F443013

General Info

Members Datasets Scaffolds Average Seq Length
434 189 868 208

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100213256|Ga0070670_1002132562
Length 252
Sequence MLFPWVPLRIIRARPAEANGVIIRCVKSTVLVLNLDLIREGSTMRFNKTPFVLLAVILLVAGISVGQDKEKSLGSIKGKVRVETGTPSGVSVVVRRGDTEVKRVTTDKNGDFVASGLTPGKYGLTFRKPGLSIGTMEDIEVKSGKTRSLGDRLILTIDEGSIAFVSGSVFSADGHSVPNAKVELSRLLDDGTTKKIDGRVTTETGSFKFRLSPEPGKYRVTVKRDGSEPVTKDVEVDGAAIYRIALSLPPKQ

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
156 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
161 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
162 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
163 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
166 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
167 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
168 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
169 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
170 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
171 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
172 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
173 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
174 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
175 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
176 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
177 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
178 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
179 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
180 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
181 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.69
Rhizosphere 99.08
Stem 0
Stem Tuber 0
Unclassified 41.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100213256 3300005331 Unclassified 1679
2 MRS1b_contig_5818974 2162886011 Unclassified 2139
3 JGI24751J29686_10000038 3300002459 Bacteria 80932
4 Ga0065714_10064462 3300005288 Bacteria 66145
5 Ga0065704_10102168 3300005289 Bacteria 2213
6 Ga0065704_10219309 3300005289 Bacteria 1080
7 Ga0065712_10000135 3300005290 Bacteria 66145
8 Ga0065712_10003714 3300005290 Bacteria 5026
9 Ga0065712_10352288 3300005290 Unclassified 777
10 Ga0065715_10003646 3300005293 Bacteria 3911
11 Ga0065715_10006106 3300005293 Bacteria 4098
12 Ga0065715_10093366 3300005293 Bacteria 4712
13 Ga0065715_10093522 3300005293 Bacteria 4653
14 Ga0065715_10116102 3300005293 Bacteria 2326
15 Ga0065715_10183238 3300005293 Unclassified 1462
16 Ga0065707_10024097 3300005295 Bacteria 1634
17 Ga0065707_10261615 3300005295 Unclassified 1091
18 Ga0070676_10023101 3300005328 Unclassified 3493
19 Ga0070690_100003785 3300005330 Bacteria 8332
20 Ga0070690_100006838 3300005330 Bacteria 6488
21 Ga0070670_100000073 3300005331 Bacteria 98443
22 Ga0070670_100251376 3300005331 Bacteria 1540
23 Ga0070670_100501549 3300005331 Bacteria 1079
24 Ga0070670_100928936 3300005331 Unclassified 789
25 Ga0070677_10018214 3300005333 Bacteria 2527
26 Ga0068869_100054789 3300005334 Bacteria 2904
27 Ga0068869_100128086 3300005334 Bacteria 1949
28 Ga0068869_100247347 3300005334 Unclassified 1423
29 Ga0068869_100252185 3300005334 Unclassified 1410
30 Ga0070666_10190307 3300005335 Unclassified 1442
31 Ga0070680_100086265 3300005336 Unclassified 2595
32 Ga0070682_100002638 3300005337 Bacteria 9908
33 Ga0070682_100017752 3300005337 Unclassified 4150
34 Ga0068868_100061268 3300005338 Unclassified 2980
35 Ga0070689_100103239 3300005340 Bacteria 2259
36 Ga0070689_100705960 3300005340 Bacteria 881
37 Ga0070687_100144314 3300005343 Bacteria 1390
38 Ga0070687_100213682 3300005343 Unclassified 1177
39 Ga0070692_10251846 3300005345 Unclassified 1058
40 Ga0070692_10299388 3300005345 Unclassified 981
41 Ga0070669_100004686 3300005353 Bacteria 9870
42 Ga0070669_100041824 3300005353 Bacteria 3334
43 Ga0070669_100263514 3300005353 Bacteria 1376
44 Ga0070669_100437479 3300005353 Unclassified 1076
