F443083

General Info

Members Datasets Scaffolds Average Seq Length
434 214 868 83

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10084055|Ga0105243_100840552
Length 99
Sequence MVEDVIKIDVRRDSARMTGSVTMYTTPWCGYCHRLKGQMDREGIAYDVVDIEEHPEAAQLVESVNGGNQTVPTLVYPDGSAQTNPSVMQVKEKLAALAV

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
99 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
169 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
170 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
171 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
179 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
196 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
209 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
210 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 2643221617 Nocardioides sp. Root79 Isolate Unclassified
213 2643221620 Nocardioides sp. Root240 Isolate Unclassified
214 2738541305 Nocardioides sp. CF167 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.93
Metatranscriptomes 4.38
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.22
Nodule 0
Rhizoplane 6.68
Rhizosphere 84.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10084055 3300009148 Bacteria 2606
2 JGI24740J21852_10052419 3300001979 Bacteria 1162
3 JGI24743J22301_10017313 3300001991 Bacteria 1352
4 JGI24735J21928_10029988 3300002067 Bacteria 1617
5 JGI24735J21928_10210360 3300002067 Bacteria 564
6 JGI24744J21845_10019684 3300002077 Bacteria 1334
7 JGI24742J22300_10081265 3300002244 Bacteria 613
8 JGI25406J46586_10131416 3300003203 Bacteria 734
9 Ga0032354_1053170 3300003693 Bacteria 551
10 Ga0070658_10023505 3300005327 Bacteria 4946
11 Ga0070658_10043809 3300005327 Bacteria 3615
12 Ga0070658_10178866 3300005327 Bacteria 1785
13 Ga0070676_10842945 3300005328 Bacteria 679
14 Ga0070683_100006304 3300005329 Bacteria 9953
15 Ga0070683_100028493 3300005329 Bacteria 5048
16 Ga0070683_100486385 3300005329 Bacteria 1179
17 Ga0070683_100573188 3300005329 Bacteria 1080
18 Ga0070683_100725785 3300005329 Bacteria 952
19 Ga0070683_101167899 3300005329 Bacteria 740
20 Ga0070690_100149081 3300005330 Bacteria 1594
21 Ga0070670_101218179 3300005331 Bacteria 688
22 Ga0068869_100287390 3300005334 Bacteria 1324
23 Ga0068869_100480018 3300005334 Bacteria 1035
24 Ga0068869_100673427 3300005334 Bacteria 880
25 Ga0070680_100036834 3300005336 Bacteria 3952
26 Ga0070682_100050230 3300005337 Bacteria 2603
27 Ga0070682_100202996 3300005337 Bacteria 1400
28 Ga0070682_100871064 3300005337 Bacteria 738
29 Ga0070682_101713319 3300005337 Bacteria 546
30 Ga0070682_101927141 3300005337 Bacteria 518
31 Ga0068868_100034894 3300005338 Bacteria 3885
32 Ga0068868_100108245 3300005338 Bacteria 2256
33 Ga0070660_100015300 3300005339 Bacteria 5535
34 Ga0070660_101406398 3300005339 Bacteria 593
35 Ga0070689_100162626 3300005340 Bacteria 1805
36 Ga0070689_100715517 3300005340 Bacteria 875
37 Ga0070687_100339457 3300005343 Bacteria 966
38 Ga0070687_100453189 3300005343 Bacteria 854
39 Ga0070687_100973019 3300005343 Bacteria 613
40 Ga0070687_101341270 3300005343 Bacteria 533
41 Ga0070692_10002817 3300005345 Bacteria 6865
42 Ga0070692_10006745 3300005345 Bacteria 5005
43 Ga0070692_11127242 3300005345 Bacteria 555
44 Ga0070668_100099973 3300005347 Bacteria 2297
45 Ga0070668_100993006 3300005347 Bacteria 754
46 Ga0070669_101278006 3300005353 Bacteria 635
47 Ga0070675_100440774 3300005354 Bacteria 1167
48 Ga0070675_100450458 3300005354 Bacteria 1154
49 Ga0070675_100499624 3300005354 Bacteria 1096
50 Ga0070674_100024440 3300005356 Bacteria 3921
51 Ga0070673_100264420 3300005364 Bacteria 1504
52 Ga0070673_101883609 3300005364 Bacteria 567
53 Ga0070688_100891509 3300005365 Bacteria 701
54 Ga0070659_100001459 3300005366 Bacteria 17030
55 Ga0070659_100059498 3300005366 Bacteria 3017
56 Ga0070659_100392680 3300005366 Bacteria 1170
57 Ga0070667_100224208 3300005367 Bacteria 1674
58 Ga0070667_100442080 3300005367 Bacteria 1187
59 Ga0070667_100724561 3300005367 Bacteria 921
60 Ga0070667_101003231 3300005367 Bacteria 779
61 Ga0070667_101105716 3300005367 Bacteria 741
62 Ga0070714_100923177 3300005435 Bacteria 848
63 Ga0070713_101369723 3300005436 Bacteria 686
