F443108

General Info

Members Datasets Scaffolds Average Seq Length
434 307 868 240

Family's Representative Sequence

Representative Sequence 3300025921|Ga0207652_10371932|Ga0207652_103719322
Length 281
Sequence VTLVLLPAVDVADGQAVRLVQGAAGSETAYGDPLEAALAWQNDGAEWVHLVDLDAAFGRGSNAELLAGVVGRLDVKVELSGGIRDDESLTRALATGAARVNIGTAALEDPQWCDRIAAEYGDRVAIGLDVRGRTLAARGWTKDGGDLYEVLARLDKAGAARYVVTDITKDGTMRGPNLDLLREVCAATDKPVIASGGVSTLDDLRALATLEPVGVEAPGGAGHAAAAGPTPTGRGAWDRRRRCGPLVRRRRTARDARSGPRWRGSRRLRACAATGSSSRSR

Samples

Sample ID Description Type Environment
1 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
132 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
133 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
134 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
145 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
159 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
162 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
165 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
166 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
180 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
181 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
182 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
183 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
208 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
209 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
210 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
218 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
219 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
220 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
259 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
260 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
261 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
262 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
263 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
264 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
265 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
266 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 2501939600 Micromonospora sp. L5 Isolate Unclassified
270 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
271 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
272 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
273 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
274 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
275 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
276 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
277 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
278 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
279 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
280 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
281 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
282 2855683550 Micromonospora sp. RP3T Isolate Unclassified
283 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
284 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
285 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
286 2858868258 Micromonospora sp. MH33 Isolate Unclassified
287 2858882152 Micromonospora noduli MED15 Isolate Nodule
288 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
289 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
290 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
291 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
292 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
293 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
294 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
295 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
296 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
297 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
298 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
299 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
300 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
301 2902582711 Micromonospora sp. AP08 Isolate Unclassified
302 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
303 649633069 Micromonospora sp. L5 Isolate Unclassified
304 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
305 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
306 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
307 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.01
Metatranscriptomes 0
Isolates 8.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.07
Nodule 1.15
Rhizoplane 5.53
Rhizosphere 80.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207652_10371932 3300025921 Bacteria 1290