45 Ga0070675_100221663 3300005354 Bacteria 1647
46 Ga0070671_100041363 3300005355 Bacteria 3830
47 Ga0070671_100356378 3300005355 Unclassified 1249
48 Ga0070673_100383138 3300005364 Unclassified 1254
49 Ga0070659_100400988 3300005366 Unclassified 1158
50 Ga0070659_100946619 3300005366 Unclassified 754
51 Ga0070667_100129399 3300005367 Unclassified 2202
52 Ga0070703_10002255 3300005406 Bacteria 5603
53 Ga0070701_10104864 3300005438 Unclassified 1571
54 Ga0070705_100006875 3300005440 Bacteria 5590
55 Ga0070705_100039786 3300005440 Bacteria 2670
56 Ga0070705_100076998 3300005440 Bacteria 2036
57 Ga0070705_100123925 3300005440 Bacteria 1674
58 Ga0070705_100143258 3300005440 Unclassified 1576
59 Ga0070700_100061103 3300005441 Bacteria 2376
60 Ga0070700_100078144 3300005441 Bacteria 2130
61 Ga0070700_100086117 3300005441 Unclassified 2039
62 Ga0070700_100180641 3300005441 Unclassified 1468
63 Ga0070694_100014607 3300005444 Unclassified 4917
64 Ga0070694_100032823 3300005444 Bacteria 3411
65 Ga0070694_100103578 3300005444 Unclassified 2016
66 Ga0070694_100133951 3300005444 Bacteria 1793
67 Ga0070694_100152851 3300005444 Unclassified 1687
68 Ga0070708_100336673 3300005445 Bacteria 1422
69 Ga0070662_100108223 3300005457 Bacteria 2114
70 Ga0070662_100162413 3300005457 Unclassified 1748
71 Ga0070681_10034397 3300005458 Bacteria 5088
72 Ga0068867_100044784 3300005459 Bacteria 3242
73 Ga0068867_100074506 3300005459 Bacteria 2544
74 Ga0068867_100109857 3300005459 Unclassified 2117
75 Ga0070685_10172867 3300005466 Unclassified 1385
76 Ga0070685_10186239 3300005466 Bacteria 1340
77 Ga0070706_100000015 3300005467 Bacteria 188425
78 Ga0070706_100049515 3300005467 Bacteria 3877
79 Ga0070707_100057837 3300005468 Bacteria 3720
80 Ga0070707_100068484 3300005468 Bacteria 3416
81 Ga0070707_100259178 3300005468 Archaea 1692
82 Ga0070698_100003969 3300005471 Bacteria 16281
83 Ga0070698_100020333 3300005471 Bacteria 6957
84 Ga0070698_100024607 3300005471 Bacteria 6281
85 Ga0070698_100076483 3300005471 Bacteria 3349
86 Ga0070698_100103698 3300005471 Bacteria 2814
87 Ga0070698_100973964 3300005471 Unclassified 795
88 Ga0070699_100003349 3300005518 Bacteria 14182
89 Ga0070699_100086453 3300005518 Bacteria 2736
90 Ga0070699_100147197 3300005518 Bacteria 2081
91 Ga0070699_100187637 3300005518 Bacteria 1836
92 Ga0070699_100276141 3300005518 Unclassified 1505
93 Ga0070699_100450011 3300005518 Bacteria 1168
94 Ga0070679_100212204 3300005530 Bacteria 1899
95 Ga0070697_100000170 3300005536 Bacteria 52782
96 Ga0070697_100044601 3300005536 Bacteria 3592
97 Ga0070697_100122547 3300005536 Unclassified 2176
98 Ga0070697_100467555 3300005536 Bacteria 1100
99 Ga0070672_100399320 3300005543 Unclassified 1178
100 Ga0070686_100004999 3300005544 Bacteria 7318
101 Ga0070695_100093855 3300005545 Bacteria 2009
102 Ga0070695_100265519 3300005545 Unclassified 1255
103 Ga0070695_100332355 3300005545 Unclassified 1133
104 Ga0070696_100015611 3300005546 Bacteria 5103
105 Ga0070696_100025405 3300005546 Unclassified 4027
106 Ga0070696_100057051 3300005546 Unclassified 2725
107 Ga0070696_100257845 3300005546 Bacteria 1321
108 Ga0070696_100382098 3300005546 Unclassified 1098
109 Ga0070696_100489927 3300005546 Bacteria 976
110 Ga0070693_100004504 3300005547 Bacteria 6595
111 Ga0070693_100321430 3300005547 Bacteria 1050
112 Ga0070693_100437801 3300005547 Unclassified 915
113 Ga0070704_100051406 3300005549 Bacteria 2902
114 Ga0070704_100126068 3300005549 Bacteria 1976
115 Ga0070704_100389106 3300005549 Bacteria 1187
116 Ga0070704_100660479 3300005549 Unclassified 924
117 Ga0070704_100796559 3300005549 Unclassified 844
118 Ga0070704_100880105 3300005549 Unclassified 804
119 Ga0070664_100136848 3300005564 Bacteria 2154
120 Ga0070664_100239415 3300005564 Unclassified 1629
121 Ga0068857_100117789 3300005577 Bacteria 2390
122 Ga0068857_100182145 3300005577 Bacteria 1912
