715
208 Ga0307410_10042479 3300031852 Bacteria 3006
209 Ga0307410_10314193 3300031852 Bacteria 1241
210 Ga0307410_10732939 3300031852 Bacteria 836
211 Ga0307406_10049768 3300031901 Bacteria 2653
212 Ga0307406_10138578 3300031901 Bacteria 1719
213 Ga0307406_10141738 3300031901 Bacteria 1702
214 Ga0307406_10145078 3300031901 Bacteria 1686
215 Ga0307406_10255558 3300031901 Bacteria 1322
216 Ga0307406_10641458 3300031901 Bacteria 880
217 Ga0307406_11001452 3300031901 Bacteria 717
218 Ga0307407_10115097 3300031903 Bacteria 1695
219 Ga0307407_10146662 3300031903 Bacteria 1529
220 Ga0307407_10241818 3300031903 Bacteria 1232
221 Ga0307412_10037049 3300031911 Bacteria 3131
222 Ga0307412_10392729 3300031911 Bacteria 1127
223 Ga0307412_10558230 3300031911 Bacteria 963
224 Ga0307409_100003761 3300031995 Bacteria 8347
225 Ga0307409_100016489 3300031995 Bacteria 4889
226 Ga0307409_100497929 3300031995 Bacteria 1186
227 Ga0307409_100796088 3300031995 Bacteria 952
228 Ga0307409_100959077 3300031995 Bacteria 871
229 Ga0307409_101285014 3300031995 Bacteria 757
230 Ga0307409_101496431 3300031995 Bacteria 702
231 Ga0307409_101718763 3300031995 Bacteria 656
232 Ga0307409_101729577 3300031995 Bacteria 654
233 Ga0307409_101929964 3300031995 Bacteria 620
234 Ga0307416_100034074 3300032002 Bacteria 3870
235 Ga0307416_100165824 3300032002 Bacteria 2049
236 Ga0307416_100331051 3300032002 Bacteria 1530
237 Ga0307416_101178527 3300032002 Bacteria 871
238 Ga0307416_101657283 3300032002 Bacteria 744
239 Ga0307416_101711227 3300032002 Bacteria 733
240 Ga0307416_102246350 3300032002 Bacteria 646
241 Ga0307416_103650611 3300032002 Bacteria 515
242 Ga0307414_10152431 3300032004 Bacteria 1825
243 Ga0307414_10201561 3300032004 Bacteria 1619
244 Ga0307414_11283250 3300032004 Bacteria 679
245 Ga0307411_10142812 3300032005 Bacteria 1767
246 Ga0307411_10273741 3300032005 Bacteria 1340
247 Ga0307411_11855927 3300032005 Bacteria 560
248 Ga0307415_100006345 3300032126 Bacteria 6366
249 Ga0307415_100184995 3300032126 Bacteria 1638
250 Ga0307415_100212942 3300032126 Bacteria 1543
251 Ga0307415_100260655 3300032126 Bacteria 1414
252 Ga0307415_100601065 3300032126 Bacteria 979
253 Ga0307415_100670701 3300032126 Bacteria 932
254 Ga0373946_0515170 3300035171 Unclassified 615
255 Ga0373924_0402565 3300035410 Bacteria 612
256 Ga0373931_0363419 3300035691 Bacteria 909
257 Ga0373935_0722999 3300035692 Unclassified 733
258 Ga0373935_1113015 3300035692 Unclassified 588
259 Ga0373933_0471162 3300035724 Bacteria 822
260 Ga0373947_0095228 3300035725 Bacteria 1863
261 Ga0373947_0492193 3300035725 Bacteria 833
262 Ga0373937_0023500 3300036401 Bacteria 5551
263 Ga0373925_0349327 3300037068 Bacteria 1201
264 Ga0395899_0418696 3300037312 Bacteria 883
265 Ga0395900_0935877 3300037418 Bacteria 789
266 Ga0395898_0078234 3300037466 Bacteria 3191
