F443098

General Info

Members Datasets Scaffolds Average Seq Length
434 261 868 164

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10227619|Ga0163163_102276192
Length 192
Sequence LRLAVTGGCCVREFRFRPATTSVPLPGIVHSMSMSSLAAVLPIDRRQSPTALAVARGTTRLLHSLGFAVVSELPLASGRRADLVALAGDGEVWIVEIKSSIADLRADQKWIDYRLHCDRLFFATTLDVPCEIFPSDTGLIVADAFGASVKCEAPEHRLHAATRRSMMLAFARAAALRLSALADPDGPYGGGS

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
85 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
130 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
137 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
144 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
145 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
146 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
150 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
155 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
177 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
178 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
181 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
182 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
189 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
206 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
209 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
210 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
211 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
212 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
218 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
221 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
230 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
231 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
232 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
233 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
237 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
238 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
239 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
240 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
241 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
254 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
255 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
256 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
257 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
258 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
259 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.46
Nodule 0
Rhizoplane 14.06
Rhizosphere 80.88
Stem 0
Stem Tuber 0
Unclassified 1.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10227619 3300014325 Bacteria 1913
2 JGI25405J52794_10003674 3300003911 Bacteria 2705
3 JGI25405J52794_10025187 3300003911 Bacteria 1218
4 Ga0070676_10903199 3300005328 Bacteria 658
5 Ga0070683_100100114 3300005329 Bacteria 2728
6 Ga0070683_100591357 3300005329 Bacteria 1062
7 Ga0070670_100004877 3300005331 Bacteria 11287
8 Ga0070670_100323385 3300005331 Bacteria 1352
9 Ga0070666_10097926 3300005335 Bacteria 2019
10 Ga0070660_100175881 3300005339 Bacteria 1731
11 Ga0070689_100195729 3300005340 Bacteria 1648
12 Ga0070689_100357907 3300005340 Bacteria 1226
13 Ga0070691_10408223 3300005341 Unclassified 767
14 Ga0070687_100103202 3300005343 Bacteria 1601
15 Ga0070692_10009840 3300005345 Bacteria 4329
16 Ga0070669_100466412 3300005353 Bacteria 1043
17 Ga0070675_100337888 3300005354 Bacteria 1334
18 Ga0070671_100002907 3300005355 Bacteria 13329
19 Ga0070673_100003299 3300005364 Bacteria 10022
20 Ga0070673_100113781 3300005364 Bacteria 2247
21 Ga0070688_100088983 3300005365 Bacteria 2014
22 Ga0070688_100114571 3300005365 Bacteria 1798
23 Ga0070659_100174597 3300005366 Bacteria 1762
24 Ga0070667_100449334 3300005367 Bacteria 1178
25 Ga0070667_101525245 3300005367 Bacteria 628
26 Ga0070709_10003339 3300005434 Bacteria 8631
27 Ga0070709_10616118 3300005434 Bacteria 837
28 Ga0070714_100175079 3300005435 Bacteria 1949
29 Ga0070714_100438138 3300005435 Bacteria 1240
30 Ga0070713_100032027 3300005436 Bacteria 4195
31 Ga0070713_100041859 3300005436 Bacteria 3735
32 Ga0070713_101390289 3300005436 Bacteria 681
33 Ga0070710_10023525 3300005437 Bacteria 3240
34 Ga0070701_10009363 3300005438 Bacteria 4287
35 Ga0070711_100010550 3300005439 Bacteria 5720
36 Ga0070711_100231621 3300005439 Bacteria 1440
37 Ga0070700_100454310 3300005441 Bacteria 975
38 Ga0070708_100198981 3300005445 Bacteria 1875