123 Ga0068857_100887041 3300005577 Unclassified 855
124 Ga0068857_101121486 3300005577 Unclassified 760
125 Ga0068854_100102754 3300005578 Bacteria 2145
126 Ga0068854_100124193 3300005578 Unclassified 1964
127 Ga0070702_100052711 3300005615 Bacteria 2334
128 Ga0070702_100503843 3300005615 Unclassified 890
129 Ga0068852_100372244 3300005616 Unclassified 1400
130 Ga0068852_100670194 3300005616 Unclassified 1046
131 Ga0068859_100007056 3300005617 Bacteria 11410
132 Ga0068859_100018005 3300005617 Bacteria 7099
133 Ga0068859_100047951 3300005617 Bacteria 4292
134 Ga0068859_100187818 3300005617 Bacteria 2150
135 Ga0068859_100195792 3300005617 Unclassified 2105
136 Ga0068859_100198912 3300005617 Bacteria 2088
137 Ga0068859_100243379 3300005617 Unclassified 1888
138 Ga0068859_100307846 3300005617 Bacteria 1678
139 Ga0068859_100595688 3300005617 Unclassified 1199
140 Ga0068859_100916820 3300005617 Unclassified 960
141 Ga0068864_100037249 3300005618 Bacteria 4150
142 Ga0068864_100041810 3300005618 Bacteria 3920
143 Ga0068864_100078387 3300005618 Bacteria 2891
144 Ga0068864_100091661 3300005618 Unclassified 2682
145 Ga0068866_10020652 3300005718 Bacteria 3021
146 Ga0068861_100000514 3300005719 Bacteria 22601
147 Ga0068861_100080703 3300005719 Unclassified 2545
148 Ga0068861_100114186 3300005719 Bacteria 2168
149 Ga0068861_100118520 3300005719 Unclassified 2132
150 Ga0068851_10002464 3300005834 Bacteria 8132
151 Ga0068870_10062621 3300005840 Bacteria 2004
152 Ga0068870_10168176 3300005840 Unclassified 1306
153 Ga0068870_10273734 3300005840 Bacteria 1056
154 Ga0068863_100099882 3300005841 Unclassified 2758
155 Ga0068863_100134065 3300005841 Bacteria 2366
156 Ga0068858_100025314 3300005842 Bacteria 5522
157 Ga0068858_100152980 3300005842 Bacteria 2170
158 Ga0068858_100404402 3300005842 Bacteria 1312
159 Ga0068860_100044762 3300005843 Unclassified 4217
160 Ga0068860_100292184 3300005843 Bacteria 1595
161 Ga0068860_100421572 3300005843 Bacteria 1323
162 Ga0068860_101365463 3300005843 Unclassified 730
163 Ga0068862_100508408 3300005844 Unclassified 1145
164 Ga0068862_100595591 3300005844 Unclassified 1061
165 Ga0068862_100630451 3300005844 Bacteria 1032
166 Ga0070716_100011891 3300006173 Bacteria 4396
167 Ga0070716_100059493 3300006173 Unclassified 2203
168 Ga0097621_100001343 3300006237 Bacteria 16907
169 Ga0097621_100008105 3300006237 Bacteria 7549
170 Ga0097621_100093420 3300006237 Bacteria 2521
171 Ga0068871_100002147 3300006358 Bacteria 13383
172 Ga0068871_100093210 3300006358 Bacteria 2512
173 Ga0068871_100538186 3300006358 Unclassified 1057
174 Ga0075428_100238346 3300006844 Bacteria 1963
175 Ga0075430_100211667 3300006846 Unclassified 1608
176 Ga0075433_10026070 3300006852 Unclassified 4944
177 Ga0075433_10037126 3300006852 Bacteria 4201
178 Ga0075433_10173617 3300006852 Bacteria 1918
179 Ga0075434_100073038 3300006871 Bacteria 3423
180 Ga0075434_100329263 3300006871 Unclassified 1548
181 Ga0075434_100542779 3300006871 Unclassified 1182
182 Ga0075429_100500679 3300006880 Unclassified 1065
183 Ga0068865_100003476 3300006881 Bacteria 9439
184 Ga0075436_100154057 3300006914 Bacteria 1618
185 Ga0075436_100415543 3300006914 Bacteria 976
186 Ga0097620_100007056 3300006931 Bacteria 11410
187 Ga0097620_100018005 3300006931 Bacteria 7099
188 Ga0097620_100047950 3300006931 Bacteria 4292
189 Ga0097620_100187830 3300006931 Bacteria 2150
190 Ga0097620_100195783 3300006931 Unclassified 2105
191 Ga0097620_100198918 3300006931 Bacteria 2088
192 Ga0097620_100243388 3300006931 Unclassified 1888
193 Ga0097620_100307849 3300006931 Bacteria 1678
194 Ga0097620_100595658 3300006931 Unclassified 1199
195 Ga0097620_100916856 3300006931 Unclassified 960
196 Ga0075435_100058203 3300007076 Bacteria 3129
197 Ga0105251_10064446 3300009011 Unclassified 1718
198 Ga0105240_10221262 3300009093 Bacteria 2205
199 Ga0111539_10006562 3300009094 Bacteria 14995