267 Ga0395898_0306542 3300037466 Bacteria 1515
268 Ga0395898_1008106 3300037466 Bacteria 768
269 Ga0395898_1139461 3300037466 Bacteria 712
270 Ga0395898_1601145 3300037466 Bacteria 576
271 Ga0395905_0827618 3300037471 Bacteria 829
272 Ga0436364_0282503 3300037853 Unclassified 626
273 Ga0436364_0977091 3300037853 Bacteria 3519
274 Ga0436364_1180097 3300037853 Bacteria 39008
275 Ga0395901_0008107 3300038443 Bacteria 10610
276 Ga0395901_0317391 3300038443 Bacteria 1613
277 Ga0395901_0320530 3300038443 Bacteria 1604
278 Ga0395901_0421344 3300038443 Bacteria 1369
279 Ga0395901_0708095 3300038443 Bacteria 1004
280 Ga0395901_0778848 3300038443 Bacteria 947
281 Ga0395901_1416441 3300038443 Bacteria 653
282 Ga0395901_1551111 3300038443 Bacteria 617
283 Ga0436365_0777355 3300039437 Bacteria 3794
284 Ga0436363_0013940 3300039450 Bacteria 720
285 Ga0436363_0518964 3300039450 Unclassified 536
286 Ga0436363_0527959 3300039450 Bacteria 2635
287 Ga0436363_0679003 3300039450 Bacteria 607
288 Ga0436363_0759473 3300039450 Unclassified 794
289 Ga0436363_0777673 3300039450 Bacteria 753
290 Ga0436363_0839357 3300039450 Bacteria 888
291 Ga0436363_1646946 3300039450 Unclassified 1851
292 Ga0436363_1651530 3300039450 Bacteria 1248
293 Ga0436362_0992121 3300039453 Bacteria 837
294 Ga0451787_350778 3300041441 Bacteria 620
295 Ga0451847_0091346 3300041503 Bacteria 541
296 Ga0451849_1303547 3300041505 Bacteria 511
297 Ga0451853_0022222 3300041512 Bacteria 623
298 Ga0451853_1720258 3300041512 Bacteria 680
299 Ga0451853_1917173 3300041512 Bacteria 1015
300 Ga0451853_3914635 3300041512 Bacteria 658
301 Ga0439458_0066187 3300042157 Bacteria 908
302 Ga0439459_0033558 3300042438 Bacteria 1058
303 Ga0466966_0128886 3300044684 Bacteria 1550
304 Ga0495603_0240290 3300046455 Bacteria 1043
305 Ga0495590_0119610 3300046457 Bacteria 944
306 Ga0495591_124059 3300046458 Bacteria 629
307 Ga0495629_0216256 3300046459 Bacteria 1323
308 Ga0495651_0016424 3300046462 Bacteria 5733
309 Ga0495651_0566110 3300046462 Bacteria 720
310 Ga0495653_0140648 3300046463 Bacteria 1698
311 Ga0495580_0868677 3300046472 Bacteria 581
312 Ga0495582_0060049 3300046473 Bacteria 2098
313 Ga0495582_0090283 3300046473 Bacteria 1708
314 Ga0495662_0285772 3300046476 Bacteria 812
315 Ga0495664_0624721 3300046477 Bacteria 639
316 Ga0495664_0772509 3300046477 Bacteria 566
317 Ga0495584_0493276 3300046491 Bacteria 624
318 Ga0495596_0121191 3300046500 Bacteria 1015
319 Ga0495596_0382059 3300046500 Bacteria 549
320 Ga0495608_0069066 3300046511 Bacteria 2309
321 Ga0495616_0207775 3300046513 Bacteria 858
322 Ga0495628_0317390 3300046516 Bacteria 1150
323 Ga0495628_0537370 3300046516 Bacteria 841
324 Ga0495628_1048387 3300046516 Unclassified 559
325 Ga0495631_0242790 3300046518 Unclassified 768
326 Ga0495631_0390267 3300046518 Bacteria 593
327 Ga0495652_0186223 3300046529 Bacteria 1588