64 Ga0070710_10607016 3300005437 Bacteria 762
65 Ga0070701_10004666 3300005438 Bacteria 5579
66 Ga0070700_100003867 3300005441 Bacteria 7771
67 Ga0070678_100198005 3300005456 Bacteria 1656
68 Ga0070662_100573868 3300005457 Bacteria 947
69 Ga0070662_101871482 3300005457 Bacteria 518
70 Ga0070681_10093720 3300005458 Bacteria 2952
71 Ga0070681_11440571 3300005458 Bacteria 613
72 Ga0068867_100005615 3300005459 Bacteria 8887
73 Ga0068867_100905084 3300005459 Bacteria 794
74 Ga0070685_10007163 3300005466 Bacteria 5695
75 Ga0070685_10595322 3300005466 Bacteria 795
76 Ga0070685_10817867 3300005466 Bacteria 688
77 Ga0070679_100172108 3300005530 Bacteria 2138
78 Ga0070684_100006786 3300005535 Bacteria 8878
79 Ga0070684_100091213 3300005535 Bacteria 2710
80 Ga0070684_100158899 3300005535 Bacteria 2050
81 Ga0070684_100355092 3300005535 Bacteria 1349
82 Ga0068853_100032975 3300005539 Bacteria 4391
83 Ga0068853_100796028 3300005539 Bacteria 905
84 Ga0068853_101043162 3300005539 Bacteria 788
85 Ga0070672_100056472 3300005543 Bacteria 3079
86 Ga0070686_100046036 3300005544 Bacteria 2750
87 Ga0070695_100859627 3300005545 Bacteria 730
88 Ga0070696_100394692 3300005546 Bacteria 1081
89 Ga0070693_100327052 3300005547 Bacteria 1042
90 Ga0070665_100002897 3300005548 Bacteria 18543
91 Ga0070665_102357353 3300005548 Bacteria 535
92 Ga0070664_100159177 3300005564 Bacteria 1997
93 Ga0070664_100401186 3300005564 Bacteria 1254
94 Ga0068857_100216966 3300005577 Bacteria 1747
95 Ga0068854_100213236 3300005578 Bacteria 1524
96 Ga0068856_100056425 3300005614 Bacteria 3875
97 Ga0068856_100718611 3300005614 Bacteria 1019
98 Ga0070702_100003365 3300005615 Bacteria 7141
99 Ga0070702_100138139 3300005615 Bacteria 1549
100 Ga0070702_101013977 3300005615 Bacteria 658
101 Ga0070702_101460906 3300005615 Bacteria 561
102 Ga0068852_100019830 3300005616 Bacteria 5333
103 Ga0068852_100061219 3300005616 Bacteria 3271
104 Ga0068864_100062141 3300005618 Bacteria 3236
105 Ga0068864_100432489 3300005618 Bacteria 1256
106 Ga0068864_100434447 3300005618 Bacteria 1253
107 Ga0068864_100644756 3300005618 Bacteria 1031
108 Ga0068864_101606326 3300005618 Bacteria 654
109 Ga0068866_10067469 3300005718 Bacteria 1878
110 Ga0068866_10126133 3300005718 Bacteria 1449
111 Ga0068861_100066272 3300005719 Bacteria 2784
112 Ga0068861_100185243 3300005719 Bacteria 1736
113 Ga0068861_101868403 3300005719 Bacteria 597
114 Ga0068863_100074959 3300005841 Bacteria 3201
115 Ga0068863_100085856 3300005841 Bacteria 2982
116 Ga0068858_100041974 3300005842 Bacteria 4241
117 Ga0068858_100139557 3300005842 Bacteria 2275
118 Ga0068858_100754822 3300005842 Bacteria 948
119 Ga0068860_100134109 3300005843 Bacteria 2378
120 Ga0068860_100356519 3300005843 Bacteria 1440
121 Ga0068860_100837755 3300005843 Bacteria 934
122 Ga0068860_100902636 3300005843 Bacteria 900
123 Ga0068862_100040216 3300005844 Bacteria 3975
124 Ga0068862_100728170 3300005844 Bacteria 963
125 Ga0081539_10006184 3300005985 Bacteria 11637
126 Ga0081539_10137971 3300005985 Bacteria 1188
127 Ga0081539_10176993 3300005985 Bacteria 1004
128 Ga0075365_10056729 3300006038 Bacteria 2604
129 Ga0075365_10127400 3300006038 Bacteria 1760
130 Ga0075365_10178826 3300006038 Bacteria 1483
131 Ga0075368_10149756 3300006042 Bacteria 974
132 Ga0075363_100057689 3300006048 Bacteria 2084
133 Ga0075363_100064820 3300006048 Bacteria 1974
134 Ga0075363_101059830 3300006048 Bacteria 501
135 Ga0075364_10025396 3300006051 Bacteria 3771
136 Ga0075364_10693685 3300006051 Bacteria 695
137 Ga0075364_10710722 3300006051 Bacteria 686
138 Ga0070716_100994615 3300006173 Bacteria 663
139 Ga0075367_10031309 3300006178 Bacteria 3054
140 Ga0075367_10778513 3300006178 Bacteria 609
141 Ga0075369_10602505 3300006186 Bacteria 526
142 Ga0075370_10075097 3300006353 Bacteria 1938
143 Ga0075370_10306413 3300006353 Bacteria 945
144 Ga0068871_101152759 3300006358 Bacteria 726
145 Ga0068865_100251163 3300006881 Bacteria 1396
146 Ga0068865_100585742 3300006881 Bacteria 941
147 Ga0068865_101051650 3300006881 Bacteria 715
148 Ga0068865_101811898 3300006881 Bacteria 552
149 Ga0105240_11283174 3300009093 Bacteria 773