200 Ga0111539_10083651 3300009094 Bacteria 3752
201 Ga0111539_10157601 3300009094 Bacteria 2656
202 Ga0105247_10039556 3300009101 Bacteria 2881
203 Ga0105247_10112857 3300009101 Bacteria 1751
204 Ga0105247_10233670 3300009101 Unclassified 1249
205 Ga0105247_10301494 3300009101 Unclassified 1112
206 Ga0105247_10395239 3300009101 Unclassified 983
207 Ga0114129_10014283 3300009147 Bacteria 11317
208 Ga0114129_10575480 3300009147 Bacteria 1462
209 Ga0114129_11034112 3300009147 Bacteria 1032
210 Ga0105243_10002227 3300009148 Bacteria 16311
211 Ga0105243_10214990 3300009148 Bacteria 1695
212 Ga0105243_10225160 3300009148 Bacteria 1660
213 Ga0105243_10248569 3300009148 Bacteria 1587
214 Ga0105243_10550461 3300009148 Unclassified 1102
215 Ga0105243_11028441 3300009148 Unclassified 828
216 Ga0105241_10050616 3300009174 Unclassified 3166
217 Ga0105241_10238950 3300009174 Bacteria 1535
218 Ga0105241_10280586 3300009174 Bacteria 1423
219 Ga0105241_10477041 3300009174 Unclassified 1108
220 Ga0105241_10600630 3300009174 Unclassified 994
221 Ga0105241_10616815 3300009174 Unclassified 981
222 Ga0105241_10749911 3300009174 Unclassified 895
223 Ga0105242_10615994 3300009176 Unclassified 1051
224 Ga0105248_10004845 3300009177 Bacteria 14901
225 Ga0105248_10013683 3300009177 Bacteria 8932
226 Ga0105248_10147482 3300009177 Bacteria 2655
227 Ga0105237_10001132 3300009545 Bacteria 35782
228 Ga0105238_10003575 3300009551 Bacteria 15496
229 Ga0105238_10045209 3300009551 Bacteria 4449
230 Ga0105249_10117923 3300009553 Bacteria 2518
231 Ga0105239_10149099 3300010375 Bacteria 2610
232 Ga0105239_10345966 3300010375 Bacteria 1678
233 Ga0105239_11298957 3300010375 Unclassified 839
234 Ga0105246_10009140 3300011119 Bacteria 6102
235 Ga0105246_10011134 3300011119 Bacteria 5574
236 Ga0105246_10126816 3300011119 Unclassified 1900
237 Ga0157373_10001035 3300013100 Bacteria 21421
238 Ga0157373_10027644 3300013100 Bacteria 4093
239 Ga0157373_10214070 3300013100 Unclassified 1359
240 Ga0157373_10226258 3300013100 Unclassified 1320
241 Ga0157378_10036749 3300013297 Bacteria 4334
242 Ga0157378_10070833 3300013297 Bacteria 3131
243 Ga0157378_10086425 3300013297 Unclassified 2843
244 Ga0157378_10134061 3300013297 Bacteria 2295
245 Ga0163162_10015778 3300013306 Bacteria 7383
246 Ga0163162_10058418 3300013306 Bacteria 3886
247 Ga0163162_10401899 3300013306 Bacteria 1502
248 Ga0163162_10479069 3300013306 Unclassified 1376
249 Ga0157372_10016829 3300013307 Bacteria 7850
250 Ga0157372_10536742 3300013307 Bacteria 1363
251 Ga0163163_10000466 3300014325 Bacteria 36943
252 Ga0163163_10006281 3300014325 Bacteria 10372
253 Ga0163163_10015075 3300014325 Bacteria 7131
254 Ga0163163_10239432 3300014325 Unclassified 1864
255 Ga0163163_10246454 3300014325 Bacteria 1837
256 Ga0163163_10307906 3300014325 Unclassified 1637
257 Ga0157380_10069455 3300014326 Unclassified 2842
258 Ga0157380_10076757 3300014326 Bacteria 2720
259 Ga0157380_10079307 3300014326 Bacteria 2681
260 Ga0157380_10109395 3300014326 Bacteria 2319
261 Ga0157380_10388295 3300014326 Bacteria 1320
262 Ga0157377_10054588 3300014745 Unclassified 2262
263 Ga0157379_10034888 3300014968 Bacteria 4485
264 Ga0157379_10804146 3300014968 Unclassified 888
265 Ga0163161_10013239 3300017792 Bacteria 5734
266 Ga0163161_10617450 3300017792 Unclassified 895
267 Ga0207697_10005816 3300025315 Bacteria 5678
268 Ga0207653_10000946 3300025885 Bacteria 9605
269 Ga0207642_10326859 3300025899 Unclassified 897
270 Ga0207710_10032533 3300025900 Bacteria 2284
271 Ga0207647_10052253 3300025904 Bacteria 2523
272 Ga0207647_10117373 3300025904 Unclassified 1571
273 Ga0207645_10063676 3300025907 Bacteria 2356
274 Ga0207645_10366170 3300025907 Unclassified 966
275 Ga0207643_10006728 3300025908 Bacteria 6166
276 Ga0207643_10122084 3300025908 Bacteria 1544
277 Ga0207684_10000083 3300025910 Bacteria 176092
278 Ga0207684_10020786 3300025910 Bacteria 5608