328 Ga0495621_0544707 3300046539 Bacteria 504
329 Ga0495645_0486003 3300046543 Bacteria 774
330 Ga0495667_0016533 3300046559 Bacteria 4983
331 Ga0495656_0065042 3300046615 Bacteria 1603
332 Ga0495656_0548696 3300046615 Bacteria 616
333 Ga0495656_0747952 3300046615 Bacteria 527
334 Ga0495668_0533799 3300046616 Bacteria 647
335 Ga0495634_0012693 3300046642 Bacteria 6098
336 Ga0495635_0653143 3300046663 Bacteria 684
337 Ga0495657_0002352 3300046675 Bacteria 15904
338 Ga0495599_0557637 3300046678 Bacteria 670
339 Ga0495599_0648800 3300046678 Bacteria 612
340 Ga0495646_0463283 3300046680 Bacteria 654
341 Ga0495658_0343608 3300046683 Bacteria 948
342 Ga0495669_0006531 3300046684 Bacteria 4876
343 Ga0495624_0131504 3300046690 Unclassified 1534
344 Ga0495670_0145422 3300046691 Unclassified 1242
345 Ga0495671_0277965 3300046692 Bacteria 807
346 Ga0495589_0197992 3300046794 Unclassified 949
347 Ga0495604_0097133 3300047317 Bacteria 2173
348 Ga0495676_0393144 3300047321 Bacteria 921
349 Ga0495675_0111983 3300047444 Bacteria 1703
350 Ga0495602_0218639 3300048088 Bacteria 1440
351 Ga0495602_0439477 3300048088 Bacteria 923
352 Ga0495614_0300650 3300048089 Bacteria 742
353 Ga0496101_0005696 3300048904 Bacteria 7952
354 Ga0496101_0822092 3300048904 Bacteria 732
355 Ga0496101_1177475 3300048904 Bacteria 601
356 Ga0496102_0006453 3300048905 Bacteria 10002
357 Ga0496103_0010371 3300048906 Bacteria 5513
358 Ga0496104_0100385 3300048907 Bacteria 2770
359 Ga0496106_0003943 3300048909 Bacteria 11084
360 Ga0496106_0783453 3300048909 Bacteria 757
361 Ga0496107_0000328 3300048910 Bacteria 25679
362 Ga0496107_0188918 3300048910 Bacteria 1530
363 Ga0496108_0018389 3300048911 Bacteria 5722
364 Ga0496108_1026416 3300048911 Bacteria 703
365 Ga0496109_0013295 3300048912 Bacteria 7131
366 Ga0496109_0348576 3300048912 Bacteria 1399
367 Ga0496109_0364810 3300048912 Bacteria 1364
368 Ga0496109_0561178 3300048912 Bacteria 1077
369 Ga0496110_0013022 3300048913 Bacteria 6861
370 Ga0496111_0033577 3300048914 Bacteria 3660
371 Ga0496111_0589993 3300048914 Bacteria 814
372 Ga0496111_0898948 3300048914 Bacteria 638
373 Ga0496112_0024654 3300048915 Bacteria 5765
374 Ga0496112_0244269 3300048915 Bacteria 1747
375 Ga0496112_0496594 3300048915 Bacteria 1156
376 Ga0496112_1424814 3300048915 Bacteria 607
377 Ga0496113_0010476 3300048916 Bacteria 6128
378 Ga0496113_0015103 3300048916 Bacteria 5293
379 Ga0496113_0111743 3300048916 Bacteria 2128
380 Ga0496113_1079757 3300048916 Bacteria 630
381 Ga0496114_0004052 3300048917 Bacteria 11318
382 Ga0496114_0193138 3300048917 Bacteria 1782
383 Ga0496114_0878321 3300048917 Bacteria 777
384 Ga0496115_0002819 3300048918 Bacteria 12497
385 Ga0496121_0576529 3300048924 Bacteria 699
386 Ga0501067_0254283 3300049583 Bacteria 978
387 Ga0501068_0216533 3300049584 Bacteria 1217