150 Ga0105245_10007353 3300009098 Bacteria 9644
151 Ga0105245_10043539 3300009098 Bacteria 4004
152 Ga0105245_11067044 3300009098 Bacteria 853
153 Ga0105245_11187142 3300009098 Bacteria 811
154 Ga0105245_11624934 3300009098 Bacteria 698
155 Ga0105247_10205908 3300009101 Bacteria 1324
156 Ga0105243_10003758 3300009148 Bacteria 12169
157 Ga0105243_10263013 3300009148 Bacteria 1545
158 Ga0105243_10796592 3300009148 Bacteria 931
159 Ga0105243_11566922 3300009148 Bacteria 684
160 Ga0105242_10073485 3300009176 Bacteria 2843
161 Ga0105242_10825133 3300009176 Bacteria 920
162 Ga0105242_10880893 3300009176 Bacteria 893
163 Ga0105242_12050929 3300009176 Bacteria 615
164 Ga0105242_12366929 3300009176 Bacteria 578
165 Ga0105248_10026920 3300009177 Bacteria 6394
166 Ga0105248_10485437 3300009177 Bacteria 1393
167 Ga0105248_10815872 3300009177 Bacteria 1053
168 Ga0105248_11039821 3300009177 Bacteria 925
169 Ga0105237_10403863 3300009545 Bacteria 1371
170 Ga0105249_10093032 3300009553 Bacteria 2823
171 Ga0105249_10109157 3300009553 Bacteria 2613
172 Ga0105249_10602466 3300009553 Bacteria 1153
173 Ga0105249_11037782 3300009553 Bacteria 889
174 Ga0105239_10049411 3300010375 Bacteria 4613
175 Ga0105239_10973698 3300010375 Bacteria 975
176 Ga0105239_11094197 3300010375 Bacteria 917
177 Ga0105239_12219347 3300010375 Bacteria 638
178 Ga0105246_10013640 3300011119 Bacteria 5098
179 Ga0105246_10023092 3300011119 Bacteria 4021
180 Ga0157371_10423195 3300013102 Bacteria 977
181 Ga0157371_11350598 3300013102 Bacteria 553
182 Ga0157369_10017474 3300013105 Bacteria 8060
183 Ga0157374_11048829 3300013296 Bacteria 835
184 Ga0157374_11174992 3300013296 Bacteria 788
185 Ga0157378_10447568 3300013297 Bacteria 1281
186 Ga0157378_11427582 3300013297 Bacteria 735
187 Ga0157378_12420352 3300013297 Bacteria 577
188 Ga0163162_10137574 3300013306 Bacteria 2554
189 Ga0163162_13134557 3300013306 Bacteria 531
190 Ga0163162_13383694 3300013306 Bacteria 509
191 Ga0157372_10007897 3300013307 Bacteria 11308
192 Ga0157372_10018178 3300013307 Bacteria 7558
193 Ga0157372_11714744 3300013307 Bacteria 723
194 Ga0157372_12529168 3300013307 Bacteria 589
195 Ga0157372_12705575 3300013307 Bacteria 569
196 Ga0157375_10090971 3300013308 Bacteria 3111
197 Ga0157375_11021221 3300013308 Bacteria 966
198 Ga0157375_11044449 3300013308 Bacteria 955
199 Ga0157375_11182570 3300013308 Bacteria 897
200 Ga0163163_10031037 3300014325 Bacteria 5154
201 Ga0163163_10220113 3300014325 Bacteria 1947
202 Ga0163163_10307822 3300014325 Bacteria 1637
203 Ga0163163_10537917 3300014325 Bacteria 1231
204 Ga0163163_10614558 3300014325 Bacteria 1150
205 Ga0163163_11802372 3300014325 Bacteria 672
206 Ga0157380_12881055 3300014326 Bacteria 547
207 Ga0157377_10007185 3300014745 Bacteria 5361
208 Ga0157377_10959233 3300014745 Bacteria 644
209 Ga0157379_10160176 3300014968 Bacteria 2031
210 Ga0157376_11219840 3300014969 Bacteria 781
211 Ga0157376_11499270 3300014969 Bacteria 707
212 Ga0157376_11659069 3300014969 Bacteria 674
213 Ga0163161_11169577 3300017792 Bacteria 664
214 Ga0197907_10155871 3300020069 Bacteria 802
215 Ga0197907_11100591 3300020069 Bacteria 524
216 Ga0206356_10958941 3300020070 Bacteria 524
217 Ga0206356_11260099 3300020070 Bacteria 554
218 Ga0206356_11283935 3300020070 Bacteria 826
219 Ga0206356_11600277 3300020070 Bacteria 657
220 Ga0206349_1415456 3300020075 Bacteria 575
221 Ga0206355_1047726 3300020076 Bacteria 681
222 Ga0206355_1577873 3300020076 Bacteria 854
223 Ga0206354_10601313 3300020081 Bacteria 992
224 Ga0206354_10650940 3300020081 Bacteria 511
225 Ga0206354_10725370 3300020081 Bacteria 743
226 Ga0206354_11321331 3300020081 Bacteria 679
227 Ga0206353_10296533 3300020082 Bacteria 506
228 Ga0206353_10408525 3300020082 Bacteria 666
229 Ga0206353_10965494 3300020082 Bacteria 2031
230 Ga0206353_11616428 3300020082 Bacteria 749
231 Ga0207697_10072054 3300025315 Bacteria 1448
232 Ga0207642_10375699 3300025899 Bacteria 845
233 Ga0207642_10763640 3300025899 Bacteria 613
234 Ga0207688_10063511 3300025901 Bacteria 2083
235 Ga0207688_10672839 3300025901 Bacteria 654
236 Ga0207647_10049587 3300025904 Bacteria 2603
237 Ga0207647_10057032 3300025904 Bacteria 2395