279 Ga0207684_10030277 3300025910 Bacteria 4608
280 Ga0207654_10045308 3300025911 Bacteria 2502
281 Ga0207654_10104590 3300025911 Bacteria 1750
282 Ga0207707_10003754 3300025912 Bacteria 13463
283 Ga0207695_10129392 3300025913 Unclassified 2483
284 Ga0207671_10005003 3300025914 Bacteria 12412
285 Ga0207660_11097462 3300025917 Unclassified 648
286 Ga0207662_10025951 3300025918 Unclassified 3377
287 Ga0207662_10098043 3300025918 Unclassified 1813
288 Ga0207662_10206428 3300025918 Bacteria 1274
289 Ga0207662_10515834 3300025918 Bacteria 824
290 Ga0207652_10705895 3300025921 Bacteria 900
291 Ga0207646_10044382 3300025922 Bacteria 3990
292 Ga0207681_10105819 3300025923 Bacteria 2037
293 Ga0207681_10139146 3300025923 Bacteria 1806
294 Ga0207694_10163019 3300025924 Unclassified 1802
295 Ga0207694_10199051 3300025924 Bacteria 1629
296 Ga0207650_10000006 3300025925 Bacteria 544730
297 Ga0207650_10003376 3300025925 Bacteria 10991
298 Ga0207650_10401076 3300025925 Unclassified 1135
299 Ga0207659_10184424 3300025926 Unclassified 1656
300 Ga0207659_10332489 3300025926 Unclassified 1256
301 Ga0207644_10052707 3300025931 Bacteria 2925
302 Ga0207690_10279402 3300025932 Unclassified 1300
303 Ga0207690_10762941 3300025932 Unclassified 798
304 Ga0207706_10081937 3300025933 Bacteria 2836
305 Ga0207706_10191382 3300025933 Unclassified 1796
306 Ga0207686_10031345 3300025934 Bacteria 3155
307 Ga0207686_10406424 3300025934 Unclassified 1038
308 Ga0207709_10008696 3300025935 Bacteria 5603
309 Ga0207709_10031887 3300025935 Bacteria 3082
310 Ga0207709_10144755 3300025935 Bacteria 1638
311 Ga0207670_10005499 3300025936 Bacteria 6963
312 Ga0207670_10107986 3300025936 Bacteria 2000
313 Ga0207665_10016736 3300025939 Bacteria 4816
314 Ga0207691_10003837 3300025940 Bacteria 14582
315 Ga0207711_10014323 3300025941 Bacteria 6586
316 Ga0207711_10057841 3300025941 Bacteria 3334
317 Ga0207711_10062826 3300025941 Bacteria 3204
318 Ga0207711_10310781 3300025941 Unclassified 1455
319 Ga0207711_10350233 3300025941 Unclassified 1367
320 Ga0207711_10811382 3300025941 Unclassified 871
321 Ga0207689_10003448 3300025942 Bacteria 14439
322 Ga0207689_10006130 3300025942 Bacteria 10638
323 Ga0207689_10114391 3300025942 Unclassified 2218
324 Ga0207689_10259619 3300025942 Unclassified 1437
325 Ga0207689_10338085 3300025942 Unclassified 1250
326 Ga0207651_10240920 3300025960 Bacteria 1474
327 Ga0207712_10107561 3300025961 Bacteria 2085
328 Ga0207712_10672961 3300025961 Unclassified 901
329 Ga0207640_10159119 3300025981 Bacteria 1669
330 Ga0207640_10391246 3300025981 Unclassified 1129
331 Ga0207640_10395738 3300025981 Unclassified 1124
332 Ga0207658_11001678 3300025986 Unclassified 762
333 Ga0207677_10062880 3300026023 Bacteria 2577
334 Ga0207703_10023440 3300026035 Bacteria 4848
335 Ga0207703_10086227 3300026035 Unclassified 2630
336 Ga0207703_10134022 3300026035 Unclassified 2142
337 Ga0207639_10726331 3300026041 Unclassified 922
338 Ga0207708_10000016 3300026075 Bacteria 193989
339 Ga0207708_10015453 3300026075 Bacteria 5725
340 Ga0207708_10046071 3300026075 Unclassified 3322
341 Ga0207708_10051279 3300026075 Unclassified 3140
342 Ga0207708_10051507 3300026075 Bacteria 3134
343 Ga0207708_10306422 3300026075 Unclassified 1293
344 Ga0207641_10045554 3300026088 Unclassified 3694
345 Ga0207641_10053148 3300026088 Unclassified 3432
346 Ga0207641_10135111 3300026088 Unclassified 2219
347 Ga0207641_10152055 3300026088 Unclassified 2097
348 Ga0207648_10004065 3300026089 Bacteria 15166
349 Ga0207648_10007267 3300026089 Bacteria 10919
350 Ga0207648_10114406 3300026089 Bacteria 2370
351 Ga0207648_10510927 3300026089 Unclassified 1100
352 Ga0207676_10010685 3300026095 Bacteria 6545
353 Ga0207676_10013380 3300026095 Bacteria 5893
354 Ga0207676_10840088 3300026095 Bacteria 898
355 Ga0207676_10843138 3300026095 Unclassified 896
356 Ga0207676_11172353 3300026095 Unclassified 761