2 JGI24738J21930_10023691 3300002075 Bacteria 1264
3 JGI25406J46586_10017186 3300003203 Bacteria 2996
4 JGI25406J46586_10070484 3300003203 Bacteria 1098
5 Ga0070676_10297501 3300005328 Bacteria 1093
6 Ga0070690_100346514 3300005330 Bacteria 1077
7 Ga0068869_100151732 3300005334 Bacteria 1797
8 Ga0070666_10014264 3300005335 Bacteria 5058
9 Ga0070682_100035284 3300005337 Bacteria 3052
10 Ga0068868_100036194 3300005338 Bacteria 3819
11 Ga0070689_100304583 3300005340 Bacteria 1327
12 Ga0070691_10043008 3300005341 Bacteria 2139
13 Ga0070687_100013219 3300005343 Bacteria 3671
14 Ga0070692_10017283 3300005345 Bacteria 3445
15 Ga0070668_100009783 3300005347 Bacteria 7107
16 Ga0070668_100032838 3300005347 Bacteria 3950
17 Ga0070668_100102640 3300005347 Bacteria 2267
18 Ga0070688_100127125 3300005365 Bacteria 1715
19 Ga0070709_10012583 3300005434 Bacteria 4738
20 Ga0070709_10017800 3300005434 Bacteria 4083
21 Ga0070709_10083473 3300005434 Bacteria 2090
22 Ga0070714_100008849 3300005435 Bacteria 7873
23 Ga0070714_100012596 3300005435 Bacteria 6753
24 Ga0070714_100053428 3300005435 Bacteria 3448
25 Ga0070714_100297854 3300005435 Bacteria 1503
26 Ga0070714_100569885 3300005435 Bacteria 1085
27 Ga0070713_100175404 3300005436 Bacteria 1923
28 Ga0070713_100213895 3300005436 Bacteria 1746
29 Ga0070713_100258040 3300005436 Bacteria 1592
30 Ga0070713_100712603 3300005436 Bacteria 958
31 Ga0070710_10000156 3300005437 Bacteria 31483
32 Ga0070710_10063879 3300005437 Bacteria 2104
33 Ga0070711_100001013 3300005439 Bacteria 14930
34 Ga0070694_100014480 3300005444 Bacteria 4938
35 Ga0070694_100358644 3300005444 Bacteria 1131
36 Ga0070708_100024575 3300005445 Bacteria 5142
37 Ga0070708_100173046 3300005445 Bacteria 2016
38 Ga0070708_100245680 3300005445 Bacteria 1681
39 Ga0070663_100017694 3300005455 Bacteria 4656
40 Ga0070678_100014415 3300005456 Bacteria 4988
41 Ga0070662_100141302 3300005457 Bacteria 1866
42 Ga0070698_100000534 3300005471 Bacteria 40564
43 Ga0070698_100072830 3300005471 Bacteria 3443
44 Ga0070699_100093889 3300005518 Bacteria 2626
45 Ga0070679_100360159 3300005530 Bacteria 1402
46 Ga0070684_100527538 3300005535 Bacteria 1095
47 Ga0070697_100028376 3300005536 Bacteria 4481
48 Ga0068853_100016620 3300005539 Bacteria 6059
49 Ga0068853_101042391 3300005539 Bacteria 788
50 Ga0070686_100024998 3300005544 Bacteria 3586
51 Ga0070695_100015524 3300005545 Bacteria 4600
52 Ga0070696_100011867 3300005546 Bacteria 5840
53 Ga0070693_100030089 3300005547 Bacteria 2966
54 Ga0070665_100868676 3300005548 Bacteria 915
55 Ga0068855_100115406 3300005563 Bacteria 3079
56 Ga0070664_100128337 3300005564 Bacteria 2226
57 Ga0068854_100030025 3300005578 Bacteria 3767
58 Ga0068856_100049862 3300005614 Bacteria 4127
59 Ga0068856_100155284 3300005614 Bacteria 2298
60 Ga0068852_100288810 3300005616 Bacteria 1584
61 Ga0068859_100105405 3300005617 Bacteria 2878
62 Ga0068859_100136107 3300005617 Bacteria 2529
63 Ga0068864_100313429 3300005618 Bacteria 1471
64 Ga0068861_100035313 3300005719 Bacteria 3702
65 Ga0068851_10082912 3300005834 Bacteria 1677
66 Ga0068863_100096186 3300005841 Bacteria 2811
67 Ga0068863_100220382 3300005841 Bacteria 1828
68 Ga0068858_100022912 3300005842 Bacteria 5825
69 Ga0068858_100075523 3300005842 Bacteria 3130
70 Ga0068860_100051707 3300005843 Bacteria 3908
71 Ga0068862_100051495 3300005844 Bacteria 3522
72 Ga0068862_100062137 3300005844 Bacteria 3212
73 Ga0081540_1002028 3300005983 Bacteria 16895
74 Ga0081539_10000385 3300005985 Bacteria 95511
75 Ga0081539_10000406 3300005985 Bacteria 91786
76 Ga0081539_10001654 3300005985 Bacteria 36124
77 Ga0081539_10004523 3300005985 Bacteria 15270
78 Ga0070717_10056851 3300006028 Bacteria 3233
79 Ga0070717_10118311 3300006028 Bacteria 2267
80 Ga0070717_10133859 3300006028 Bacteria 2133
81 Ga0070717_10473048 3300006028 Bacteria 1131
82 Ga0070715_10126712 3300006163 Bacteria 1224
83 Ga0070715_10221569 3300006163 Bacteria 973
84 Ga0070716_100012132 3300006173 Bacteria 4359
85 Ga0070716_100020657 3300006173 Bacteria 3460
86 Ga0070712_100004605 3300006175 Bacteria 8519
87 Ga0070712_100100339 3300006175 Bacteria 2139
88 Ga0070712_100145531 3300006175 Bacteria 1813
89 Ga0097621_100024019 3300006237 Bacteria 4754
90 Ga0075428_100571549 3300006844 Bacteria 1208
91 Ga0075428_100745114 3300006844 Bacteria 1042
92 Ga0075433_10057185 3300006852 Bacteria 3409
93 Ga0075434_100041537 3300006871 Bacteria 4556
94 Ga0075429_100036971 3300006880 Bacteria 4249
95 Ga0068865_100040590 3300006881 Bacteria 3163
96 Ga0075436_100020420 3300006914 Bacteria 4546