388 Ga0501249_135465 3300049679 Bacteria 610
389 Ga0501221_222301 3300049704 Bacteria 533
390 Ga0501225_0217397 3300049705 Unclassified 614
391 nmdc:mga03n38_35018_c1 3300050490 Bacteria 2148
392 nmdc:mga0yw44_1229196_c1 3300050492 Unclassified 505
393 nmdc:mga0yw44_307593_c1 3300050492 Bacteria 1063
394 nmdc:mga0yw44_915871_c1 3300050492 Bacteria 594
395 nmdc:mga0yw44_997555_c1 3300050492 Bacteria 567
396 nmdc:mga06z11_115721_c1 3300050494 Bacteria 1199
397 nmdc:mga06z11_416081_c1 3300050494 Unclassified 810
398 nmdc:mga06z11_765069_c1 3300050494 Bacteria 588
399 nmdc:mga05p37_1594085_c1 3300050507 Unclassified 644
400 nmdc:mga05p37_256142_c1 3300050507 Bacteria 2097
401 nmdc:mga05p37_298891_c1 3300050507 Bacteria 1914
402 nmdc:mga05p37_831356_c1 3300050507 Bacteria 1006
403 nmdc:mga09592_360735_c1 3300050508 Bacteria 1258
404 nmdc:mga0qj67_1497479_c1 3300050509 Bacteria 519
405 nmdc:mga0qj67_16890_c1 3300050509 Bacteria 5544
406 nmdc:mga0qj67_287364_c1 3300050509 Bacteria 1333
407 nmdc:mga06r32_1147373_c1 3300050510 Bacteria 725
408 nmdc:mga06r32_149422_c1 3300050510 Bacteria 2314
409 nmdc:mga06r32_246601_c1 3300050510 Bacteria 1774
410 nmdc:mga06r32_31737_c1 3300050510 Bacteria 4965
411 nmdc:mga06r32_512085_c1 3300050510 Bacteria 1176
412 nmdc:mga06r32_667011_c1 3300050510 Bacteria 1007
413 nmdc:mga08y16_1344360_c1 3300050511 Bacteria 680
414 nmdc:mga08y16_1485358_c1 3300050511 Bacteria 639
415 nmdc:mga08y16_180772_c1 3300050511 Bacteria 2190
416 nmdc:mga08y16_44682_c1 3300050511 Bacteria 4642
417 nmdc:mga0n895_112221_c1 3300050512 Bacteria 2743
418 nmdc:mga0n895_197331_c1 3300050512 Bacteria 2044
419 nmdc:mga0n895_96452_c1 3300050512 Bacteria 2962
420 nmdc:mga0rr50_1171821_c1 3300050513 Bacteria 653
421 nmdc:mga0rr50_298274_c1 3300050513 Bacteria 1348
422 nmdc:mga08x19_481359_c1 3300050514 Bacteria 875
423 nmdc:mga08x19_796802_c1 3300050514 Bacteria 671
424 nmdc:mga0a205_220472_c1 3300050515 Bacteria 1782
425 Ga0495601_0653248 3300053077 Bacteria 673
426 Ga0495612_0000022 3300053078 Bacteria 119126
427 Ga0495612_0182909 3300053078 Bacteria 921
428 Ga0495595_0025786 3300053084 Bacteria 2607
429 Ga0495595_0174093 3300053084 Bacteria 1066
430 Ga0495619_0091840 3300053085 Bacteria 2056
431 Ga0587070_079121 3300059491 Bacteria 717
432 Ga0587080_079070 3300059503 Bacteria 672
433 Ga0501082_1813191 3300060353 Bacteria 532
434 Ga0530510_1488468 3300061734 Bacteria 520
435 Ga0495647_0179570
436 JGI25407J50210_10079752
437 Ga0070666_10692897
438 Ga0068868_100330493
439 Ga0070661_100778162
440 Ga0070668_100094860
441 Ga0070674_100068036
442 Ga0070674_100239305
443 Ga0070673_100775603
444 Ga0070688_100219479
445 Ga0070659_100437207
446 Ga0070667_100566268
447 Ga0070709_10642553
448 Ga0070713_101682498
449 Ga0070701_10694554
450 Ga0070711_100098902
451 Ga0070705_100325028
452 Ga0070694_100813129