238 Ga0207643_10014254 3300025908 Bacteria 4316
239 Ga0207705_10092174 3300025909 Bacteria 2220
240 Ga0207705_10214161 3300025909 Bacteria 1461
241 Ga0207705_10496021 3300025909 Bacteria 948
242 Ga0207707_10241487 3300025912 Bacteria 1570
243 Ga0207707_11177945 3300025912 Bacteria 621
244 Ga0207695_11706281 3300025913 Bacteria 511
245 Ga0207671_10567340 3300025914 Bacteria 905
246 Ga0207660_10050690 3300025917 Bacteria 2948
247 Ga0207662_10220334 3300025918 Bacteria 1235
248 Ga0207662_10249257 3300025918 Bacteria 1165
249 Ga0207657_10006115 3300025919 Bacteria 12512
250 Ga0207657_10014087 3300025919 Bacteria 7824
251 Ga0207657_10153746 3300025919 Bacteria 1872
252 Ga0207657_11003318 3300025919 Bacteria 640
253 Ga0207652_10031443 3300025921 Bacteria 4458
254 Ga0207652_10573944 3300025921 Bacteria 1013
255 Ga0207681_10812288 3300025923 Bacteria 781
256 Ga0207694_11012222 3300025924 Bacteria 703
257 Ga0207659_11189769 3300025926 Bacteria 655
258 Ga0207687_10007412 3300025927 Bacteria 7223
259 Ga0207687_10048185 3300025927 Bacteria 2957
260 Ga0207687_10899627 3300025927 Bacteria 757
261 Ga0207687_10923666 3300025927 Bacteria 747
262 Ga0207700_11028517 3300025928 Bacteria 737
263 Ga0207690_10183206 3300025932 Bacteria 1578
264 Ga0207690_10362728 3300025932 Bacteria 1148
265 Ga0207706_10181120 3300025933 Bacteria 1850
266 Ga0207686_10086180 3300025934 Bacteria 2062
267 Ga0207686_10151342 3300025934 Bacteria 1616
268 Ga0207709_10040293 3300025935 Bacteria 2796
269 Ga0207709_10191310 3300025935 Bacteria 1454
270 Ga0207709_10259224 3300025935 Bacteria 1274
271 Ga0207670_10109942 3300025936 Bacteria 1984
272 Ga0207670_10923641 3300025936 Bacteria 732
273 Ga0207669_10070185 3300025937 Bacteria 2195
274 Ga0207704_10142217 3300025938 Bacteria 1680
275 Ga0207704_10183447 3300025938 Bacteria 1515
276 Ga0207691_10001843 3300025940 Bacteria 20711
277 Ga0207711_10560661 3300025941 Bacteria 1066
278 Ga0207689_10046574 3300025942 Bacteria 3583
279 Ga0207689_10073439 3300025942 Bacteria 2810
280 Ga0207661_10054668 3300025944 Bacteria 3199
281 Ga0207661_10136000 3300025944 Bacteria 2111
282 Ga0207661_10211080 3300025944 Bacteria 1711
283 Ga0207661_10464074 3300025944 Bacteria 1154
284 Ga0207661_10871760 3300025944 Bacteria 829
285 Ga0207679_10213587 3300025945 Bacteria 1619
286 Ga0207667_10694496 3300025949 Bacteria 1020
287 Ga0207651_10417083 3300025960 Bacteria 1145
288 Ga0207712_10153375 3300025961 Bacteria 1782
289 Ga0207712_10205710 3300025961 Bacteria 1564
290 Ga0207712_10952576 3300025961 Bacteria 760
291 Ga0207668_10059505 3300025972 Bacteria 2677
292 Ga0207668_10783541 3300025972 Bacteria 843
293 Ga0207640_10107045 3300025981 Bacteria 1973
294 Ga0207640_11712266 3300025981 Bacteria 568
295 Ga0207658_10103812 3300025986 Bacteria 2232
296 Ga0207658_10151793 3300025986 Bacteria 1888
297 Ga0207658_10566329 3300025986 Bacteria 1018
298 Ga0207677_10068732 3300026023 Bacteria 2488
299 Ga0207677_10743545 3300026023 Bacteria 874
300 Ga0207703_10040146 3300026035 Bacteria 3744
301 Ga0207703_10269255 3300026035 Bacteria 1543
302 Ga0207703_10277683 3300026035 Bacteria 1520
303 Ga0207639_10030545 3300026041 Bacteria 3951
304 Ga0207639_11413205 3300026041 Bacteria 653
305 Ga0207708_10010065 3300026075 Bacteria 7020
306 Ga0207702_10047472 3300026078 Bacteria 3619
307 Ga0207641_10547877 3300026088 Bacteria 1128
308 Ga0207648_10001531 3300026089 Bacteria 25458
309 Ga0207676_10420961 3300026095 Bacteria 1253
310 Ga0207676_11011074 3300026095 Bacteria 819
311 Ga0207676_11458683 3300026095 Bacteria 681
312 Ga0207674_10002765 3300026116 Bacteria 21883
313 Ga0207674_10796426 3300026116 Bacteria 912
314 Ga0207674_10804401 3300026116 Bacteria 907
315 Ga0207675_100002597 3300026118 Bacteria 17876
316 Ga0207675_101297778 3300026118 Bacteria 748
317 Ga0207675_101337485 3300026118 Bacteria 737
318 Ga0207683_10141402 3300026121 Bacteria 2169
319 Ga0207683_10448512 3300026121 Bacteria 1189
320 Ga0207698_10314342 3300026142 Bacteria 1464
321 Ga0207698_10456896 3300026142 Bacteria 1234
322 Ga0209813_10116801 3300027866 Bacteria 925
323 Ga0207428_10458187 3300027907 Bacteria 929
324 Ga0268266_10007429 3300028379 Bacteria 9890