39 Ga0070708_100996584 3300005445 Bacteria 786
40 Ga0070663_100153887 3300005455 Bacteria 1765
41 Ga0070662_100231044 3300005457 Bacteria 1480
42 Ga0070662_100262952 3300005457 Bacteria 1391
43 Ga0068867_100132522 3300005459 Bacteria 1939
44 Ga0070699_100000391 3300005518 Bacteria 42600
45 Ga0070699_100534613 3300005518 Bacteria 1066
46 Ga0070696_100061218 3300005546 Bacteria 2633
47 Ga0070665_100148403 3300005548 Bacteria 2347
48 Ga0070665_100160235 3300005548 Bacteria 2252
49 Ga0070665_100652215 3300005548 Bacteria 1066
50 Ga0070704_100589207 3300005549 Bacteria 976
51 Ga0070704_100619372 3300005549 Bacteria 953
52 Ga0068857_100186850 3300005577 Bacteria 1887
53 Ga0068857_100480983 3300005577 Bacteria 1164
54 Ga0070702_100063674 3300005615 Bacteria 2154
55 Ga0068859_100135918 3300005617 Bacteria 2531
56 Ga0068864_100551887 3300005618 Bacteria 1114
57 Ga0068866_10121114 3300005718 Bacteria 1474
58 Ga0068861_100012035 3300005719 Bacteria 6027
59 Ga0068860_100011200 3300005843 Bacteria 8838
60 Ga0068860_101241034 3300005843 Bacteria 766
61 Ga0068862_100067881 3300005844 Bacteria 3075
62 Ga0081455_10006672 3300005937 Bacteria 12335
63 Ga0081455_10012328 3300005937 Bacteria 8529
64 Ga0081455_10044298 3300005937 Bacteria 3884
65 Ga0081455_10117102 3300005937 Bacteria 2106
66 Ga0081455_10136329 3300005937 Bacteria 1912
67 Ga0081538_10031620 3300005981 Bacteria 3564
68 Ga0081540_1011083 3300005983 Bacteria 6053
69 Ga0081540_1023376 3300005983 Bacteria 3616
70 Ga0081540_1081272 3300005983 Bacteria 1458
71 Ga0070717_10013809 3300006028 Bacteria 6200
72 Ga0070717_10133448 3300006028 Bacteria 2137
73 Ga0070717_10624438 3300006028 Bacteria 978
74 Ga0070717_10809326 3300006028 Bacteria 852
75 Ga0075365_10015255 3300006038 Bacteria 4643
76 Ga0075365_10088305 3300006038 Bacteria 2109
77 Ga0075368_10220016 3300006042 Bacteria 807
78 Ga0075364_10108480 3300006051 Bacteria 1852
79 Ga0070715_10004637 3300006163 Bacteria 4532
80 Ga0070715_10028501 3300006163 Bacteria 2240
81 Ga0070712_100093084 3300006175 Bacteria 2212
82 Ga0070712_100385994 3300006175 Bacteria 1154
83 Ga0075367_10154456 3300006178 Bacteria 1425
84 Ga0097621_100045973 3300006237 Bacteria 3529
85 Ga0097621_100130495 3300006237 Bacteria 2139
86 Ga0068871_100282788 3300006358 Bacteria 1452
87 Ga0075428_100092522 3300006844 Bacteria 3297
88 Ga0075428_100106046 3300006844 Bacteria 3064
89 Ga0075428_100142133 3300006844 Bacteria 2609
90 Ga0075428_100564896 3300006844 Bacteria 1216
91 Ga0075430_100011768 3300006846 Bacteria 7450
92 Ga0075430_100283669 3300006846 Bacteria 1370
93 Ga0075431_100836934 3300006847 Bacteria 892
94 Ga0075434_100010425 3300006871 Bacteria 8710
95 Ga0075434_100251712 3300006871 Bacteria 1786
96 Ga0075429_100027581 3300006880 Bacteria 4930
97 Ga0075429_100188235 3300006880 Bacteria 1809
98 Ga0097620_100135925 3300006931 Bacteria 2531
99 Ga0075435_100448177 3300007076 Bacteria 1113
100 Ga0111539_10093020 3300009094 Bacteria 3542
101 Ga0111539_10155829 3300009094 Bacteria 2673
102 Ga0111539_10157001 3300009094 Bacteria 2662
103 Ga0111539_11318375 3300009094 Bacteria 838
104 Ga0105245_10097534 3300009098 Bacteria 2714
105 Ga0105247_10240807 3300009101 Bacteria 1233
106 Ga0114129_10021806 3300009147 Bacteria 9093
107 Ga0114129_10023750 3300009147 Bacteria 8690
108 Ga0114129_10040058 3300009147 Bacteria 6607
109 Ga0114129_10322264 3300009147 Bacteria 2054
110 Ga0105243_10077623 3300009148 Bacteria 2702
111 Ga0105241_10608749 3300009174 Bacteria 988
112 Ga0105241_10777596 3300009174 Bacteria 880
113 Ga0105242_10108964 3300009176 Bacteria 2358
114 Ga0105248_10302548 3300009177 Bacteria 1801
115 Ga0105237_10488572 3300009545 Bacteria 1237
116 Ga0105249_10014009 3300009553 Bacteria 7088
117 Ga0099796_10000682 3300010159 Bacteria 5966
118 Ga0105239_10103676 3300010375 Bacteria 3148
119 Ga0105246_10531144 3300011119 Bacteria 1005
120 Ga0157371_11280675 3300013102 Bacteria 567
121 Ga0157374_10008942 3300013296 Bacteria 8583
122 Ga0157374_11280024 3300013296 Bacteria 755
123 Ga0157378_10420175 3300013297 Bacteria 1321
124 Ga0157372_11602400 3300013307 Unclassified 749
125 Ga0163163_10116895 3300014325 Bacteria 2698
126 Ga0157380_10341631 3300014326 Bacteria 1397
127 Ga0157377_10048756 3300014745 Bacteria 2378
128 Ga0157377_10152599 3300014745 Bacteria 1429
129 Ga0157376_10145671 3300014969 Bacteria 2130
130 Ga0157376_10584812 3300014969 Bacteria 1109