97 Ga0097620_100105410 3300006931 Bacteria 2878
98 Ga0097620_100136111 3300006931 Bacteria 2529
99 Ga0075435_100012275 3300007076 Bacteria 6336
100 Ga0105245_10196136 3300009098 Bacteria 1937
101 Ga0105245_10404643 3300009098 Bacteria 1365
102 Ga0105247_10017689 3300009101 Bacteria 4275
103 Ga0114129_10000744 3300009147 Bacteria 41358
104 Ga0114129_10731139 3300009147 Bacteria 1269
105 Ga0105241_10044860 3300009174 Bacteria 3351
106 Ga0105242_10042685 3300009176 Bacteria 3664
107 Ga0105248_10155428 3300009177 Bacteria 2581
108 Ga0105248_10604219 3300009177 Bacteria 1238
109 Ga0105237_10025512 3300009545 Bacteria 6045
110 Ga0105237_10063161 3300009545 Bacteria 3701
111 Ga0105237_10311586 3300009545 Bacteria 1577
112 Ga0105238_10143559 3300009551 Bacteria 2364
113 Ga0105238_10621476 3300009551 Bacteria 1089
114 Ga0105249_10007381 3300009553 Bacteria 9589
115 Ga0105239_10005021 3300010375 Bacteria 15620
116 Ga0105239_10085286 3300010375 Bacteria 3480
117 Ga0105239_10185705 3300010375 Bacteria 2326
118 Ga0105246_10007956 3300011119 Bacteria 6507
119 Ga0157371_10076670 3300013102 Bacteria 2367
120 Ga0157369_10048309 3300013105 Bacteria 4618
121 Ga0157369_10645807 3300013105 Bacteria 1091
122 Ga0157378_10043419 3300013297 Bacteria 3991
123 Ga0163162_10039626 3300013306 Bacteria 4709
124 Ga0163162_10342824 3300013306 Bacteria 1627
125 Ga0157372_10121762 3300013307 Bacteria 2997
126 Ga0157372_10764036 3300013307 Bacteria 1124
127 Ga0157375_10008112 3300013308 Bacteria 9189
128 Ga0157375_10727583 3300013308 Bacteria 1145
129 Ga0163163_10001611 3300014325 Bacteria 18983
130 Ga0157379_10198456 3300014968 Bacteria 1814
131 Ga0157379_10463604 3300014968 Bacteria 1171
132 Ga0163161_10003537 3300017792 Bacteria 10928
133 Ga0207692_10015974 3300025898 Bacteria 3313
134 Ga0207688_10005767 3300025901 Bacteria 6739
135 Ga0207685_10173980 3300025905 Bacteria 993
136 Ga0207699_10000563 3300025906 Bacteria 18306
137 Ga0207699_10158207 3300025906 Bacteria 1506
138 Ga0207699_10266921 3300025906 Bacteria 1185
139 Ga0207705_10122113 3300025909 Bacteria 1934
140 Ga0207684_10213191 3300025910 Bacteria 1666
141 Ga0207707_10300974 3300025912 Bacteria 1387
142 Ga0207695_10066912 3300025913 Bacteria 3687
143 Ga0207695_10185124 3300025913 Bacteria 2002
144 Ga0207671_10012605 3300025914 Bacteria 6790
145 Ga0207671_10020055 3300025914 Bacteria 5099
146 Ga0207693_10005948 3300025915 Bacteria 10126
147 Ga0207693_10123725 3300025915 Bacteria 2032
148 Ga0207660_10100669 3300025917 Bacteria 2158
149 Ga0207657_10041575 3300025919 Bacteria 4064
150 Ga0207681_10068383 3300025923 Bacteria 2467
151 Ga0207694_10070078 3300025924 Bacteria 2739
152 Ga0207687_10099101 3300025927 Bacteria 2141
153 Ga0207700_10002174 3300025928 Bacteria 11232
154 Ga0207700_10007308 3300025928 Bacteria 6742
155 Ga0207700_10049575 3300025928 Bacteria 3124
156 Ga0207700_10071231 3300025928 Bacteria 2676
157 Ga0207700_10089872 3300025928 Bacteria 2422
158 Ga0207700_10401779 3300025928 Bacteria 1201
159 Ga0207700_10528128 3300025928 Bacteria 1046
160 Ga0207664_10002078 3300025929 Bacteria 13174
161 Ga0207664_10004273 3300025929 Bacteria 9668
162 Ga0207664_10022897 3300025929 Bacteria 4673
163 Ga0207664_10113953 3300025929 Bacteria 2252
164 Ga0207664_10119983 3300025929 Bacteria 2199
165 Ga0207644_10414510 3300025931 Bacteria 1103
166 Ga0207644_10440752 3300025931 Bacteria 1069
167 Ga0207644_10619085 3300025931 Bacteria 900
168 Ga0207706_10004309 3300025933 Bacteria 13371
169 Ga0207670_10256732 3300025936 Bacteria 1353
170 Ga0207665_10000352 3300025939 Bacteria 31877
171 Ga0207665_10000882 3300025939 Bacteria 20246
172 Ga0207711_10537620 3300025941 Bacteria 1090
173 Ga0207689_10024307 3300025942 Bacteria 5084
174 Ga0207689_10252566 3300025942 Bacteria 1458
175 Ga0207661_10413889 3300025944 Bacteria 1224
176 Ga0207679_10059918 3300025945 Bacteria 2826
177 Ga0207679_10124636 3300025945 Bacteria 2057
178 Ga0207667_10214730 3300025949 Bacteria 1971
179 Ga0207712_10178535 3300025961 Bacteria 1666
180 Ga0207668_10003312 3300025972 Bacteria 9441
181 Ga0207640_10068941 3300025981 Bacteria 2372
182 Ga0207658_10036320 3300025986 Bacteria 3532
183 Ga0207703_10063457 3300026035 Bacteria 3029
184 Ga0207703_10249723 3300026035 Bacteria 1598
185 Ga0207639_10051325 3300026041 Bacteria 3137
186 Ga0207702_10209324 3300026078 Bacteria 1812
187 Ga0207702_10296114 3300026078 Bacteria 1534
188 Ga0207702_10317974 3300026078 Bacteria 1482
189 Ga0207702_10617541 3300026078 Bacteria 1064
190 Ga0207641_10084119 3300026088 Bacteria 2769