325 Ga0268265_10020937 3300028380 Bacteria 4572
326 Ga0268265_10051658 3300028380 Bacteria 3104
327 Ga0268264_10064295 3300028381 Bacteria 3087
328 Ga0268264_11038111 3300028381 Bacteria 827
329 Ga0307509_10309797 3300031507 Bacteria 1322
330 Ga0307508_10373388 3300031616 Bacteria 1017
331 Ga0307405_10397219 3300031731 Bacteria 1078
332 Ga0307413_10950257 3300031824 Bacteria 733
333 Ga0307413_10954171 3300031824 Bacteria 732
334 Ga0307410_10061089 3300031852 Bacteria 2578
335 Ga0307410_10366681 3300031852 Bacteria 1155
336 Ga0307406_11274712 3300031901 Bacteria 640
337 Ga0307407_10811842 3300031903 Bacteria 712
338 Ga0307412_10163570 3300031911 Bacteria 1656
339 Ga0307409_100033945 3300031995 Bacteria 3720
340 Ga0307409_100330895 3300031995 Bacteria 1429
341 Ga0307409_101846755 3300031995 Bacteria 634
342 Ga0307416_100108460 3300032002 Bacteria 2439
343 Ga0307416_100362906 3300032002 Bacteria 1471
344 Ga0307416_101420324 3300032002 Bacteria 800
345 Ga0307416_101691094 3300032002 Bacteria 738
346 Ga0307411_10551992 3300032005 Bacteria 983
347 Ga0307411_11160728 3300032005 Bacteria 699
348 Ga0307411_11265916 3300032005 Bacteria 671
349 Ga0307415_100018688 3300032126 Bacteria 4192
350 Ga0307415_100106121 3300032126 Bacteria 2073
351 Ga0373943_0274311 3300035170 Bacteria 952
352 Ga0436365_1083458 3300039437 Bacteria 611
353 Ga0451833_1182108 3300041491 Bacteria 564
354 Ga0451837_0411239 3300041494 Bacteria 619
355 Ga0451837_0453295 3300041494 Bacteria 575
356 Ga0451853_1969612 3300041512 Bacteria 1457
357 Ga0451853_2122473 3300041512 Bacteria 1121
358 Ga0466972_0210192 3300044658 Bacteria 911
359 Ga0466963_0178037 3300044694 Bacteria 1484
360 Ga0466963_0379850 3300044694 Bacteria 996
361 Ga0466963_1272159 3300044694 Bacteria 517
362 Ga0466964_0022932 3300044706 Bacteria 2425
363 Ga0466964_0293795 3300044706 Bacteria 817
364 Ga0466964_0317379 3300044706 Bacteria 790
365 Ga0466960_0011599 3300044901 Bacteria 3694
366 Ga0466960_0345259 3300044901 Bacteria 848
367 Ga0466958_0724175 3300045836 Bacteria 648
368 Ga0466967_0039860 3300045976 Bacteria 4041
369 Ga0466967_0072543 3300045976 Bacteria 3086
370 Ga0495629_0898639 3300046459 Bacteria 581
371 Ga0495620_0237008 3300046515 Bacteria 697
372 Ga0495657_0055835 3300046675 Bacteria 2634
373 Ga0495658_0359339 3300046683 Bacteria 926
374 Ga0495676_0323719 3300047321 Bacteria 1035
375 Ga0496101_0083578 3300048904 Bacteria 2364
376 Ga0496102_0050088 3300048905 Bacteria 3802
377 Ga0496102_0105968 3300048905 Bacteria 2616
378 Ga0496102_1836478 3300048905 Bacteria 523
379 Ga0496106_0227561 3300048909 Bacteria 1488
380 Ga0496107_0189501 3300048910 Bacteria 1528
381 Ga0496107_0205400 3300048910 Bacteria 1464
382 Ga0496107_0937370 3300048910 Bacteria 630
383 Ga0496107_0939811 3300048910 Bacteria 629
384 Ga0496108_0009433 3300048911 Bacteria 7903
385 Ga0496108_0042574 3300048911 Bacteria 3791
386 Ga0496108_0311386 3300048911 Bacteria 1372
387 Ga0496108_0582106 3300048911 Bacteria 976
388 Ga0496109_0022055 3300048912 Bacteria 5637
389 Ga0496109_0052328 3300048912 Bacteria 3721
390 Ga0496109_0162385 3300048912 Bacteria 2093
391 Ga0496109_1553547 3300048912 Bacteria 596
392 Ga0496109_1817979 3300048912 Bacteria 542
393 Ga0496110_0008163 3300048913 Bacteria 8412
394 Ga0496110_0165842 3300048913 Bacteria 2003
395 Ga0496111_0002574 3300048914 Bacteria 10968
396 Ga0496113_0336419 3300048916 Bacteria 1211
397 Ga0496113_0478413 3300048916 Bacteria 1000
398 Ga0496114_0005508 3300048917 Bacteria 9913
399 Ga0496114_0330535 3300048917 Bacteria 1347
400 Ga0496114_0420335 3300048917 Bacteria 1184
401 Ga0496114_0536239 3300048917 Bacteria 1035
402 Ga0496115_0041194 3300048918 Bacteria 3675
403 Ga0496115_0712967 3300048918 Bacteria 788
404 Ga0496126_0640371 3300048929 Bacteria 833
405 Ga0501067_0057300 3300049583 Bacteria 2158
406 Ga0501067_0119716 3300049583 Bacteria 1464
407 Ga0501069_0018918 3300049585 Bacteria 3719
408 Ga0501069_0071248 3300049585 Bacteria 1948
409 Ga0501069_0576247 3300049585 Bacteria 674
410 Ga0501070_0010073 3300049586 Bacteria 7997
411 Ga0501070_0196604 3300049586 Bacteria 1656
412 Ga0501073_0074588 3300049589 Bacteria 2362
413 Ga0501074_0008246 3300049590 Bacteria 7554