131 Ga0157376_10774413 3300014969 Bacteria 970
132 Ga0163161_10078368 3300017792 Bacteria 2428
133 Ga0213872_10157449 3300021361 Bacteria 990
134 Ga0213876_10039363 3300021384 Bacteria 2497
135 Ga0213876_10239902 3300021384 Bacteria 964
136 Ga0228598_1001334 3300024227 Bacteria 5436
137 Ga0207692_10009995 3300025898 Bacteria 3980
138 Ga0207688_10002715 3300025901 Bacteria 9581
139 Ga0207680_10519673 3300025903 Bacteria 849
140 Ga0207685_10027242 3300025905 Bacteria 1998
141 Ga0207685_10098015 3300025905 Bacteria 1248
142 Ga0207699_10243666 3300025906 Bacteria 1236
143 Ga0207645_10008896 3300025907 Bacteria 6974
144 Ga0207643_10002169 3300025908 Bacteria 10765
145 Ga0207684_10256893 3300025910 Bacteria 1507
146 Ga0207654_10518910 3300025911 Bacteria 843
147 Ga0207671_10660983 3300025914 Bacteria 832
148 Ga0207693_10007249 3300025915 Bacteria 9125
149 Ga0207693_10018778 3300025915 Bacteria 5502
150 Ga0207693_10095068 3300025915 Bacteria 2336
151 Ga0207662_10003837 3300025918 Bacteria 7814
152 Ga0207657_10027961 3300025919 Bacteria 5154
153 Ga0207657_10580932 3300025919 Bacteria 875
154 Ga0207646_10617826 3300025922 Bacteria 972
155 Ga0207681_10053257 3300025923 Bacteria 2747
156 Ga0207650_10002294 3300025925 Bacteria 13327
157 Ga0207650_10194724 3300025925 Bacteria 1621
158 Ga0207659_10173705 3300025926 Bacteria 1702
159 Ga0207687_10128440 3300025927 Bacteria 1907
160 Ga0207700_10122534 3300025928 Bacteria 2110
161 Ga0207700_10237319 3300025928 Bacteria 1553
162 Ga0207700_10334524 3300025928 Bacteria 1315
163 Ga0207700_10449500 3300025928 Bacteria 1135
164 Ga0207644_10279760 3300025931 Bacteria 1339
165 Ga0207690_10742814 3300025932 Bacteria 809
166 Ga0207706_10217468 3300025933 Bacteria 1674
167 Ga0207706_10313248 3300025933 Bacteria 1366
168 Ga0207704_10018680 3300025938 Bacteria 3625
169 Ga0207704_10318344 3300025938 Bacteria 1199
170 Ga0207665_10015898 3300025939 Bacteria 4941
171 Ga0207691_10012500 3300025940 Bacteria 8139
172 Ga0207689_10026160 3300025942 Bacteria 4886
173 Ga0207661_10061743 3300025944 Bacteria 3029
174 Ga0207658_10311495 3300025986 Bacteria 1360
175 Ga0207703_10009328 3300026035 Bacteria 7711
176 Ga0207703_10883583 3300026035 Bacteria 855
177 Ga0207708_10017820 3300026075 Bacteria 5344
178 Ga0207641_10418760 3300026088 Bacteria 1289
179 Ga0207648_10113047 3300026089 Bacteria 2384
180 Ga0207676_10326699 3300026095 Bacteria 1410
181 Ga0207674_10187414 3300026116 Bacteria 2019
182 Ga0207675_100064437 3300026118 Bacteria 3425
183 Ga0207683_10046859 3300026121 Bacteria 3784
184 Ga0207683_10582274 3300026121 Bacteria 1035
185 Ga0207698_10602601 3300026142 Bacteria 1083
186 Ga0209813_10084533 3300027866 Bacteria 1055
187 Ga0207428_10267590 3300027907 Bacteria 1272
188 Ga0207428_10287556 3300027907 Bacteria 1219
189 Ga0268266_10073648 3300028379 Bacteria 2964
190 Ga0268266_10277132 3300028379 Bacteria 1558
191 Ga0268266_10612491 3300028379 Bacteria 1046
192 Ga0268265_10026480 3300028380 Bacteria 4127
193 Ga0268264_10025676 3300028381 Bacteria 4812
194 Ga0265338_10057101 3300028800 Bacteria 3455
195 Ga0265332_10050491 3300031238 Bacteria 1788
196 Ga0265320_10129381 3300031240 Bacteria 1147
197 Ga0265325_10027187 3300031241 Bacteria 3094
198 Ga0265340_10008643 3300031247 Bacteria 5490
199 Ga0265340_10038299 3300031247 Bacteria 2372
200 Ga0265314_10299421 3300031711 Bacteria 903
201 Ga0265342_10020357 3300031712 Bacteria 4258
202 Ga0265342_10265080 3300031712 Bacteria 913
203 Ga0316576_10122291 3300031727 Bacteria 1955
204 Ga0307416_101882890 3300032002 Bacteria 702
205 Ga0373938_0101512 3300034957 Bacteria 723
206 Ga0373934_0119292 3300035086 Bacteria 1073
207 Ga0373940_0168290 3300035088 Bacteria 707
208 Ga0373923_0213129 3300035111 Bacteria 896
209 Ga0373923_0402499 3300035111 Bacteria 659
210 Ga0373936_0019763 3300035113 Bacteria 2612
211 Ga0373945_0078345 3300035116 Bacteria 1262
212 Ga0373953_0147753 3300035117 Bacteria 1007
213 Ga0373954_0091840 3300035118 Bacteria 1459
214 Ga0373954_0505580 3300035118 Bacteria 599
215 Ga0373956_0023411 3300035119 Bacteria 2651
216 Ga0373956_0181543 3300035119 Bacteria 995
217 Ga0373960_0229789 3300035121 Bacteria 667
218 Ga0373946_0151624 3300035171 Bacteria 1082
219 Ga0373946_0154781 3300035171 Bacteria 1072
220 Ga0373946_0385519 3300035171 Bacteria 706
221 Ga0373955_0249930 3300035172 Bacteria 1063
222 Ga0373955_0303834 3300035172 Bacteria 962
223 Ga0373962_0196797 3300035242 Bacteria 680