191 Ga0207641_10207571 3300026088 Bacteria 1810
192 Ga0207641_10278466 3300026088 Bacteria 1572
193 Ga0207676_10652370 3300026095 Bacteria 1016
194 Ga0207674_10150798 3300026116 Bacteria 2282
195 Ga0207675_100009835 3300026118 Bacteria 8948
196 Ga0207683_10010376 3300026121 Bacteria 7947
197 Ga0268266_10614461 3300028379 Bacteria 1045
198 Ga0268265_10085071 3300028380 Bacteria 2509
199 Ga0268264_10302413 3300028381 Bacteria 1506
200 Ga0265337_1000052 3300028556 Bacteria 52251
201 Ga0265326_10003382 3300028558 Bacteria 5225
202 Ga0265319_1002287 3300028563 Bacteria 10569
203 Ga0265334_10000162 3300028573 Bacteria 40960
204 Ga0265318_10007745 3300028577 Bacteria 4829
205 Ga0265322_10005360 3300028654 Bacteria 3798
206 Ga0265336_10033092 3300028666 Bacteria 1601
207 Ga0307517_10084573 3300028786 Bacteria 2669
208 Ga0307515_10002200 3300028794 Bacteria 42791
209 Ga0307515_10030640 3300028794 Bacteria 9016
210 Ga0307515_10305237 3300028794 Bacteria 1272
211 Ga0265338_10000986 3300028800 Bacteria 47980
212 Ga0265338_10003673 3300028800 Bacteria 21387
213 Ga0265338_10004932 3300028800 Bacteria 17719
214 Ga0265324_10004189 3300029957 Bacteria 6600
215 Ga0307512_10004194 3300030522 Bacteria 15960
216 Ga0307512_10004480 3300030522 Bacteria 15286
217 Ga0265332_10015650 3300031238 Bacteria 3348
218 Ga0265320_10005127 3300031240 Bacteria 8459
219 Ga0265325_10011209 3300031241 Bacteria 5157
220 Ga0265340_10017137 3300031247 Bacteria 3746
221 Ga0265339_10030455 3300031249 Bacteria 3055
222 Ga0265316_10056762 3300031344 Bacteria 3056
223 Ga0307513_10014890 3300031456 Bacteria 9457
224 Ga0307513_10023131 3300031456 Bacteria 7272
225 Ga0307513_10208657 3300031456 Bacteria 1787
226 Ga0307509_10002147 3300031507 Bacteria 32420
227 Ga0307509_10178611 3300031507 Bacteria 1992
228 Ga0265313_10011428 3300031595 Bacteria 5523
229 Ga0307508_10001138 3300031616 Bacteria 30634
230 Ga0307508_10005883 3300031616 Bacteria 11576
231 Ga0265314_10008105 3300031711 Bacteria 9041
232 Ga0265342_10002806 3300031712 Bacteria 14749
233 Ga0307516_10008708 3300031730 Bacteria 11411
234 Ga0307516_10146543 3300031730 Bacteria 2126
235 Ga0307405_10089435 3300031731 Bacteria 2034
236 Ga0307413_10070946 3300031824 Bacteria 2193
237 Ga0307413_10458651 3300031824 Bacteria 1013
238 Ga0307410_10109401 3300031852 Bacteria 1997
239 Ga0307406_10056940 3300031901 Bacteria 2506
240 Ga0307406_10295802 3300031901 Bacteria 1241
241 Ga0307406_10422794 3300031901 Bacteria 1062
242 Ga0307409_100013557 3300031995 Bacteria 5254
243 Ga0307409_100259160 3300031995 Bacteria 1595
244 Ga0307409_100585855 3300031995 Bacteria 1100
245 Ga0307416_100140696 3300032002 Bacteria 2193
246 Ga0307415_100047730 3300032126 Bacteria 2884
247 Ga0307415_100085622 3300032126 Bacteria 2265
248 Ga0307415_100223272 3300032126 Bacteria 1512
249 Ga0307415_100237152 3300032126 Bacteria 1473
250 Ga0307507_10170998 3300033179 Bacteria 1579
251 Ga0373938_0002760 3300034957 Bacteria 2835
252 Ga0373926_0017394 3300035083 Bacteria 2467
253 Ga0373929_0014506 3300035085 Bacteria 1523
254 Ga0373951_0000194 3300035091 Bacteria 21927
255 Ga0373932_0071067 3300035112 Bacteria 1080
256 Ga0373939_0020281 3300035114 Bacteria 1803
257 Ga0373941_0002265 3300035115 Bacteria 4211
258 Ga0373946_0158586 3300035171 Bacteria 1061
259 Ga0373942_0000437 3300035207 Bacteria 11648
260 Ga0373961_0007808 3300035241 Bacteria 2593
261 Ga0373962_0000223 3300035242 Bacteria 11975
262 Ga0373962_0007765 3300035242 Bacteria 2633
263 Ga0373931_0020303 3300035691 Bacteria 3322
264 Ga0373935_0006287 3300035692 Bacteria 7075
265 Ga0373947_0000005 3300035725 Bacteria 225129
266 Ga0373947_0110806 3300035725 Bacteria 1734
267 Ga0373947_0195134 3300035725 Bacteria 1323
268 Ga0373937_0242214 3300036401 Bacteria 1699
269 Ga0373925_0197263 3300037068 Bacteria 1599
270 Ga0395899_0006864 3300037312 Bacteria 8819
271 Ga0395898_0029388 3300037466 Bacteria 5505
272 Ga0436364_0086889 3300037853 Bacteria 54583
273 Ga0436364_0126636 3300037853 Bacteria 3310
274 Ga0436365_0672354 3300039437 Bacteria 1015
275 Ga0451791_0020448 3300041451 Bacteria 3274
276 Ga0451797_0727517 3300041453 Bacteria 1738
277 Ga0451839_1546768 3300041496 Bacteria 1851
278 Ga0451843_1667944 3300041509 Bacteria 2515
279 Ga0451853_3673365 3300041512 Bacteria 4342
280 Ga0466972_0021481 3300044658 Bacteria 3217
281 Ga0466965_0028596 3300044683 Bacteria 2709
282 Ga0466966_0009536 3300044684 Bacteria 6426
283 Ga0466966_0145494 3300044684 Bacteria 1447
284 Ga0466963_0012815 3300044694 Bacteria 5137
285 Ga0466963_0119816 3300044694 Bacteria 1810
286 Ga0466963_0339528 3300044694 Bacteria 1057