414 Ga0501044_0959880 3300049823 Bacteria 728
415 nmdc:mga03n38_221597_c1 3300050490 Bacteria 988
416 nmdc:mga03n38_432232_c1 3300050490 Bacteria 730
417 nmdc:mga00v17_190167_c1 3300050491 Bacteria 1326
418 nmdc:mga00v17_388469_c1 3300050491 Bacteria 907
419 nmdc:mga00v17_429137_c1 3300050491 Bacteria 858
420 nmdc:mga0yw44_129661_c1 3300050492 Bacteria 1631
421 nmdc:mga0yw44_442480_c1 3300050492 Bacteria 881
422 nmdc:mga04h51_182427_c1 3300050495 Bacteria 818
423 nmdc:mga07m45_245475_c1 3300050496 Bacteria 1042
424 nmdc:mga08y16_612166_c1 3300050511 Bacteria 1097
425 Ga0495595_0546954 3300053084 Bacteria 591
426 Ga0495619_0393993 3300053085 Bacteria 957
427 Ga0495619_0665589 3300053085 Bacteria 709
428 Ga0500583_0363113 3300053092 Bacteria 700
429 Ga0500600_0029232 3300053149 Bacteria 3255
430 Ga0587091_213105 3300059511 Bacteria 525
431 Ga0466962_0220430 3300061719 Bacteria 929
432 2644099335 2643221617 Bacteria 5139111
433 2644116471 2643221620 Bacteria 5134593
434 2738867702 2738541305 Bacteria 4910150
435 Ga0105243_10084055
436 JGI24740J21852_10052419
437 JGI24743J22301_10017313
438 JGI24735J21928_10029988
439 JGI24735J21928_10210360
440 JGI24744J21845_10019684
441 JGI24742J22300_10081265
442 JGI25406J46586_10131416
443 Ga0032354_1053170
444 Ga0070658_10023505
445 Ga0070658_10043809
446 Ga0070658_10178866
447 Ga0070676_10842945
448 Ga0070683_100006304
449 Ga0070683_100028493
450 Ga0070683_100486385
451 Ga0070683_100573188
452 Ga0070683_100725785
453 Ga0070683_101167899
454 Ga0070690_100149081
455 Ga0070670_101218179
456 Ga0068869_100287390
457 Ga0068869_100480018
458 Ga0068869_100673427
459 Ga0070680_100036834
460 Ga0070682_100050230
461 Ga0070682_100202996
462 Ga0070682_100871064
463 Ga0070682_101713319
464 Ga0070682_101927141
465 Ga0068868_100034894
466 Ga0068868_100108245
467 Ga0070660_100015300
468 Ga0070660_101406398
469 Ga0070689_100162626
470 Ga0070689_100715517
471 Ga0070687_100339457
472 Ga0070687_100453189
473 Ga0070687_100973019
474 Ga0070687_101341270
475 Ga0070692_10002817
476 Ga0070692_10006745
477 Ga0070692_11127242
478 Ga0070668_100099973
479 Ga0070668_100993006
480 Ga0070669_101278006
481 Ga0070675_100440774
482 Ga0070675_100450458
483 Ga0070675_100499624
484 Ga0070674_100024440
485 Ga0070673_100264420
486 Ga0070673_101883609
487 Ga0070688_100891509
488 Ga0070659_100001459
489 Ga0070659_100059498
490 Ga0070659_100392680
491 Ga0070667_100224208
492 Ga0070667_100442080
493 Ga0070667_100724561
494 Ga0070667_101003231
495 Ga0070667_101105716
496 Ga0070714_100923177
497 Ga0070713_101369723
498 Ga0070710_10607016
499 Ga0070701_10004666
500 Ga0070700_100003867
501 Ga0070678_100198005
502 Ga0070662_100573868
503 Ga0070662_101871482
504 Ga0070681_10093720
505 Ga0070681_11440571
506 Ga0068867_100005615
507 Ga0068867_100905084
508 Ga0070685_10007163
509 Ga0070685_10595322
510 Ga0070685_10817867
511 Ga0070679_100172108
512 Ga0070684_100006786
513 Ga0070684_100091213
514 Ga0070684_100158899
515 Ga0070684_100355092
516 Ga0068853_100032975
517 Ga0068853_100796028
518 Ga0068853_101043162
519 Ga0070672_100056472
520 Ga0070686_100046036
521 Ga0070695_100859627
522 Ga0070696_100394692
523 Ga0070693_100327052
524 Ga0070665_100002897
525 Ga0070665_102357353
526 Ga0070664_100159177
527 Ga0070664_100401186
528 Ga0068857_100216966
529 Ga0068854_100213236
530 Ga0068856_100056425
531 Ga0068856_100718611
532 Ga0070702_100003365
533 Ga0070702_100138139
534 Ga0070702_101013977
535 Ga0070702_101460906
536 Ga0068852_100019830
537 Ga0068852_100061219
538 Ga0068864_100062141
539 Ga0068864_100432489
540 Ga0068864_100434447
541 Ga0068864_100644756
542 Ga0068864_101606326
543 Ga0068866_10067469
544 Ga0068866_10126133
545 Ga0068861_100066272
546 Ga0068861_100185243
547 Ga0068861_101868403
548 Ga0068863_100074959
549 Ga0068863_100085856
550 Ga0068858_100041974
551 Ga0068858_100139557
552 Ga0068858_100754822
553 Ga0068860_100134109
554 Ga0068860_100356519
555 Ga0068860_100837755
556 Ga0068860_100902636
557 Ga0068862_100040216
558 Ga0068862_100728170
559 Ga0081539_10006184
560 Ga0081539_10137971
561 Ga0081539_10176993
562 Ga0075365_10056729
563 Ga0075365_10127400
564 Ga0075365_10178826
565 Ga0075368_10149756