357 Ga0207674_10104343 3300026116 Bacteria 2813
358 Ga0207674_10410042 3300026116 Bacteria 1309
359 Ga0207674_10414652 3300026116 Unclassified 1301
360 Ga0207674_10863258 3300026116 Unclassified 873
361 Ga0207675_100065327 3300026118 Bacteria 3400
362 Ga0207675_101010475 3300026118 Unclassified 850
363 Ga0207698_10085708 3300026142 Bacteria 2559
364 Ga0207698_10256192 3300026142 Unclassified 1604
365 Ga0207428_10014113 3300027907 Bacteria 6956
366 Ga0207428_10110265 3300027907 Bacteria 2119
367 Ga0268265_10066991 3300028380 Bacteria 2778
368 Ga0268265_10363520 3300028380 Bacteria 1326
369 Ga0268265_10465568 3300028380 Bacteria 1184
370 Ga0268264_10157909 3300028381 Unclassified 2040
371 Ga0268264_10254736 3300028381 Unclassified 1632
372 Ga0268264_10471968 3300028381 Bacteria 1219
373 Ga0268264_10622790 3300028381 Bacteria 1066
374 Ga0268264_10977999 3300028381 Unclassified 852
375 Ga0307513_10164869 3300031456 Unclassified 2102
376 Ga0307408_100172112 3300031548 Unclassified 1730
377 Ga0307408_100305798 3300031548 Unclassified 1334
378 Ga0307406_10316204 3300031901 Unclassified 1206
379 Ga0307409_100803560 3300031995 Bacteria 948
380 Ga0307416_100446798 3300032002 Unclassified 1344
381 Ga0307416_100513961 3300032002 Unclassified 1264
382 Ga0307414_10206863 3300032004 Bacteria 1601
383 Ga0307411_10035625 3300032005 Bacteria 3110
384 Ga0373951_0000825 3300035091 Bacteria 8418
385 Ga0373941_0033353 3300035115 Unclassified 1547
386 Ga0395898_0086499 3300037466 Bacteria 3021
387 Ga0395898_0403516 3300037466 Unclassified 1303
388 Ga0495610_0152502 3300046512 Unclassified 984
389 Ga0495636_0004904 3300047318 Bacteria 5244
390 Ga0496106_0352457 3300048909 Unclassified 1182
391 Ga0496108_0640266 3300048911 Unclassified 925
392 Ga0496112_0294156 3300048915 Bacteria 1570
393 Ga0501291_003313 3300049514 Unclassified 1997
394 Ga0501292_009703 3300049515 Unclassified 1432
395 Ga0501298_013342 3300049521 Unclassified 1454
396 Ga0501299_009108 3300049522 Bacteria 1629
397 Ga0501038_0008522 3300049574 Bacteria 9423
398 Ga0501198_014909 3300049649 Unclassified 1189
399 Ga0501206_005230 3300049653 Unclassified 1669
400 Ga0501206_008293 3300049653 Unclassified 1371
401 Ga0501207_018684 3300049654 Bacteria 1092
402 Ga0501227_006476 3300049665 Bacteria 2516
403 Ga0501227_118298 3300049665 Unclassified 714
404 Ga0501235_036520 3300049669 Unclassified 1117
405 Ga0501235_050006 3300049669 Bacteria 967
406 Ga0501239_004030 3300049672 Unclassified 1423
407 Ga0501249_085237 3300049679 Unclassified 745
408 Ga0501251_001688 3300049681 Unclassified 2088
409 Ga0501252_019576 3300049682 Unclassified 875
410 Ga0501257_032322 3300049686 Unclassified 1266
411 Ga0501258_008274 3300049687 Unclassified 1067
412 Ga0501258_011980 3300049687 Unclassified 936
413 Ga0501260_003606 3300049689 Bacteria 1399
414 Ga0501221_013688 3300049704 Bacteria 1496
415 Ga0501221_073288 3300049704 Unclassified 812
416 Ga0501225_0097570 3300049705 Bacteria 856
417 Ga0501245_022324 3300049708 Unclassified 998
418 Ga0501245_027992 3300049708 Unclassified 917
419 Ga0501267_002432 3300049764 Unclassified 1666
420 Ga0501212_006033 3300049851 Unclassified 1623
421 nmdc:mga05p37_60254_c1 3300050507 Bacteria 4674
422 nmdc:mga06r32_1006565_c1 3300050510 Unclassified 786
423 nmdc:mga08y16_13322_c1 3300050511 Bacteria 8649
424 nmdc:mga08y16_35018_c1 3300050511 Bacteria 5274
425 nmdc:mga08y16_4683_c1 3300050511 Bacteria 14257
426 nmdc:mga08y16_793167_c1 3300050511 Bacteria 940
427 nmdc:mga0n895_47412_c1 3300050512 Unclassified 4201
428 nmdc:mga0rr50_34521_c1 3300050513 Bacteria 3623
429 nmdc:mga08x19_39903_c1 3300050514 Bacteria 2986
430 nmdc:mga0a205_187085_c1 3300050515 Bacteria 1963
431 nmdc:mga0a205_270668_c1 3300050515 Bacteria 1576
432 nmdc:mga0a205_33369_c1 3300050515 Unclassified 4936
433 nmdc:mga0a205_96543_c1 3300050515 Bacteria 2854
434 Ga0530510_0028900 3300061734 Unclassified 3977