287 Ga0466964_0002467 3300044706 Bacteria 6574
288 Ga0466971_0013753 3300044719 Bacteria 3557
289 Ga0466971_0114686 3300044719 Bacteria 1245
290 Ga0466970_0094797 3300044765 Bacteria 1622
291 Ga0466970_0106421 3300044765 Bacteria 1530
292 Ga0466957_0047627 3300044842 Bacteria 2605
293 Ga0466957_0053882 3300044842 Bacteria 2454
294 Ga0466957_0141615 3300044842 Bacteria 1549
295 Ga0466960_0205079 3300044901 Bacteria 1079
296 Ga0466959_0015491 3300045049 Bacteria 5555
297 Ga0466959_0102550 3300045049 Bacteria 2048
298 Ga0466959_0212650 3300045049 Bacteria 1343
299 Ga0466959_0265740 3300045049 Bacteria 1180
300 Ga0466958_0009996 3300045836 Bacteria 5300
301 Ga0466958_0019168 3300045836 Bacteria 3979
302 Ga0466958_0057360 3300045836 Bacteria 2366
303 Ga0466967_0001284 3300045976 Bacteria 14286
304 Ga0466967_0003844 3300045976 Bacteria 9948
305 Ga0466967_0009420 3300045976 Bacteria 7243
306 Ga0466967_0012927 3300045976 Bacteria 6419
307 Ga0466967_0370961 3300045976 Bacteria 1388
308 Ga0466967_1019094 3300045976 Bacteria 824
309 Ga0495603_0179556 3300046455 Bacteria 1225
310 Ga0495638_0048500 3300046460 Bacteria 2658
311 Ga0495664_0007153 3300046477 Bacteria 6184
312 Ga0495594_0087308 3300046499 Bacteria 1745
313 Ga0495606_0004365 3300046507 Bacteria 14182
314 Ga0495628_0021056 3300046516 Bacteria 5370
315 Ga0495630_0075202 3300046517 Bacteria 2545
316 Ga0495632_0013760 3300046519 Bacteria 4604
317 Ga0495640_0138941 3300046533 Bacteria 1567
318 Ga0495586_0017828 3300046535 Bacteria 3778
319 Ga0495645_0087227 3300046543 Bacteria 2232
320 Ga0495645_0180758 3300046543 Bacteria 1445
321 Ga0495668_0000464 3300046616 Bacteria 51784
322 Ga0495634_0056531 3300046642 Bacteria 2621
323 Ga0495625_0000677 3300046660 Bacteria 48654
324 Ga0495659_0183078 3300046664 Bacteria 854
325 Ga0495599_0137904 3300046678 Bacteria 1514
326 Ga0495624_0087004 3300046690 Bacteria 1930
327 Ga0495674_0053174 3300047319 Bacteria 3561
328 Ga0495676_0225608 3300047321 Bacteria 1289
329 Ga0495680_0182516 3300047322 Bacteria 1514
330 Ga0495684_0465418 3300047471 Bacteria 876
331 Ga0495614_0014615 3300048089 Bacteria 3433
332 Ga0495626_0000184 3300048091 Bacteria 76088
333 Ga0496100_0228364 3300048903 Bacteria 1368
334 Ga0496102_0051731 3300048905 Bacteria 3742
335 Ga0496104_0039664 3300048907 Bacteria 4409
336 Ga0496104_0048806 3300048907 Bacteria 3991
337 Ga0496105_0092485 3300048908 Bacteria 2497
338 Ga0496105_0105580 3300048908 Bacteria 2325
339 Ga0496106_0085074 3300048909 Bacteria 2434
340 Ga0496107_0022355 3300048910 Bacteria 4469
341 Ga0496108_0000481 3300048911 Bacteria 31977
342 Ga0496108_0018189 3300048911 Bacteria 5753
343 Ga0496108_0042303 3300048911 Bacteria 3803
344 Ga0496109_0005860 3300048912 Bacteria 10301
345 Ga0496110_0027175 3300048913 Bacteria 4903
346 Ga0496110_0057759 3300048913 Bacteria 3416
347 Ga0496111_0021831 3300048914 Bacteria 4473
348 Ga0496111_0146070 3300048914 Bacteria 1753
349 Ga0496112_0055476 3300048915 Bacteria 3896
350 Ga0496112_0296043 3300048915 Bacteria 1564
351 Ga0496113_0054854 3300048916 Bacteria 2985
352 Ga0496114_0015245 3300048917 Bacteria 6178
353 Ga0496114_0179745 3300048917 Bacteria 1847
354 Ga0496115_0124081 3300048918 Bacteria 2126
355 Ga0496126_0258066 3300048929 Bacteria 1450
356 Ga0501039_0138676 3300049575 Bacteria 1910
357 Ga0501040_0146383 3300049576 Bacteria 1665
358 Ga0501041_0020346 3300049577 Bacteria 3968
359 Ga0501042_0039968 3300049578 Bacteria 3335
360 Ga0501042_0184967 3300049578 Bacteria 1503
361 Ga0501046_0095646 3300049580 Bacteria 2282
362 Ga0501047_0100317 3300049581 Bacteria 2774
363 Ga0501048_0176243 3300049582 Bacteria 1515
364 Ga0501070_0356996 3300049586 Bacteria 1186
365 Ga0501072_0110318 3300049588 Bacteria 2190
366 Ga0501073_0144171 3300049589 Bacteria 1650
367 Ga0501074_0002824 3300049590 Bacteria 12158
368 Ga0501076_0115314 3300049592 Bacteria 2174
369 Ga0501079_0002723 3300049741 Bacteria 12877
370 Ga0501079_0188044 3300049741 Bacteria 1612
371 Ga0501080_0014244 3300049742 Bacteria 7321
372 Ga0501081_0072755 3300049743 Bacteria 2397
373 Ga0501081_0696869 3300049743 Bacteria 762
374 Ga0501044_0017433 3300049823 Bacteria 7705
375 Ga0501044_0525372 3300049823 Bacteria 1083
376 Ga0501045_0052179 3300049824 Bacteria 2985
377 nmdc:mga05p37_452_c1 3300050507 Bacteria 44614
378 nmdc:mga09592_44058_c1 3300050508 Bacteria 3754
379 nmdc:mga0qj67_181696_c1 3300050509 Bacteria 1708
380 nmdc:mga06r32_387125_c1 3300050510 Bacteria 1381
381 nmdc:mga0rr50_292348_c1 3300050513 Bacteria 1362
382 nmdc:mga0a205_35742_c1 3300050515 Bacteria 4771