224 Ga0316574_0008000 3300035398 Bacteria 5840
225 Ga0373924_0410290 3300035410 Bacteria 606
226 Ga0373931_0020165 3300035691 Bacteria 3333
227 Ga0373935_0248244 3300035692 Bacteria 1245
228 Ga0373927_0133425 3300035695 Bacteria 1622
229 Ga0373927_0466143 3300035695 Bacteria 834
230 Ga0373927_0523101 3300035695 Bacteria 784
231 Ga0373933_0036034 3300035724 Bacteria 2893
232 Ga0373947_0033762 3300035725 Bacteria 3023
233 Ga0373947_0311689 3300035725 Bacteria 1051
234 Ga0373947_0357031 3300035725 Bacteria 981
235 Ga0373937_0101780 3300036401 Bacteria 2666
236 Ga0373937_0763537 3300036401 Bacteria 914
237 Ga0373937_1043786 3300036401 Bacteria 766
238 Ga0316584_0001301 3300036712 Bacteria 14742
239 Ga0373925_0158654 3300037068 Bacteria 1780
240 Ga0373925_0286698 3300037068 Bacteria 1327
241 Ga0395899_0276948 3300037312 Bacteria 1143
242 Ga0395900_1087126 3300037418 Bacteria 717
243 Ga0395898_0128044 3300037466 Bacteria 2432
244 Ga0436364_0258698 3300037853 Bacteria 1897
245 Ga0395901_0203505 3300038443 Bacteria 2075
246 Ga0436365_1721974 3300039437 Bacteria 568
247 Ga0436365_1863098 3300039437 Bacteria 1997
248 Ga0436361_0667294 3300039447 Bacteria 4131
249 Ga0436363_0511897 3300039450 Bacteria 1223
250 Ga0451800_1501496 3300041459 Unclassified 705
251 Ga0451853_3727332 3300041512 Bacteria 652
252 Ga0466960_0547701 3300044901 Bacteria 682
253 Ga0495592_0186832 3300046454 Bacteria 1407
254 Ga0495603_0098703 3300046455 Bacteria 1705
255 Ga0495603_0189084 3300046455 Bacteria 1191
256 Ga0495590_0319053 3300046457 Bacteria 587
257 Ga0495629_0567751 3300046459 Bacteria 760
258 Ga0495651_0118961 3300046462 Bacteria 1943
259 Ga0495653_0095214 3300046463 Bacteria 2168
260 Ga0495580_0253856 3300046472 Bacteria 1203
261 Ga0495582_0375820 3300046473 Bacteria 819
262 Ga0495605_0057383 3300046474 Bacteria 1874
263 Ga0495662_0137123 3300046476 Bacteria 1204
264 Ga0495664_0106693 3300046477 Bacteria 1689
265 Ga0495584_0051814 3300046491 Bacteria 2066
266 Ga0495585_0267263 3300046492 Unclassified 849
267 Ga0495594_0169910 3300046499 Bacteria 1240
268 Ga0495608_0041916 3300046511 Bacteria 3062
269 Ga0495618_0054432 3300046514 Bacteria 2532
270 Ga0495628_0854707 3300046516 Bacteria 634
271 Ga0495630_0399245 3300046517 Bacteria 1053
272 Ga0495631_0141318 3300046518 Bacteria 1034
273 Ga0495637_0082203 3300046520 Bacteria 1283
274 Ga0495637_0222432 3300046520 Bacteria 687
275 Ga0495666_0102987 3300046526 Bacteria 1344
276 Ga0495666_0110586 3300046526 Bacteria 1291
277 Ga0495652_0093646 3300046529 Bacteria 2452
278 Ga0495652_0187699 3300046529 Bacteria 1580
279 Ga0495665_0024206 3300046531 Bacteria 3262
280 Ga0495640_0107389 3300046533 Bacteria 1827
281 Ga0495640_0125498 3300046533 Bacteria 1665
282 Ga0495640_0178059 3300046533 Bacteria 1356
283 Ga0495587_0151774 3300046536 Bacteria 1320
284 Ga0495645_0108442 3300046543 Bacteria 1967
285 Ga0495645_0225444 3300046543 Bacteria 1258
286 Ga0495633_0272732 3300046558 Viruses 770
287 Ga0495667_0055266 3300046559 Bacteria 2611
288 Ga0495656_0032060 3300046615 Bacteria 2136
289 Ga0495656_0162997 3300046615 Bacteria 1085
290 Ga0495656_0434848 3300046615 Bacteria 690
291 Ga0495668_0195459 3300046616 Bacteria 1108
292 Ga0495634_0249095 3300046642 Bacteria 1087
293 Ga0495659_0018451 3300046664 Bacteria 2325
294 Ga0495661_0280932 3300046665 Bacteria 839
295 Ga0495599_0233396 3300046678 Bacteria 1123
296 Ga0495599_0670060 3300046678 Bacteria 600
297 Ga0495623_0088891 3300046679 Bacteria 1900
298 Ga0495646_0089254 3300046680 Bacteria 1784
299 Ga0495647_0220074 3300046681 Bacteria 838
300 Ga0495658_0347044 3300046683 Bacteria 943
301 Ga0495624_0032429 3300046690 Bacteria 3387
302 Ga0495624_0091327 3300046690 Bacteria 1878
303 Ga0495624_0321076 3300046690 Bacteria 933
304 Ga0495670_0248251 3300046691 Bacteria 948
305 Ga0495589_0067456 3300046794 Bacteria 1751
306 Ga0495581_0057456 3300047315 Bacteria 2246
307 Ga0495581_0213702 3300047315 Bacteria 1128
308 Ga0495604_0217411 3300047317 Bacteria 1317
309 Ga0495674_0231892 3300047319 Bacteria 1523
310 Ga0495674_0614663 3300047319 Unclassified 860
311 Ga0495672_0070694 3300047320 Bacteria 1977
312 Ga0495676_0063072 3300047321 Bacteria 2890
313 Ga0495676_0203477 3300047321 Bacteria 1374
314 Ga0495680_0182453 3300047322 Bacteria 1514
315 Ga0495683_0325140 3300047323 Bacteria 655
316 Ga0495677_0088006 3300047445 Bacteria 1169