435 Ga0070670_100213256
436 MRS1b_contig_5818974
437 JGI24751J29686_10000038
438 Ga0065714_10064462
439 Ga0065704_10102168
440 Ga0065704_10219309
441 Ga0065712_10000135
442 Ga0065712_10003714
443 Ga0065712_10352288
444 Ga0065715_10003646
445 Ga0065715_10006106
446 Ga0065715_10093366
447 Ga0065715_10093522
448 Ga0065715_10116102
449 Ga0065715_10183238
450 Ga0065707_10024097
451 Ga0065707_10261615
452 Ga0070676_10023101
453 Ga0070690_100003785
454 Ga0070690_100006838
455 Ga0070670_100000073
456 Ga0070670_100251376
457 Ga0070670_100501549
458 Ga0070670_100928936
459 Ga0070677_10018214
460 Ga0068869_100054789
461 Ga0068869_100128086
462 Ga0068869_100247347
463 Ga0068869_100252185
464 Ga0070666_10190307
465 Ga0070680_100086265
466 Ga0070682_100002638
467 Ga0070682_100017752
468 Ga0068868_100061268
469 Ga0070689_100103239
470 Ga0070689_100705960
471 Ga0070687_100144314
472 Ga0070687_100213682
473 Ga0070692_10251846
474 Ga0070692_10299388
475 Ga0070669_100004686
476 Ga0070669_100041824
477 Ga0070669_100263514
478 Ga0070669_100437479
479 Ga0070675_100221663
480 Ga0070671_100041363
481 Ga0070671_100356378
482 Ga0070673_100383138
483 Ga0070659_100400988
484 Ga0070659_100946619
485 Ga0070667_100129399
486 Ga0070703_10002255
487 Ga0070701_10104864
488 Ga0070705_100006875
489 Ga0070705_100039786
490 Ga0070705_100076998
491 Ga0070705_100123925
492 Ga0070705_100143258
493 Ga0070700_100061103
494 Ga0070700_100078144
495 Ga0070700_100086117
496 Ga0070700_100180641
497 Ga0070694_100014607
498 Ga0070694_100032823
499 Ga0070694_100103578
500 Ga0070694_100133951
501 Ga0070694_100152851
502 Ga0070708_100336673
503 Ga0070662_100108223
504 Ga0070662_100162413
505 Ga0070681_10034397
506 Ga0068867_100044784
507 Ga0068867_100074506
508 Ga0068867_100109857
509 Ga0070685_10172867
510 Ga0070685_10186239
511 Ga0070706_100000015
512 Ga0070706_100049515
513 Ga0070707_100057837
514 Ga0070707_100068484
515 Ga0070707_100259178
516 Ga0070698_100003969
517 Ga0070698_100020333
518 Ga0070698_100024607
519 Ga0070698_100076483
520 Ga0070698_100103698
521 Ga0070698_100973964
522 Ga0070699_100003349
523 Ga0070699_100086453
524 Ga0070699_100147197
525 Ga0070699_100187637
526 Ga0070699_100276141
527 Ga0070699_100450011
528 Ga0070679_100212204
529 Ga0070697_100000170
530 Ga0070697_100044601
531 Ga0070697_100122547
532 Ga0070697_100467555
533 Ga0070672_100399320
534 Ga0070686_100004999
535 Ga0070695_100093855
536 Ga0070695_100265519
537 Ga0070695_100332355
538 Ga0070696_100015611
539 Ga0070696_100025405
540 Ga0070696_100057051
541 Ga0070696_100257845
542 Ga0070696_100382098
543 Ga0070696_100489927
544 Ga0070693_100004504
545 Ga0070693_100321430
546 Ga0070693_100437801
547 Ga0070704_100051406
548 Ga0070704_100126068
549 Ga0070704_100389106
550 Ga0070704_100660479
551 Ga0070704_100796559
552 Ga0070704_100880105
553 Ga0070664_100136848
554 Ga0070664_100239415
555 Ga0068857_100117789
556 Ga0068857_100182145
557 Ga0068857_100887041
558 Ga0068857_101121486
559 Ga0068854_100102754
560 Ga0068854_100124193
561 Ga0070702_100052711
562 Ga0070702_100503843
563 Ga0068852_100372244
564 Ga0068852_100670194
565 Ga0068859_100007056
566 Ga0068859_100018005
567 Ga0068859_100047951
568 Ga0068859_100187818
569 Ga0068859_100195792
570 Ga0068859_100198912
571 Ga0068859_100243379
572 Ga0068859_100307846
573 Ga0068859_100595688
574 Ga0068859_100916820
575 Ga0068864_100037249
576 Ga0068864_100041810
577 Ga0068864_100078387
578 Ga0068864_100091661
579 Ga0068866_10020652
580 Ga0068861_100000514
581 Ga0068861_100080703
582 Ga0068861_100114186
583 Ga0068861_100118520
584 Ga0068851_10002464
585 Ga0068870_10062621
586 Ga0068870_10168176
587 Ga0068870_10273734
588 Ga0068863_100099882
589 Ga0068863_100134065
590 Ga0068858_100025314
591 Ga0068858_100152980
592 Ga0068858_100404402
593 Ga0068860_100044762
594 Ga0068860_100292184
595 Ga0068860_100421572
596 Ga0068860_101365463