453 Ga0070694_101086141
454 Ga0070678_100062179
455 Ga0070678_100655264
456 Ga0070685_10020115
457 Ga0070684_100620586
458 Ga0070684_102202825
459 Ga0068853_102373633
460 Ga0070686_100064271
461 Ga0070686_101933779
462 Ga0070696_100780922
463 Ga0070665_100534704
464 Ga0070665_102018998
465 Ga0070704_100151909
466 Ga0070704_101178387
467 Ga0070704_102148263
468 Ga0068857_101662167
469 Ga0068856_101452884
470 Ga0070702_100441679
471 Ga0068852_101221821
472 Ga0068859_100158494
473 Ga0068861_100188357
474 Ga0068870_10468788
475 Ga0068863_101534775
476 Ga0068858_101915588
477 Ga0068860_101814579
478 Ga0068862_100357738
479 Ga0068862_100621782
480 Ga0081455_10005852
481 Ga0081455_10016000
482 Ga0081455_10039364
483 Ga0081455_10157286
484 Ga0081455_10319754
485 Ga0081538_10001372
486 Ga0081538_10059374
487 Ga0075365_10241224
488 Ga0075365_10420998
489 Ga0075365_10595474
490 Ga0075368_10232040
491 Ga0075363_100036989
492 Ga0075363_100420792
493 Ga0075364_10656599
494 Ga0075432_10094098
495 Ga0075432_10165623
496 Ga0070716_100553834
497 Ga0070712_100006258
498 Ga0070712_100275292
499 Ga0070712_101947412
500 Ga0075367_10139809
501 Ga0075367_10155636
502 Ga0075428_100012531
503 Ga0075428_100409276
504 Ga0075428_100674393
505 Ga0075428_102450629
506 Ga0075428_102733675
507 Ga0075430_100111195
508 Ga0075430_100298328
509 Ga0075430_101524011
510 Ga0075431_100065347
511 Ga0075431_100132468
512 Ga0075431_100430860
513 Ga0075431_101479130
514 Ga0075433_10102673
515 Ga0075433_10115192
516 Ga0075433_10186047
517 Ga0075433_10334951
518 Ga0075434_100044043
519 Ga0075434_100092762
520 Ga0075434_100095012
521 Ga0075434_100138038
522 Ga0075434_100334384
523 Ga0075429_100374473
524 Ga0075429_101240521
525 Ga0068865_100096779
526 Ga0068865_100281536
527 Ga0097620_100158496
528 Ga0075435_100039251
529 Ga0075435_101177534
530 Ga0075435_101502327
531 Ga0111539_10004337
532 Ga0111539_10013510
533 Ga0111539_10050481
534 Ga0111539_10073225
535 Ga0111539_10186746
536 Ga0105245_10010043
537 Ga0105245_10287277
538 Ga0105245_12521989
539 Ga0105247_10365177
540 Ga0105247_10553640
541 Ga0114129_10007588
542 Ga0114129_10072232
543 Ga0114129_10181396
544 Ga0114129_10668591
545 Ga0114129_10972833
546 Ga0105243_10295550
547 Ga0105241_10667068
548 Ga0105242_10057849
549 Ga0105242_13024068
550 Ga0105242_13216592
551 Ga0105248_11114175
552 Ga0105238_12287095
553 Ga0105249_10050832
554 Ga0105249_10265786
555 Ga0105249_11343327
556 Ga0105249_12120992
557 Ga0105249_12632004
558 Ga0105239_10714359
559 Ga0105239_10813448
560 Ga0105239_10824951
561 Ga0157378_11362928
562 Ga0163162_11471420
563 Ga0163162_11711985
564 Ga0157372_11538247
565 Ga0157372_12389205
566 Ga0157372_12939023
567 Ga0157372_12987640
568 Ga0157375_10173313
569 Ga0163163_10276943
570 Ga0163163_12814094
571 Ga0157380_10614642
572 Ga0157377_10388885
573 Ga0157377_10613517