317 Ga0495686_0533157 3300047472 Unclassified 615
318 Ga0496100_1027079 3300048903 Bacteria 649
319 Ga0496101_0134040 3300048904 Bacteria 1883
320 Ga0496101_0173784 3300048904 Bacteria 1656
321 Ga0496101_0290747 3300048904 Bacteria 1278
322 Ga0496102_0056199 3300048905 Bacteria 3589
323 Ga0496102_0148578 3300048905 Bacteria 2200
324 Ga0496102_0545378 3300048905 Bacteria 1082
325 Ga0496102_0562468 3300048905 Bacteria 1063
326 Ga0496103_0009953 3300048906 Bacteria 5622
327 Ga0496103_0159918 3300048906 Bacteria 1444
328 Ga0496104_0000778 3300048907 Bacteria 27299
329 Ga0496104_0008273 3300048907 Bacteria 9237
330 Ga0496104_0012528 3300048907 Bacteria 7627
331 Ga0496104_0036935 3300048907 Bacteria 4567
332 Ga0496104_0291748 3300048907 Bacteria 1544
333 Ga0496105_0003920 3300048908 Bacteria 11126
334 Ga0496105_0024338 3300048908 Bacteria 4919
335 Ga0496105_0108185 3300048908 Bacteria 2295
336 Ga0496106_0139601 3300048909 Bacteria 1905
337 Ga0496106_0242637 3300048909 Bacteria 1440
338 Ga0496106_0437942 3300048909 Bacteria 1050
339 Ga0496106_0609078 3300048909 Bacteria 874
340 Ga0496107_0007269 3300048910 Bacteria 7631
341 Ga0496107_0657429 3300048910 Bacteria 772
342 Ga0496108_0002100 3300048911 Bacteria 15953
343 Ga0496108_0017280 3300048911 Bacteria 5900
344 Ga0496108_0384292 3300048911 Bacteria 1226
345 Ga0496108_0918061 3300048911 Bacteria 751
346 Ga0496109_0205150 3300048912 Bacteria 1853
347 Ga0496109_0278100 3300048912 Bacteria 1577
348 Ga0496109_0288715 3300048912 Bacteria 1546
349 Ga0496109_0450897 3300048912 Bacteria 1215
350 Ga0496109_0654487 3300048912 Bacteria 987
351 Ga0496110_0049353 3300048913 Bacteria 3692
352 Ga0496110_0063408 3300048913 Bacteria 3265
353 Ga0496110_0316235 3300048913 Bacteria 1422
354 Ga0496110_0358036 3300048913 Bacteria 1329
355 Ga0496110_0974409 3300048913 Bacteria 755
356 Ga0496110_1274200 3300048913 Bacteria 644
357 Ga0496110_1335850 3300048913 Bacteria 626
358 Ga0496111_0048342 3300048914 Bacteria 3064
359 Ga0496111_0159462 3300048914 Bacteria 1675
360 Ga0496112_0004430 3300048915 Bacteria 11892
361 Ga0496112_0005377 3300048915 Bacteria 11065
362 Ga0496112_0072408 3300048915 Bacteria 3406
363 Ga0496113_0042202 3300048916 Bacteria 3369
364 Ga0496113_0138193 3300048916 Bacteria 1916
365 Ga0496113_0183517 3300048916 Bacteria 1659
366 Ga0496113_0252718 3300048916 Bacteria 1407
367 Ga0496113_0766724 3300048916 Bacteria 767
368 Ga0496114_0076180 3300048917 Bacteria 2826
369 Ga0496114_0516373 3300048917 Bacteria 1056
370 Ga0496114_0664655 3300048917 Bacteria 916
371 Ga0496114_1098511 3300048917 Bacteria 680
372 Ga0496115_0033735 3300048918 Bacteria 4042
373 Ga0496115_0141352 3300048918 Bacteria 1986
374 Ga0496115_0172316 3300048918 Bacteria 1790
375 Ga0496115_0184846 3300048918 Bacteria 1722
376 Ga0496115_0334913 3300048918 Bacteria 1236
377 Ga0496115_0360092 3300048918 Bacteria 1185
378 Ga0501071_0930247 3300049587 Bacteria 671
379 Ga0501072_0635445 3300049588 Bacteria 841
380 Ga0501074_0447547 3300049590 Bacteria 916
381 Ga0501075_0484139 3300049591 Bacteria 944
382 Ga0501075_0565759 3300049591 Bacteria 867
383 Ga0501076_0198547 3300049592 Bacteria 1637
384 Ga0501077_0308950 3300049593 Bacteria 1008
385 Ga0501035_0906345 3300049822 Bacteria 698
386 Ga0501045_1050161 3300049824 Bacteria 597
387 nmdc:mga00v17_511930_c1 3300050491 Bacteria 777
388 nmdc:mga00v17_89785_c1 3300050491 Bacteria 1928
389 nmdc:mga0yw44_1301_c2 3300050492 Bacteria 6584
390 nmdc:mga0yw44_236781_c1 3300050492 Bacteria 1213
391 nmdc:mga0yw44_58193_c1 3300050492 Bacteria 2361
392 nmdc:mga0yw44_84727_c1 3300050492 Bacteria 1993
393 nmdc:mga0k408_476338_c1 3300050493 Bacteria 740
394 nmdc:mga06z11_542599_c1 3300050494 Bacteria 706
395 nmdc:mga06z11_91581_c1 3300050494 Bacteria 1651
396 nmdc:mga05p37_125564_c1 3300050507 Bacteria 3151
397 nmdc:mga05p37_1422485_c1 3300050507 Bacteria 697
398 nmdc:mga05p37_1937611_c1 3300050507 Bacteria 561
399 nmdc:mga05p37_336106_c1 3300050507 Bacteria 1782
400 nmdc:mga05p37_770421_c1 3300050507 Bacteria 1057
401 nmdc:mga05p37_9913_c1 3300050507 Bacteria 11307
402 nmdc:mga09592_1103777_c1 3300050508 Bacteria 659
403 nmdc:mga0qj67_160_c1 3300050509 Bacteria 45393
404 nmdc:mga06r32_1009825_c1 3300050510 Bacteria 784
405 nmdc:mga06r32_49181_c1 3300050510 Bacteria 4031
406 nmdc:mga08y16_102465_c1 3300050511 Bacteria 2980
407 nmdc:mga08y16_1037663_c1 3300050511 Bacteria 798
408 nmdc:mga08y16_246740_c1 3300050511 Bacteria 1845