383 Ga0495601_0013113 3300053077 Bacteria 4982
384 Ga0495612_0016052 3300053078 Bacteria 3000
385 Ga0500646_0000099 3300053090 Bacteria 24433
386 Ga0500646_0052574 3300053090 Bacteria 1179
387 Ga0500583_0165975 3300053092 Bacteria 1100
388 Ga0500641_0053028 3300053096 Bacteria 1673
389 Ga0500650_0020121 3300053098 Bacteria 2924
390 Ga0500594_0010207 3300053118 Bacteria 2175
391 Ga0500652_051927 3300053131 Bacteria 1675
392 Ga0500559_0033249 3300053136 Bacteria 2220
393 Ga0500588_0005765 3300053146 Bacteria 2769
394 Ga0501084_0156177 3300054114 Bacteria 1924
395 Ga0501082_0288226 3300060353 Bacteria 1429
396 2501944210 2501939600 Bacteria 6907073
397 2515495170 2515154088 Bacteria 5526283
398 2515754875 2515154137 Bacteria 5711575
399 2516083377 2515154202 Bacteria 5471270
400 2516088518 2515154203 Bacteria 5458536
401 2623500298 2622736605 Bacteria 4992138
402 2623590784 2622736626 Bacteria 7181580
403 2753268273 2751185782 Bacteria 11227053
404 2831936256 2831935698 Bacteria 5963223
405 2832010479 2832004796 Bacteria 6538017
406 2837273200 2837268691 Bacteria 7850704
407 2855676471 2855670206 Bacteria 7120389
408 2855678607 2855676851 Bacteria 7063653
409 2855684690 2855683550 Bacteria 7134265
410 2856864448 2856858025 Bacteria 7255264
411 2857294567 2857288857 Bacteria 7189066
412 2858852053 2858848962 Bacteria 6963058
413 2858875544 2858868258 Bacteria 7683772
414 2858888691 2858882152 Bacteria 7230291
415 2858888945 2858888857 Bacteria 7060307
416 2858897461 2858895516 Bacteria 7378898
417 2858905720 2858902515 Bacteria 7086037
418 2866070288 2866065130 Bacteria 6518152
419 2867316074 2867312974 Bacteria 7058875
420 2867320940 2867319477 Bacteria 7069771
421 2867511807 2867507094 Bacteria 6506033
422 2869051200 2869048445 Bacteria 6875584
423 2869067312 2869061728 Bacteria 7112407
424 2869074183 2869068681 Bacteria 7205615
425 2880489717 2880489317 Bacteria 7096270
426 2880495985 2880495981 Bacteria 7340502
427 2887481176 2887478801 Bacteria 8972725
428 2902583471 2902582711 Bacteria 6187705
429 2929232400 2929226422 Bacteria 7248583
430 649814024 649633069 Bacteria 6962533
431 8001789888 8001781756 Bacteria 9586736
432 8054732750 8054727385 Bacteria 7558670
433 8054737976 8054734606 Bacteria 6947278
434 8055413479 8055412473 Bacteria 6257500
435 Ga0207652_10371932
436 JGI24738J21930_10023691
437 JGI25406J46586_10017186
438 JGI25406J46586_10070484
439 Ga0070676_10297501
440 Ga0070690_100346514
441 Ga0068869_100151732
442 Ga0070666_10014264
443 Ga0070682_100035284
444 Ga0068868_100036194
445 Ga0070689_100304583
446 Ga0070691_10043008
447 Ga0070687_100013219
448 Ga0070692_10017283
449 Ga0070668_100009783
450 Ga0070668_100032838
451 Ga0070668_100102640
452 Ga0070688_100127125
453 Ga0070709_10012583
454 Ga0070709_10017800
455 Ga0070709_10083473
456 Ga0070714_100008849
457 Ga0070714_100012596
458 Ga0070714_100053428
459 Ga0070714_100297854
460 Ga0070714_100569885
461 Ga0070713_100175404
462 Ga0070713_100213895
463 Ga0070713_100258040
464 Ga0070713_100712603
465 Ga0070710_10000156
466 Ga0070710_10063879
467 Ga0070711_100001013
468 Ga0070694_100014480
469 Ga0070694_100358644
470 Ga0070708_100024575
471 Ga0070708_100173046
472 Ga0070708_100245680
473 Ga0070663_100017694
474 Ga0070678_100014415
475 Ga0070662_100141302
476 Ga0070698_100000534
477 Ga0070698_100072830
478 Ga0070699_100093889
479 Ga0070679_100360159
480 Ga0070684_100527538
481 Ga0070697_100028376
482 Ga0068853_100016620
483 Ga0068853_101042391
484 Ga0070686_100024998
485 Ga0070695_100015524
486 Ga0070696_100011867
487 Ga0070693_100030089
488 Ga0070665_100868676
489 Ga0068855_100115406
490 Ga0070664_100128337
491 Ga0068854_100030025
492 Ga0068856_100049862
493 Ga0068856_100155284
494 Ga0068852_100288810
495 Ga0068859_100105405
496 Ga0068859_100136107
497 Ga0068864_100313429
498 Ga0068861_100035313
499 Ga0068851_10082912
500 Ga0068863_100096186
501 Ga0068863_100220382
502 Ga0068858_100022912
503 Ga0068858_100075523
504 Ga0068860_100051707
505 Ga0068862_100051495
506 Ga0068862_100062137
507 Ga0081540_1002028
508 Ga0081539_10000385
509 Ga0081539_10000406
510 Ga0081539_10001654
511 Ga0081539_10004523
512 Ga0070717_10056851
513 Ga0070717_10118311
514 Ga0070717_10133859
515 Ga0070717_10473048
516 Ga0070715_10126712
517 Ga0070715_10221569
518 Ga0070716_100012132
519 Ga0070716_100020657
520 Ga0070712_100004605
521 Ga0070712_100100339
522 Ga0070712_100145531
523 Ga0097621_100024019
524 Ga0075428_100571549
525 Ga0075428_100745114
526 Ga0075433_10057185
527 Ga0075434_100041537
528 Ga0075429_100036971
529 Ga0068865_100040590