574 Ga0157379_10479378
575 Ga0157376_11002974
576 Ga0157376_11685822
577 Ga0206356_11695945
578 Ga0213874_10087302
579 Ga0213875_10009148
580 Ga0207692_10455919
581 Ga0207710_10177267
582 Ga0207680_10325555
583 Ga0207699_10026930
584 Ga0207643_10146445
585 Ga0207654_10697104
586 Ga0207693_10005335
587 Ga0207693_10129684
588 Ga0207693_10397037
589 Ga0207663_10163610
590 Ga0207649_10365068
591 Ga0207659_10809714
592 Ga0207687_10179247
593 Ga0207687_10973205
594 Ga0207644_11566177
595 Ga0207690_10117993
596 Ga0207690_10856511
597 Ga0207686_10056362
598 Ga0207709_10356626
599 Ga0207709_10892235
600 Ga0207669_10131392
601 Ga0207669_10585187
602 Ga0207704_10111014
603 Ga0207704_10395167
604 Ga0207704_10605416
605 Ga0207665_11299560
606 Ga0207691_11249471
607 Ga0207661_11911626
608 Ga0207661_11960147
609 Ga0207679_10218077
610 Ga0207651_10229193
611 Ga0207712_10513118
612 Ga0207712_10524184
613 Ga0207712_10999904
614 Ga0207668_10879765
615 Ga0207668_11721652
616 Ga0207677_10274748
617 Ga0207703_10273451
618 Ga0207639_12299810
619 Ga0207708_10536669
620 Ga0207702_10777677
621 Ga0207702_10790975
622 Ga0207702_12196037
623 Ga0207674_11948601
624 Ga0207675_100632373
625 Ga0207675_101839703
626 Ga0207683_10079904
627 Ga0207698_10510297
628 Ga0207698_10927668
629 Ga0207428_10034894
630 Ga0207428_10304630
631 Ga0207428_10381732
632 Ga0268266_11862121
633 Ga0268265_12666960
634 Ga0268264_10812754
635 Ga0307408_100463879
636 Ga0265314_10552110
637 Ga0307405_10324898
638 Ga0307413_10054235
639 Ga0307413_10062922
640 Ga0307413_10170968
641 Ga0307413_11005226
642 Ga0307410_10042479
643 Ga0307410_10314193
644 Ga0307410_10732939
645 Ga0307406_10049768
646 Ga0307406_10138578
647 Ga0307406_10141738
648 Ga0307406_10145078
649 Ga0307406_10255558
650 Ga0307406_10641458
651 Ga0307406_11001452
652 Ga0307407_10115097
653 Ga0307407_10146662
654 Ga0307407_10241818
655 Ga0307412_10037049
656 Ga0307412_10392729
657 Ga0307412_10558230
658 Ga0307409_100003761
659 Ga0307409_100016489
660 Ga0307409_100497929
661 Ga0307409_100796088
662 Ga0307409_100959077
663 Ga0307409_101285014
664 Ga0307409_101496431
665 Ga0307409_101718763
666 Ga0307409_101729577
667 Ga0307409_101929964
668 Ga0307416_100034074
669 Ga0307416_100165824
670 Ga0307416_100331051
671 Ga0307416_101178527
672 Ga0307416_101657283
673 Ga0307416_101711227
674 Ga0307416_102246350
675 Ga0307416_103650611
676 Ga0307414_10152431
677 Ga0307414_10201561
678 Ga0307414_11283250
679 Ga0307411_10142812
680 Ga0307411_10273741
681 Ga0307411_11855927
682 Ga0307415_100006345
683 Ga0307415_100184995
684 Ga0307415_100212942
685 Ga0307415_100260655
686 Ga0307415_100601065
687 Ga0307415_100670701
688 Ga0373946_0515170
689 Ga0373924_0402565
690 Ga0373931_0363419
691 Ga0373935_0722999
692 Ga0373935_1113015
693 Ga0373933_0471162
694 Ga0373947_0095228
695 Ga0373947_0492193
696 Ga0373937_0023500