409 nmdc:mga08y16_571803_c1 3300050511 Bacteria 1142
410 nmdc:mga08y16_609320_c1 3300050511 Bacteria 1100
411 nmdc:mga08y16_829666_c1 3300050511 Bacteria 915
412 nmdc:mga0n895_1052832_c1 3300050512 Bacteria 793
413 nmdc:mga0n895_1555167_c1 3300050512 Bacteria 627
414 nmdc:mga0n895_185961_c1 3300050512 Bacteria 2108
415 nmdc:mga0n895_2528_c1 3300050512 Bacteria 14323
416 nmdc:mga0n895_830358_c1 3300050512 Unclassified 913
417 nmdc:mga0n895_940160_c1 3300050512 Bacteria 848
418 nmdc:mga0n895_97932_c1 3300050512 Bacteria 2939
419 nmdc:mga0rr50_244062_c2 3300050513 Bacteria 1193
420 nmdc:mga0rr50_286628_c1 3300050513 Bacteria 1375
421 nmdc:mga0rr50_311013_c1 3300050513 Bacteria 1319
422 nmdc:mga0rr50_973090_c1 3300050513 Bacteria 723
423 nmdc:mga08x19_268058_c1 3300050514 Bacteria 1181
424 nmdc:mga0a205_20872_c1 3300050515 Bacteria 6190
425 nmdc:mga0a205_588535_c1 3300050515 Bacteria 966
426 Ga0495601_0110105 3300053077 Bacteria 1783
427 Ga0495601_0208576 3300053077 Bacteria 1276
428 Ga0495595_0084784 3300053084 Bacteria 1514
429 Ga0495619_0051174 3300053085 Bacteria 2729
430 Ga0495619_0114164 3300053085 Bacteria 1848
431 Ga0495619_0213782 3300053085 Bacteria 1335
432 Ga0501082_1337895 3300060353 Bacteria 626
433 Ga0530510_0404169 3300061734 Bacteria 1030
434 Ga0530510_0554779 3300061734 Bacteria 873
435 Ga0163163_10227619
436 JGI25405J52794_10003674
437 JGI25405J52794_10025187
438 Ga0070676_10903199
439 Ga0070683_100100114
440 Ga0070683_100591357
441 Ga0070670_100004877
442 Ga0070670_100323385
443 Ga0070666_10097926
444 Ga0070660_100175881
445 Ga0070689_100195729
446 Ga0070689_100357907
447 Ga0070691_10408223
448 Ga0070687_100103202
449 Ga0070692_10009840
450 Ga0070669_100466412
451 Ga0070675_100337888
452 Ga0070671_100002907
453 Ga0070673_100003299
454 Ga0070673_100113781
455 Ga0070688_100088983
456 Ga0070688_100114571
457 Ga0070659_100174597
458 Ga0070667_100449334
459 Ga0070667_101525245
460 Ga0070709_10003339
461 Ga0070709_10616118
462 Ga0070714_100175079
463 Ga0070714_100438138
464 Ga0070713_100032027
465 Ga0070713_100041859
466 Ga0070713_101390289
467 Ga0070710_10023525
468 Ga0070701_10009363
469 Ga0070711_100010550
470 Ga0070711_100231621
471 Ga0070700_100454310
472 Ga0070708_100198981
473 Ga0070708_100996584
474 Ga0070663_100153887
475 Ga0070662_100231044
476 Ga0070662_100262952
477 Ga0068867_100132522
478 Ga0070699_100000391
479 Ga0070699_100534613
480 Ga0070696_100061218
481 Ga0070665_100148403
482 Ga0070665_100160235
483 Ga0070665_100652215
484 Ga0070704_100589207
485 Ga0070704_100619372
486 Ga0068857_100186850
487 Ga0068857_100480983
488 Ga0070702_100063674
489 Ga0068859_100135918
490 Ga0068864_100551887
491 Ga0068866_10121114
492 Ga0068861_100012035
493 Ga0068860_100011200
494 Ga0068860_101241034
495 Ga0068862_100067881
496 Ga0081455_10006672
497 Ga0081455_10012328
498 Ga0081455_10044298
499 Ga0081455_10117102
500 Ga0081455_10136329
501 Ga0081538_10031620
502 Ga0081540_1011083
503 Ga0081540_1023376
504 Ga0081540_1081272
505 Ga0070717_10013809
506 Ga0070717_10133448
507 Ga0070717_10624438
508 Ga0070717_10809326
509 Ga0075365_10015255
510 Ga0075365_10088305
511 Ga0075368_10220016
512 Ga0075364_10108480
513 Ga0070715_10004637
514 Ga0070715_10028501
515 Ga0070712_100093084
516 Ga0070712_100385994
517 Ga0075367_10154456
518 Ga0097621_100045973
519 Ga0097621_100130495
520 Ga0068871_100282788
521 Ga0075428_100092522
522 Ga0075428_100106046
523 Ga0075428_100142133
524 Ga0075428_100564896
525 Ga0075430_100011768
526 Ga0075430_100283669
527 Ga0075431_100836934
528 Ga0075434_100010425
529 Ga0075434_100251712
530 Ga0075429_100027581
531 Ga0075429_100188235
532 Ga0097620_100135925
533 Ga0075435_100448177
534 Ga0111539_10093020
535 Ga0111539_10155829
536 Ga0111539_10157001
537 Ga0111539_11318375
538 Ga0105245_10097534
539 Ga0105247_10240807
540 Ga0114129_10021806
541 Ga0114129_10023750
542 Ga0114129_10040058
543 Ga0114129_10322264
544 Ga0105243_10077623
545 Ga0105241_10608749
546 Ga0105241_10777596
547 Ga0105242_10108964
548 Ga0105248_10302548
549 Ga0105237_10488572
550 Ga0105249_10014009
551 Ga0099796_10000682
552 Ga0105239_10103676
553 Ga0105246_10531144
554 Ga0157371_11280675
555 Ga0157374_10008942
556 Ga0157374_11280024
557 Ga0157378_10420175
558 Ga0157372_11602400
559 Ga0163163_10116895
560 Ga0157380_10341631
561 Ga0157377_10048756
562 Ga0157377_10152599
563 Ga0157376_10145671
564 Ga0157376_10584812