530 Ga0075436_100020420
531 Ga0097620_100105410
532 Ga0097620_100136111
533 Ga0075435_100012275
534 Ga0105245_10196136
535 Ga0105245_10404643
536 Ga0105247_10017689
537 Ga0114129_10000744
538 Ga0114129_10731139
539 Ga0105241_10044860
540 Ga0105242_10042685
541 Ga0105248_10155428
542 Ga0105248_10604219
543 Ga0105237_10025512
544 Ga0105237_10063161
545 Ga0105237_10311586
546 Ga0105238_10143559
547 Ga0105238_10621476
548 Ga0105249_10007381
549 Ga0105239_10005021
550 Ga0105239_10085286
551 Ga0105239_10185705
552 Ga0105246_10007956
553 Ga0157371_10076670
554 Ga0157369_10048309
555 Ga0157369_10645807
556 Ga0157378_10043419
557 Ga0163162_10039626
558 Ga0163162_10342824
559 Ga0157372_10121762
560 Ga0157372_10764036
561 Ga0157375_10008112
562 Ga0157375_10727583
563 Ga0163163_10001611
564 Ga0157379_10198456
565 Ga0157379_10463604
566 Ga0163161_10003537
567 Ga0207692_10015974
568 Ga0207688_10005767
569 Ga0207685_10173980
570 Ga0207699_10000563
571 Ga0207699_10158207
572 Ga0207699_10266921
573 Ga0207705_10122113
574 Ga0207684_10213191
575 Ga0207707_10300974
576 Ga0207695_10066912
577 Ga0207695_10185124
578 Ga0207671_10012605
579 Ga0207671_10020055
580 Ga0207693_10005948
581 Ga0207693_10123725
582 Ga0207660_10100669
583 Ga0207657_10041575
584 Ga0207681_10068383
585 Ga0207694_10070078
586 Ga0207687_10099101
587 Ga0207700_10002174
588 Ga0207700_10007308
589 Ga0207700_10049575
590 Ga0207700_10071231
591 Ga0207700_10089872
592 Ga0207700_10401779
593 Ga0207700_10528128
594 Ga0207664_10002078
595 Ga0207664_10004273
596 Ga0207664_10022897
597 Ga0207664_10113953
598 Ga0207664_10119983
599 Ga0207644_10414510
600 Ga0207644_10440752
601 Ga0207644_10619085
602 Ga0207706_10004309
603 Ga0207670_10256732
604 Ga0207665_10000352
605 Ga0207665_10000882
606 Ga0207711_10537620
607 Ga0207689_10024307
608 Ga0207689_10252566
609 Ga0207661_10413889
610 Ga0207679_10059918
611 Ga0207679_10124636
612 Ga0207667_10214730
613 Ga0207712_10178535
614 Ga0207668_10003312
615 Ga0207640_10068941
616 Ga0207658_10036320
617 Ga0207703_10063457
618 Ga0207703_10249723
619 Ga0207639_10051325
620 Ga0207702_10209324
621 Ga0207702_10296114
622 Ga0207702_10317974
623 Ga0207702_10617541
624 Ga0207641_10084119
625 Ga0207641_10207571
626 Ga0207641_10278466
627 Ga0207676_10652370
628 Ga0207674_10150798
629 Ga0207675_100009835
630 Ga0207683_10010376
631 Ga0268266_10614461
632 Ga0268265_10085071
633 Ga0268264_10302413
634 Ga0265337_1000052
635 Ga0265326_10003382
636 Ga0265319_1002287
637 Ga0265334_10000162
638 Ga0265318_10007745
639 Ga0265322_10005360
640 Ga0265336_10033092
641 Ga0307517_10084573
642 Ga0307515_10002200
643 Ga0307515_10030640
644 Ga0307515_10305237
645 Ga0265338_10000986
646 Ga0265338_10003673
647 Ga0265338_10004932
648 Ga0265324_10004189
649 Ga0307512_10004194
650 Ga0307512_10004480
651 Ga0265332_10015650
652 Ga0265320_10005127
653 Ga0265325_10011209
654 Ga0265340_10017137
655 Ga0265339_10030455
656 Ga0265316_10056762
657 Ga0307513_10014890
658 Ga0307513_10023131
659 Ga0307513_10208657
660 Ga0307509_10002147
661 Ga0307509_10178611
662 Ga0265313_10011428
663 Ga0307508_10001138
664 Ga0307508_10005883
665 Ga0265314_10008105
666 Ga0265342_10002806
667 Ga0307516_10008708
668 Ga0307516_10146543
669 Ga0307405_10089435
670 Ga0307413_10070946
671 Ga0307413_10458651
672 Ga0307410_10109401
673 Ga0307406_10056940
674 Ga0307406_10295802
675 Ga0307406_10422794
676 Ga0307409_100013557
677 Ga0307409_100259160
678 Ga0307409_100585855
679 Ga0307416_100140696
680 Ga0307415_100047730
681 Ga0307415_100085622
682 Ga0307415_100223272
683 Ga0307415_100237152
684 Ga0307507_10170998
685 Ga0373938_0002760
686 Ga0373926_0017394
687 Ga0373929_0014506
688 Ga0373951_0000194
689 Ga0373932_0071067
690 Ga0373939_0020281
691 Ga0373941_0002265
692 Ga0373946_0158586
693 Ga0373942_0000437
694 Ga0373961_0007808
695 Ga0373962_0000223
696 Ga0373962_0007765
697 Ga0373931_0020303
698 Ga0373935_0006287
699 Ga0373947_0000005
700 Ga0373947_0110806
701 Ga0373947_0195134
702 Ga0373937_0242214
703 Ga0373925_0197263
704 Ga0395899_0006864
705 Ga0395898_0029388
706 Ga0436364_0086889
707 Ga0436364_0126636
708 Ga0436365_0672354
709 Ga0451791_0020448
710 Ga0451797_0727517
711 Ga0451839_1546768
712 Ga0451843_1667944
713 Ga0451853_3673365
714 Ga0466972_0021481
715 Ga0466965_0028596
716 Ga0466966_0009536
717 Ga0466966_0145494
718 Ga0466963_0012815
719 Ga0466963_0119816
720 Ga0466963_0339528
721 Ga0466964_0002467
722 Ga0466971_0013753
723 Ga0466971_0114686
724 Ga0466970_0094797
725 Ga0466970_0106421
726 Ga0466957_0047627
727 Ga0466957_0053882
728 Ga0466957_0141615
729 Ga0466960_0205079