697 Ga0373925_0349327
698 Ga0395899_0418696
699 Ga0395900_0935877
700 Ga0395898_0078234
701 Ga0395898_0306542
702 Ga0395898_1008106
703 Ga0395898_1139461
704 Ga0395898_1601145
705 Ga0395905_0827618
706 Ga0436364_0282503
707 Ga0436364_0977091
708 Ga0436364_1180097
709 Ga0395901_0008107
710 Ga0395901_0317391
711 Ga0395901_0320530
712 Ga0395901_0421344
713 Ga0395901_0708095
714 Ga0395901_0778848
715 Ga0395901_1416441
716 Ga0395901_1551111
717 Ga0436365_0777355
718 Ga0436363_0013940
719 Ga0436363_0518964
720 Ga0436363_0527959
721 Ga0436363_0679003
722 Ga0436363_0759473
723 Ga0436363_0777673
724 Ga0436363_0839357
725 Ga0436363_1646946
726 Ga0436363_1651530
727 Ga0436362_0992121
728 Ga0451787_350778
729 Ga0451847_0091346
730 Ga0451849_1303547
731 Ga0451853_0022222
732 Ga0451853_1720258
733 Ga0451853_1917173
734 Ga0451853_3914635
735 Ga0439458_0066187
736 Ga0439459_0033558
737 Ga0466966_0128886
738 Ga0495603_0240290
739 Ga0495590_0119610
740 Ga0495591_124059
741 Ga0495629_0216256
742 Ga0495651_0016424
743 Ga0495651_0566110
744 Ga0495653_0140648
745 Ga0495580_0868677
746 Ga0495582_0060049
747 Ga0495582_0090283
748 Ga0495662_0285772
749 Ga0495664_0624721
750 Ga0495664_0772509
751 Ga0495584_0493276
752 Ga0495596_0121191
753 Ga0495596_0382059
754 Ga0495608_0069066
755 Ga0495616_0207775
756 Ga0495628_0317390
757 Ga0495628_0537370
758 Ga0495628_1048387
759 Ga0495631_0242790
760 Ga0495631_0390267
761 Ga0495652_0186223
762 Ga0495621_0544707
763 Ga0495645_0486003
764 Ga0495667_0016533
765 Ga0495656_0065042
766 Ga0495656_0548696
767 Ga0495656_0747952
768 Ga0495668_0533799
769 Ga0495634_0012693
770 Ga0495635_0653143
771 Ga0495657_0002352
772 Ga0495599_0557637
773 Ga0495599_0648800
774 Ga0495646_0463283
775 Ga0495658_0343608
776 Ga0495669_0006531
777 Ga0495624_0131504
778 Ga0495670_0145422
779 Ga0495671_0277965
780 Ga0495589_0197992
781 Ga0495604_0097133
782 Ga0495676_0393144
783 Ga0495675_0111983
784 Ga0495602_0218639
785 Ga0495602_0439477
786 Ga0495614_0300650
787 Ga0496101_0005696
788 Ga0496101_0822092
789 Ga0496101_1177475
790 Ga0496102_0006453
791 Ga0496103_0010371
792 Ga0496104_0100385
793 Ga0496106_0003943
794 Ga0496106_0783453
795 Ga0496107_0000328
796 Ga0496107_0188918
797 Ga0496108_0018389
798 Ga0496108_1026416
799 Ga0496109_0013295
800 Ga0496109_0348576
801 Ga0496109_0364810
802 Ga0496109_0561178
803 Ga0496110_0013022
804 Ga0496111_0033577
805 Ga0496111_0589993
806 Ga0496111_0898948
807 Ga0496112_0024654
808 Ga0496112_0244269
809 Ga0496112_0496594
810 Ga0496112_1424814
811 Ga0496113_0010476
812 Ga0496113_0015103
813 Ga0496113_0111743
814 Ga0496113_1079757
815 Ga0496114_0004052
816 Ga0496114_0193138
817 Ga0496114_0878321
818 Ga0496115_0002819
819 Ga0496121_0576529
820 Ga0501067_0254283
821 Ga0501068_0216533
822 Ga0501249_135465
823 Ga0501221_222301
824 Ga0501225_0217397
825 nmdc:mga03n38_35018_c1