565 Ga0157376_10774413
566 Ga0163161_10078368
567 Ga0213872_10157449
568 Ga0213876_10039363
569 Ga0213876_10239902
570 Ga0228598_1001334
571 Ga0207692_10009995
572 Ga0207688_10002715
573 Ga0207680_10519673
574 Ga0207685_10027242
575 Ga0207685_10098015
576 Ga0207699_10243666
577 Ga0207645_10008896
578 Ga0207643_10002169
579 Ga0207684_10256893
580 Ga0207654_10518910
581 Ga0207671_10660983
582 Ga0207693_10007249
583 Ga0207693_10018778
584 Ga0207693_10095068
585 Ga0207662_10003837
586 Ga0207657_10027961
587 Ga0207657_10580932
588 Ga0207646_10617826
589 Ga0207681_10053257
590 Ga0207650_10002294
591 Ga0207650_10194724
592 Ga0207659_10173705
593 Ga0207687_10128440
594 Ga0207700_10122534
595 Ga0207700_10237319
596 Ga0207700_10334524
597 Ga0207700_10449500
598 Ga0207644_10279760
599 Ga0207690_10742814
600 Ga0207706_10217468
601 Ga0207706_10313248
602 Ga0207704_10018680
603 Ga0207704_10318344
604 Ga0207665_10015898
605 Ga0207691_10012500
606 Ga0207689_10026160
607 Ga0207661_10061743
608 Ga0207658_10311495
609 Ga0207703_10009328
610 Ga0207703_10883583
611 Ga0207708_10017820
612 Ga0207641_10418760
613 Ga0207648_10113047
614 Ga0207676_10326699
615 Ga0207674_10187414
616 Ga0207675_100064437
617 Ga0207683_10046859
618 Ga0207683_10582274
619 Ga0207698_10602601
620 Ga0209813_10084533
621 Ga0207428_10267590
622 Ga0207428_10287556
623 Ga0268266_10073648
624 Ga0268266_10277132
625 Ga0268266_10612491
626 Ga0268265_10026480
627 Ga0268264_10025676
628 Ga0265338_10057101
629 Ga0265332_10050491
630 Ga0265320_10129381
631 Ga0265325_10027187
632 Ga0265340_10008643
633 Ga0265340_10038299
634 Ga0265314_10299421
635 Ga0265342_10020357
636 Ga0265342_10265080
637 Ga0316576_10122291
638 Ga0307416_101882890
639 Ga0373938_0101512
640 Ga0373934_0119292
641 Ga0373940_0168290
642 Ga0373923_0213129
643 Ga0373923_0402499
644 Ga0373936_0019763
645 Ga0373945_0078345
646 Ga0373953_0147753
647 Ga0373954_0091840
648 Ga0373954_0505580
649 Ga0373956_0023411
650 Ga0373956_0181543
651 Ga0373960_0229789
652 Ga0373946_0151624
653 Ga0373946_0154781
654 Ga0373946_0385519
655 Ga0373955_0249930
656 Ga0373955_0303834
657 Ga0373962_0196797
658 Ga0316574_0008000
659 Ga0373924_0410290
660 Ga0373931_0020165
661 Ga0373935_0248244
662 Ga0373927_0133425
663 Ga0373927_0466143
664 Ga0373927_0523101
665 Ga0373933_0036034
666 Ga0373947_0033762
667 Ga0373947_0311689
668 Ga0373947_0357031
669 Ga0373937_0101780
670 Ga0373937_0763537
671 Ga0373937_1043786
672 Ga0316584_0001301
673 Ga0373925_0158654
674 Ga0373925_0286698
675 Ga0395899_0276948
676 Ga0395900_1087126
677 Ga0395898_0128044
678 Ga0436364_0258698
679 Ga0395901_0203505
680 Ga0436365_1721974
681 Ga0436365_1863098
682 Ga0436361_0667294
683 Ga0436363_0511897
684 Ga0451800_1501496
685 Ga0451853_3727332
686 Ga0466960_0547701
687 Ga0495592_0186832
688 Ga0495603_0098703
689 Ga0495603_0189084
690 Ga0495590_0319053
691 Ga0495629_0567751
692 Ga0495651_0118961
693 Ga0495653_0095214
694 Ga0495580_0253856
695 Ga0495582_0375820
696 Ga0495605_0057383
697 Ga0495662_0137123
698 Ga0495664_0106693
699 Ga0495584_0051814
700 Ga0495585_0267263
701 Ga0495594_0169910
702 Ga0495608_0041916
703 Ga0495618_0054432
704 Ga0495628_0854707
705 Ga0495630_0399245
706 Ga0495631_0141318
707 Ga0495637_0082203
708 Ga0495637_0222432
709 Ga0495666_0102987
710 Ga0495666_0110586
711 Ga0495652_0093646
712 Ga0495652_0187699
713 Ga0495665_0024206
714 Ga0495640_0107389
715 Ga0495640_0125498
716 Ga0495640_0178059
717 Ga0495587_0151774
718 Ga0495645_0108442
719 Ga0495645_0225444
720 Ga0495633_0272732
721 Ga0495667_0055266
722 Ga0495656_0032060
723 Ga0495656_0162997
724 Ga0495656_0434848
725 Ga0495668_0195459
726 Ga0495634_0249095
727 Ga0495659_0018451
728 Ga0495661_0280932
729 Ga0495599_0233396
730 Ga0495599_0670060
731 Ga0495623_0088891
732 Ga0495646_0089254
733 Ga0495647_0220074
734 Ga0495658_0347044
735 Ga0495624_0032429
736 Ga0495624_0091327
737 Ga0495624_0321076
738 Ga0495670_0248251
739 Ga0495589_0067456
740 Ga0495581_0057456
741 Ga0495581_0213702
742 Ga0495604_0217411
743 Ga0495674_0231892
744 Ga0495674_0614663
745 Ga0495672_0070694
746 Ga0495676_0063072
747 Ga0495676_0203477
748 Ga0495680_0182453
749 Ga0495683_0325140
750 Ga0495677_0088006
751 Ga0495686_0533157
752 Ga0496100_1027079
753 Ga0496101_0134040
754 Ga0496101_0173784
755 Ga0496101_0290747
756 Ga0496102_0056199
757 Ga0496102_0148578
758 Ga0496102_0545378
759 Ga0496102_0562468
760 Ga0496103_0009953