730 Ga0466959_0015491
731 Ga0466959_0102550
732 Ga0466959_0212650
733 Ga0466959_0265740
734 Ga0466958_0009996
735 Ga0466958_0019168
736 Ga0466958_0057360
737 Ga0466967_0001284
738 Ga0466967_0003844
739 Ga0466967_0009420
740 Ga0466967_0012927
741 Ga0466967_0370961
742 Ga0466967_1019094
743 Ga0495603_0179556
744 Ga0495638_0048500
745 Ga0495664_0007153
746 Ga0495594_0087308
747 Ga0495606_0004365
748 Ga0495628_0021056
749 Ga0495630_0075202
750 Ga0495632_0013760
751 Ga0495640_0138941
752 Ga0495586_0017828
753 Ga0495645_0087227
754 Ga0495645_0180758
755 Ga0495668_0000464
756 Ga0495634_0056531
757 Ga0495625_0000677
758 Ga0495659_0183078
759 Ga0495599_0137904
760 Ga0495624_0087004
761 Ga0495674_0053174
762 Ga0495676_0225608
763 Ga0495680_0182516
764 Ga0495684_0465418
765 Ga0495614_0014615
766 Ga0495626_0000184
767 Ga0496100_0228364
768 Ga0496102_0051731
769 Ga0496104_0039664
770 Ga0496104_0048806
771 Ga0496105_0092485
772 Ga0496105_0105580
773 Ga0496106_0085074
774 Ga0496107_0022355
775 Ga0496108_0000481
776 Ga0496108_0018189
777 Ga0496108_0042303
778 Ga0496109_0005860
779 Ga0496110_0027175
780 Ga0496110_0057759
781 Ga0496111_0021831
782 Ga0496111_0146070
783 Ga0496112_0055476
784 Ga0496112_0296043
785 Ga0496113_0054854
786 Ga0496114_0015245
787 Ga0496114_0179745
788 Ga0496115_0124081
789 Ga0496126_0258066
790 Ga0501039_0138676
791 Ga0501040_0146383
792 Ga0501041_0020346
793 Ga0501042_0039968
794 Ga0501042_0184967
795 Ga0501046_0095646
796 Ga0501047_0100317
797 Ga0501048_0176243
798 Ga0501070_0356996
799 Ga0501072_0110318
800 Ga0501073_0144171
801 Ga0501074_0002824
802 Ga0501076_0115314
803 Ga0501079_0002723
804 Ga0501079_0188044
805 Ga0501080_0014244
806 Ga0501081_0072755
807 Ga0501081_0696869
808 Ga0501044_0017433
809 Ga0501044_0525372
810 Ga0501045_0052179
811 nmdc:mga05p37_452_c1
812 nmdc:mga09592_44058_c1
813 nmdc:mga0qj67_181696_c1
814 nmdc:mga06r32_387125_c1
815 nmdc:mga0rr50_292348_c1
816 nmdc:mga0a205_35742_c1
817 Ga0495601_0013113
818 Ga0495612_0016052
819 Ga0500646_0000099
820 Ga0500646_0052574
821 Ga0500583_0165975
822 Ga0500641_0053028
823 Ga0500650_0020121
824 Ga0500594_0010207
825 Ga0500652_051927
826 Ga0500559_0033249
827 Ga0500588_0005765
828 Ga0501084_0156177
829 Ga0501082_0288226
830 2501944210
831 2515495170
832 2515754875
833 2516083377
834 2516088518
835 2623500298
836 2623590784
837 2753268273
838 2831936256
839 2832010479
840 2837273200
841 2855676471
842 2855678607
843 2855684690
844 2856864448
845 2857294567
846 2858852053
847 2858875544
848 2858888691
849 2858888945
850 2858897461
851 2858905720
852 2866070288
853 2867316074
854 2867320940
855 2867511807
856 2869051200
857 2869067312
858 2869074183
859 2880489717
860 2880495985
861 2887481176
862 2902583471
863 2929232400
864 649814024
865 8001789888
866 8054732750
867 8054737976
868 8055413479

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

4

218

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vzw-assembly1.cif.gz_A crystal structure of the bifunctional protein pria 0.9657 1 237
1vzw-assembly1.cif.gz_A crystal structure of the bifunctional protein pria 0.9617 1 237
4x9s-assembly1.cif.gz_A crystal structure of hisap from streptomyces sp. mg1 0.9532 1 236
2vep-assembly1.cif.gz_A crystal structure of the full length bifunctional enzyme pria 0.9517 2 237
2x30-assembly1.cif.gz_A crystal structure of the r139n mutant of a bifunctional enzyme pria 0.9502 2 237
ID Description Score Start End Superfamily
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9381 1 236 3.20.20.70
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.919 1 236 3.20.20.70
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9149 5 236 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9011 3 236 3.20.20.70
4gj1A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8953 4 237 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7K0SNI1-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 0.9703 28 236 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A3D4SXN0-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 0.9666 1 127 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A4Y8Y3H5-F1-model_v4 deleted 0.965 25 135
AF-A0A3C0ATR8-F1-model_v4 Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA (EC 5.3.1.16, EC 5.3.1.24) 0.9625 1 100 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737
AF-A0A6A9UWS2-F1-model_v4 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase (EC 5.3.1.16) (Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase) 0.9601 2 236 GO:0000105
GO:0000162
GO:0003949
GO:0004640
GO:0005737

Map