826 nmdc:mga0yw44_1229196_c1
827 nmdc:mga0yw44_307593_c1
828 nmdc:mga0yw44_915871_c1
829 nmdc:mga0yw44_997555_c1
830 nmdc:mga06z11_115721_c1
831 nmdc:mga06z11_416081_c1
832 nmdc:mga06z11_765069_c1
833 nmdc:mga05p37_1594085_c1
834 nmdc:mga05p37_256142_c1
835 nmdc:mga05p37_298891_c1
836 nmdc:mga05p37_831356_c1
837 nmdc:mga09592_360735_c1
838 nmdc:mga0qj67_1497479_c1
839 nmdc:mga0qj67_16890_c1
840 nmdc:mga0qj67_287364_c1
841 nmdc:mga06r32_1147373_c1
842 nmdc:mga06r32_149422_c1
843 nmdc:mga06r32_246601_c1
844 nmdc:mga06r32_31737_c1
845 nmdc:mga06r32_512085_c1
846 nmdc:mga06r32_667011_c1
847 nmdc:mga08y16_1344360_c1
848 nmdc:mga08y16_1485358_c1
849 nmdc:mga08y16_180772_c1
850 nmdc:mga08y16_44682_c1
851 nmdc:mga0n895_112221_c1
852 nmdc:mga0n895_197331_c1
853 nmdc:mga0n895_96452_c1
854 nmdc:mga0rr50_1171821_c1
855 nmdc:mga0rr50_298274_c1
856 nmdc:mga08x19_481359_c1
857 nmdc:mga08x19_796802_c1
858 nmdc:mga0a205_220472_c1
859 Ga0495601_0653248
860 Ga0495612_0000022
861 Ga0495612_0182909
862 Ga0495595_0025786
863 Ga0495595_0174093
864 Ga0495619_0091840
865 Ga0587070_079121
866 Ga0587080_079070
867 Ga0501082_1813191
868 Ga0530510_1488468

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i5b-assembly2.cif.gz_D the crystal structure of an adp complex of bacillus subtilis pyridoxal kinase provides evidence for the parralel emergence of enzyme activity during evolution 0.9732 32 57
2i5b-assembly1.cif.gz_B the crystal structure of an adp complex of bacillus subtilis pyridoxal kinase provides evidence for the parralel emergence of enzyme activity during evolution 0.9707 32 57
1un8-assembly1.cif.gz_B crystal structure of the dihydroxyacetone kinase of c. freundii (native form) 0.9051 29 62
4o0g-assembly1.cif.gz_A crystal structure of the human l-asparaginase protein t219v mutant 0.8966 32 63
4pvq-assembly1.cif.gz_B crystal structure of sulfate-bound human l-asparaginase protein 0.8951 35 63
ID Description Score Start End Superfamily
af_Q9VDR4_479_718_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9781 31 58 3.40.50.300
af_Q06490_24_336_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9739 29 56 3.40.1190.20
af_C4J0B8_48_219_1.10.238.10 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;EF-hand 0.9737 35 55 1.10.238.10
af_O94265_1_284_3.40.1190.20 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9735 29 56 3.40.1190.20
2i5bB00 Alpha Beta;3-Layer(aba) Sandwich;UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase;Ribokinase 0.9707 32 57 3.40.1190.20
ID Description Score Start End GO Terms
AF-A0A2V5TY32-F1-model_v4 Bleomycin resistance protein 1.002 2 57
AF-A0A317IX59-F1-model_v4 Glyoxalase 0.9961 1 68
AF-A0A2V6B5A9-F1-model_v4 Bleomycin resistance protein 0.9819 1 66
AF-A0A317IX59-F1-model_v4 Glyoxalase 0.9817 1 68
AF-A0A534TD83-F1-model_v4 Glyoxalase 0.9724 1 61

Map