566 Ga0075363_100057689
567 Ga0075363_100064820
568 Ga0075363_101059830
569 Ga0075364_10025396
570 Ga0075364_10693685
571 Ga0075364_10710722
572 Ga0070716_100994615
573 Ga0075367_10031309
574 Ga0075367_10778513
575 Ga0075369_10602505
576 Ga0075370_10075097
577 Ga0075370_10306413
578 Ga0068871_101152759
579 Ga0068865_100251163
580 Ga0068865_100585742
581 Ga0068865_101051650
582 Ga0068865_101811898
583 Ga0105240_11283174
584 Ga0105245_10007353
585 Ga0105245_10043539
586 Ga0105245_11067044
587 Ga0105245_11187142
588 Ga0105245_11624934
589 Ga0105247_10205908
590 Ga0105243_10003758
591 Ga0105243_10263013
592 Ga0105243_10796592
593 Ga0105243_11566922
594 Ga0105242_10073485
595 Ga0105242_10825133
596 Ga0105242_10880893
597 Ga0105242_12050929
598 Ga0105242_12366929
599 Ga0105248_10026920
600 Ga0105248_10485437
601 Ga0105248_10815872
602 Ga0105248_11039821
603 Ga0105237_10403863
604 Ga0105249_10093032
605 Ga0105249_10109157
606 Ga0105249_10602466
607 Ga0105249_11037782
608 Ga0105239_10049411
609 Ga0105239_10973698
610 Ga0105239_11094197
611 Ga0105239_12219347
612 Ga0105246_10013640
613 Ga0105246_10023092
614 Ga0157371_10423195
615 Ga0157371_11350598
616 Ga0157369_10017474
617 Ga0157374_11048829
618 Ga0157374_11174992
619 Ga0157378_10447568
620 Ga0157378_11427582
621 Ga0157378_12420352
622 Ga0163162_10137574
623 Ga0163162_13134557
624 Ga0163162_13383694
625 Ga0157372_10007897
626 Ga0157372_10018178
627 Ga0157372_11714744
628 Ga0157372_12529168
629 Ga0157372_12705575
630 Ga0157375_10090971
631 Ga0157375_11021221
632 Ga0157375_11044449
633 Ga0157375_11182570
634 Ga0163163_10031037
635 Ga0163163_10220113
636 Ga0163163_10307822
637 Ga0163163_10537917
638 Ga0163163_10614558
639 Ga0163163_11802372
640 Ga0157380_12881055
641 Ga0157377_10007185
642 Ga0157377_10959233
643 Ga0157379_10160176
644 Ga0157376_11219840
645 Ga0157376_11499270
646 Ga0157376_11659069
647 Ga0163161_11169577
648 Ga0197907_10155871
649 Ga0197907_11100591
650 Ga0206356_10958941
651 Ga0206356_11260099
652 Ga0206356_11283935
653 Ga0206356_11600277
654 Ga0206349_1415456
655 Ga0206355_1047726
656 Ga0206355_1577873
657 Ga0206354_10601313
658 Ga0206354_10650940
659 Ga0206354_10725370
660 Ga0206354_11321331
661 Ga0206353_10296533
662 Ga0206353_10408525
663 Ga0206353_10965494
664 Ga0206353_11616428
665 Ga0207697_10072054
666 Ga0207642_10375699
667 Ga0207642_10763640
668 Ga0207688_10063511
669 Ga0207688_10672839
670 Ga0207647_10049587
671 Ga0207647_10057032
672 Ga0207643_10014254
673 Ga0207705_10092174
674 Ga0207705_10214161
675 Ga0207705_10496021
676 Ga0207707_10241487
677 Ga0207707_11177945
678 Ga0207695_11706281
679 Ga0207671_10567340
680 Ga0207660_10050690
681 Ga0207662_10220334
682 Ga0207662_10249257
683 Ga0207657_10006115
684 Ga0207657_10014087
685 Ga0207657_10153746
686 Ga0207657_11003318
687 Ga0207652_10031443
688 Ga0207652_10573944
689 Ga0207681_10812288
690 Ga0207694_11012222
691 Ga0207659_11189769
692 Ga0207687_10007412
693 Ga0207687_10048185
694 Ga0207687_10899627
695 Ga0207687_10923666
696 Ga0207700_11028517
697 Ga0207690_10183206
698 Ga0207690_10362728
699 Ga0207706_10181120
700 Ga0207686_10086180
701 Ga0207686_10151342
702 Ga0207709_10040293
703 Ga0207709_10191310
704 Ga0207709_10259224
705 Ga0207670_10109942
706 Ga0207670_10923641
707 Ga0207669_10070185
708 Ga0207704_10142217
709 Ga0207704_10183447
710 Ga0207691_10001843
711 Ga0207711_10560661
712 Ga0207689_10046574
713 Ga0207689_10073439
714 Ga0207661_10054668
715 Ga0207661_10136000
716 Ga0207661_10211080
717 Ga0207661_10464074
718 Ga0207661_10871760
719 Ga0207679_10213587
720 Ga0207667_10694496
721 Ga0207651_10417083
722 Ga0207712_10153375
723 Ga0207712_10205710
724 Ga0207712_10952576
725 Ga0207668_10059505
726 Ga0207668_10783541
727 Ga0207640_10107045
728 Ga0207640_11712266
729 Ga0207658_10103812
730 Ga0207658_10151793
731 Ga0207658_10566329
732 Ga0207677_10068732
733 Ga0207677_10743545
734 Ga0207703_10040146
735 Ga0207703_10269255
736 Ga0207703_10277683
737 Ga0207639_10030545
738 Ga0207639_11413205
739 Ga0207708_10010065
740 Ga0207702_10047472
741 Ga0207641_10547877
742 Ga0207648_10001531
743 Ga0207676_10420961
744 Ga0207676_11011074
745 Ga0207676_11458683
746 Ga0207674_10002765