761 Ga0496103_0159918
762 Ga0496104_0000778
763 Ga0496104_0008273
764 Ga0496104_0012528
765 Ga0496104_0036935
766 Ga0496104_0291748
767 Ga0496105_0003920
768 Ga0496105_0024338
769 Ga0496105_0108185
770 Ga0496106_0139601
771 Ga0496106_0242637
772 Ga0496106_0437942
773 Ga0496106_0609078
774 Ga0496107_0007269
775 Ga0496107_0657429
776 Ga0496108_0002100
777 Ga0496108_0017280
778 Ga0496108_0384292
779 Ga0496108_0918061
780 Ga0496109_0205150
781 Ga0496109_0278100
782 Ga0496109_0288715
783 Ga0496109_0450897
784 Ga0496109_0654487
785 Ga0496110_0049353
786 Ga0496110_0063408
787 Ga0496110_0316235
788 Ga0496110_0358036
789 Ga0496110_0974409
790 Ga0496110_1274200
791 Ga0496110_1335850
792 Ga0496111_0048342
793 Ga0496111_0159462
794 Ga0496112_0004430
795 Ga0496112_0005377
796 Ga0496112_0072408
797 Ga0496113_0042202
798 Ga0496113_0138193
799 Ga0496113_0183517
800 Ga0496113_0252718
801 Ga0496113_0766724
802 Ga0496114_0076180
803 Ga0496114_0516373
804 Ga0496114_0664655
805 Ga0496114_1098511
806 Ga0496115_0033735
807 Ga0496115_0141352
808 Ga0496115_0172316
809 Ga0496115_0184846
810 Ga0496115_0334913
811 Ga0496115_0360092
812 Ga0501071_0930247
813 Ga0501072_0635445
814 Ga0501074_0447547
815 Ga0501075_0484139
816 Ga0501075_0565759
817 Ga0501076_0198547
818 Ga0501077_0308950
819 Ga0501035_0906345
820 Ga0501045_1050161
821 nmdc:mga00v17_511930_c1
822 nmdc:mga00v17_89785_c1
823 nmdc:mga0yw44_1301_c2
824 nmdc:mga0yw44_236781_c1
825 nmdc:mga0yw44_58193_c1
826 nmdc:mga0yw44_84727_c1
827 nmdc:mga0k408_476338_c1
828 nmdc:mga06z11_542599_c1
829 nmdc:mga06z11_91581_c1
830 nmdc:mga05p37_125564_c1
831 nmdc:mga05p37_1422485_c1
832 nmdc:mga05p37_1937611_c1
833 nmdc:mga05p37_336106_c1
834 nmdc:mga05p37_770421_c1
835 nmdc:mga05p37_9913_c1
836 nmdc:mga09592_1103777_c1
837 nmdc:mga0qj67_160_c1
838 nmdc:mga06r32_1009825_c1
839 nmdc:mga06r32_49181_c1
840 nmdc:mga08y16_102465_c1
841 nmdc:mga08y16_1037663_c1
842 nmdc:mga08y16_246740_c1
843 nmdc:mga08y16_571803_c1
844 nmdc:mga08y16_609320_c1
845 nmdc:mga08y16_829666_c1
846 nmdc:mga0n895_1052832_c1
847 nmdc:mga0n895_1555167_c1
848 nmdc:mga0n895_185961_c1
849 nmdc:mga0n895_2528_c1
850 nmdc:mga0n895_830358_c1
851 nmdc:mga0n895_940160_c1
852 nmdc:mga0n895_97932_c1
853 nmdc:mga0rr50_244062_c2
854 nmdc:mga0rr50_286628_c1
855 nmdc:mga0rr50_311013_c1
856 nmdc:mga0rr50_973090_c1
857 nmdc:mga08x19_268058_c1
858 nmdc:mga0a205_20872_c1
859 nmdc:mga0a205_588535_c1
860 Ga0495601_0110105
861 Ga0495601_0208576
862 Ga0495595_0084784
863 Ga0495619_0051174
864 Ga0495619_0114164
865 Ga0495619_0213782
866 Ga0501082_1337895
867 Ga0530510_0404169
868 Ga0530510_0554779

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06319

MmcB-like

DNA repair protein MmcB-like

39

185

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dnx-assembly1.cif.gz_A-2 spo1766 protein of unknown function from silicibacter pomeroyi. 0.9228 15 161
3dnx-assembly1.cif.gz_A-2 spo1766 protein of unknown function from silicibacter pomeroyi. 0.9168 15 161
5x89-assembly1.cif.gz_A-2 the x-ray crystal structure of subunit fusion rna splicing endonuclease from methanopyrus kandleri 0.821 23 68
5jjq-assembly4.cif.gz_D crystal structure of idnl1 0.7165 90 126
5jjq-assembly3.cif.gz_C crystal structure of idnl1 0.7133 90 126
ID Description Score Start End Superfamily
4qbnB00 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.7529 23 67 3.40.1350.10
1rv5A00 Alpha Beta;3-Layer(aba) Sandwich;ECO RV Endonuclease; Chain A;DNA mismatch repair MutH/Restriction endonuclease, type II 0.6725 28 68 3.40.600.10
2rveB00 Alpha Beta;3-Layer(aba) Sandwich;ECO RV Endonuclease; Chain A;DNA mismatch repair MutH/Restriction endonuclease, type II 0.6693 28 70 3.40.600.10
af_P9WFM9_15_126_3.40.1350.10 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.6592 27 83 3.40.1350.10
af_Q4DGW0_24_151_2.70.130.10 Mainly Beta;Distorted Sandwich;Cation-dependent Mannose-6-phosphate Receptor; Chain A;Mannose-6-phosphate receptor binding domain 0.656 37 68 2.70.130.10
ID Description Score Start End GO Terms
AF-A0A2D7XUV4-F1-model_v4 DNA repair protein MmcB-related protein 0.9951 20 151
AF-A0A258BNE0-F1-model_v4 DNA repair protein MmcB-related protein 0.9939 20 155
AF-A0A380W3F0-F1-model_v4 Protein of uncharacterized function (DUF1052) 0.9925 23 156
AF-A0A395D2K8-F1-model_v4 DNA repair protein MmcB-related protein 0.9918 20 152
AF-A0A537QTZ8-F1-model_v4 MmcB family DNA repair protein 0.9902 19 154

Map