747 Ga0207674_10796426
748 Ga0207674_10804401
749 Ga0207675_100002597
750 Ga0207675_101297778
751 Ga0207675_101337485
752 Ga0207683_10141402
753 Ga0207683_10448512
754 Ga0207698_10314342
755 Ga0207698_10456896
756 Ga0209813_10116801
757 Ga0207428_10458187
758 Ga0268266_10007429
759 Ga0268265_10020937
760 Ga0268265_10051658
761 Ga0268264_10064295
762 Ga0268264_11038111
763 Ga0307509_10309797
764 Ga0307508_10373388
765 Ga0307405_10397219
766 Ga0307413_10950257
767 Ga0307413_10954171
768 Ga0307410_10061089
769 Ga0307410_10366681
770 Ga0307406_11274712
771 Ga0307407_10811842
772 Ga0307412_10163570
773 Ga0307409_100033945
774 Ga0307409_100330895
775 Ga0307409_101846755
776 Ga0307416_100108460
777 Ga0307416_100362906
778 Ga0307416_101420324
779 Ga0307416_101691094
780 Ga0307411_10551992
781 Ga0307411_11160728
782 Ga0307411_11265916
783 Ga0307415_100018688
784 Ga0307415_100106121
785 Ga0373943_0274311
786 Ga0436365_1083458
787 Ga0451833_1182108
788 Ga0451837_0411239
789 Ga0451837_0453295
790 Ga0451853_1969612
791 Ga0451853_2122473
792 Ga0466972_0210192
793 Ga0466963_0178037
794 Ga0466963_0379850
795 Ga0466963_1272159
796 Ga0466964_0022932
797 Ga0466964_0293795
798 Ga0466964_0317379
799 Ga0466960_0011599
800 Ga0466960_0345259
801 Ga0466958_0724175
802 Ga0466967_0039860
803 Ga0466967_0072543
804 Ga0495629_0898639
805 Ga0495620_0237008
806 Ga0495657_0055835
807 Ga0495658_0359339
808 Ga0495676_0323719
809 Ga0496101_0083578
810 Ga0496102_0050088
811 Ga0496102_0105968
812 Ga0496102_1836478
813 Ga0496106_0227561
814 Ga0496107_0189501
815 Ga0496107_0205400
816 Ga0496107_0937370
817 Ga0496107_0939811
818 Ga0496108_0009433
819 Ga0496108_0042574
820 Ga0496108_0311386
821 Ga0496108_0582106
822 Ga0496109_0022055
823 Ga0496109_0052328
824 Ga0496109_0162385
825 Ga0496109_1553547
826 Ga0496109_1817979
827 Ga0496110_0008163
828 Ga0496110_0165842
829 Ga0496111_0002574
830 Ga0496113_0336419
831 Ga0496113_0478413
832 Ga0496114_0005508
833 Ga0496114_0330535
834 Ga0496114_0420335
835 Ga0496114_0536239
836 Ga0496115_0041194
837 Ga0496115_0712967
838 Ga0496126_0640371
839 Ga0501067_0057300
840 Ga0501067_0119716
841 Ga0501069_0018918
842 Ga0501069_0071248
843 Ga0501069_0576247
844 Ga0501070_0010073
845 Ga0501070_0196604
846 Ga0501073_0074588
847 Ga0501074_0008246
848 Ga0501044_0959880
849 nmdc:mga03n38_221597_c1
850 nmdc:mga03n38_432232_c1
851 nmdc:mga00v17_190167_c1
852 nmdc:mga00v17_388469_c1
853 nmdc:mga00v17_429137_c1
854 nmdc:mga0yw44_129661_c1
855 nmdc:mga0yw44_442480_c1
856 nmdc:mga04h51_182427_c1
857 nmdc:mga07m45_245475_c1
858 nmdc:mga08y16_612166_c1
859 Ga0495595_0546954
860 Ga0495619_0393993
861 Ga0495619_0665589
862 Ga0500583_0363113
863 Ga0500600_0029232
864 Ga0587091_213105
865 Ga0466962_0220430
866 2644099335
867 2644116471
868 2738867702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

21

80

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2lqq-assembly1.cif.gz_A oxidized mrx1 0.9298 5 82
2lqo-assembly1.cif.gz_A mrx1 reduced 0.8949 2 83
3zmk-assembly1.cif.gz_A anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa 0.8913 5 67
1h75-assembly1.cif.gz_A structural basis for the thioredoxin-like activity profile of the glutaredoxin-like protein nrdh-redoxin from escherichia coli. 0.889 4 67
3zit-assembly1.cif.gz_B crystal structure of the thioredoxin-like protein bc3987 mutant t8a 0.883 5 76
ID Description Score Start End Superfamily
2lqoA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8949 2 83 3.40.30.10
1h75A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.889 4 67 3.40.30.10
2m46A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8818 5 35 3.40.30.10
2lqoA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8753 2 83 3.40.30.10
4fiwA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.864 5 76 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1H1XH04-F1-model_v4 Mycoredoxin 1.009 5 81 GO:0009055
GO:0045454
AF-A0A7Y9E4E2-F1-model_v4 Mycoredoxin (EC 1.20.4.3) 1.008 5 81 GO:0009055
GO:0016491
GO:0045454
AF-X8AR78-F1-model_v4 deleted 1.007 5 83
AF-A0A0Q6JM06-F1-model_v4 NrdH-redoxin 1.007 7 79
AF-A0A0H5P638-F1-model_v4 Glutaredoxin 3 1.006 5 81 GO:0009055
GO:0045454

Map