597 Ga0068862_100508408
598 Ga0068862_100595591
599 Ga0068862_100630451
600 Ga0070716_100011891
601 Ga0070716_100059493
602 Ga0097621_100001343
603 Ga0097621_100008105
604 Ga0097621_100093420
605 Ga0068871_100002147
606 Ga0068871_100093210
607 Ga0068871_100538186
608 Ga0075428_100238346
609 Ga0075430_100211667
610 Ga0075433_10026070
611 Ga0075433_10037126
612 Ga0075433_10173617
613 Ga0075434_100073038
614 Ga0075434_100329263
615 Ga0075434_100542779
616 Ga0075429_100500679
617 Ga0068865_100003476
618 Ga0075436_100154057
619 Ga0075436_100415543
620 Ga0097620_100007056
621 Ga0097620_100018005
622 Ga0097620_100047950
623 Ga0097620_100187830
624 Ga0097620_100195783
625 Ga0097620_100198918
626 Ga0097620_100243388
627 Ga0097620_100307849
628 Ga0097620_100595658
629 Ga0097620_100916856
630 Ga0075435_100058203
631 Ga0105251_10064446
632 Ga0105240_10221262
633 Ga0111539_10006562
634 Ga0111539_10083651
635 Ga0111539_10157601
636 Ga0105247_10039556
637 Ga0105247_10112857
638 Ga0105247_10233670
639 Ga0105247_10301494
640 Ga0105247_10395239
641 Ga0114129_10014283
642 Ga0114129_10575480
643 Ga0114129_11034112
644 Ga0105243_10002227
645 Ga0105243_10214990
646 Ga0105243_10225160
647 Ga0105243_10248569
648 Ga0105243_10550461
649 Ga0105243_11028441
650 Ga0105241_10050616
651 Ga0105241_10238950
652 Ga0105241_10280586
653 Ga0105241_10477041
654 Ga0105241_10600630
655 Ga0105241_10616815
656 Ga0105241_10749911
657 Ga0105242_10615994
658 Ga0105248_10004845
659 Ga0105248_10013683
660 Ga0105248_10147482
661 Ga0105237_10001132
662 Ga0105238_10003575
663 Ga0105238_10045209
664 Ga0105249_10117923
665 Ga0105239_10149099
666 Ga0105239_10345966
667 Ga0105239_11298957
668 Ga0105246_10009140
669 Ga0105246_10011134
670 Ga0105246_10126816
671 Ga0157373_10001035
672 Ga0157373_10027644
673 Ga0157373_10214070
674 Ga0157373_10226258
675 Ga0157378_10036749
676 Ga0157378_10070833
677 Ga0157378_10086425
678 Ga0157378_10134061
679 Ga0163162_10015778
680 Ga0163162_10058418
681 Ga0163162_10401899
682 Ga0163162_10479069
683 Ga0157372_10016829
684 Ga0157372_10536742
685 Ga0163163_10000466
686 Ga0163163_10006281
687 Ga0163163_10015075
688 Ga0163163_10239432
689 Ga0163163_10246454
690 Ga0163163_10307906
691 Ga0157380_10069455
692 Ga0157380_10076757
693 Ga0157380_10079307
694 Ga0157380_10109395
695 Ga0157380_10388295
696 Ga0157377_10054588
697 Ga0157379_10034888
698 Ga0157379_10804146
699 Ga0163161_10013239
700 Ga0163161_10617450
701 Ga0207697_10005816
702 Ga0207653_10000946
703 Ga0207642_10326859
704 Ga0207710_10032533
705 Ga0207647_10052253
706 Ga0207647_10117373
707 Ga0207645_10063676
708 Ga0207645_10366170
709 Ga0207643_10006728
710 Ga0207643_10122084
711 Ga0207684_10000083
712 Ga0207684_10020786
713 Ga0207684_10030277
714 Ga0207654_10045308
715 Ga0207654_10104590
716 Ga0207707_10003754
717 Ga0207695_10129392
718 Ga0207671_10005003
719 Ga0207660_11097462
720 Ga0207662_10025951
721 Ga0207662_10098043
722 Ga0207662_10206428
723 Ga0207662_10515834
724 Ga0207652_10705895
725 Ga0207646_10044382
726 Ga0207681_10105819
727 Ga0207681_10139146
728 Ga0207694_10163019
729 Ga0207694_10199051
730 Ga0207650_10000006
731 Ga0207650_10003376
732 Ga0207650_10401076
733 Ga0207659_10184424
734 Ga0207659_10332489
735 Ga0207644_10052707
736 Ga0207690_10279402
737 Ga0207690_10762941
738 Ga0207706_10081937
739 Ga0207706_10191382
740 Ga0207686_10031345
741 Ga0207686_10406424
742 Ga0207709_10008696
743 Ga0207709_10031887
744 Ga0207709_10144755
745 Ga0207670_10005499
746 Ga0207670_10107986
747 Ga0207665_10016736
748 Ga0207691_10003837
749 Ga0207711_10014323
750 Ga0207711_10057841
751 Ga0207711_10062826
752 Ga0207711_10310781
753 Ga0207711_10350233
754 Ga0207711_10811382
755 Ga0207689_10003448
756 Ga0207689_10006130
757 Ga0207689_10114391
758 Ga0207689_10259619
759 Ga0207689_10338085
760 Ga0207651_10240920
761 Ga0207712_10107561
762 Ga0207712_10672961
763 Ga0207640_10159119
764 Ga0207640_10391246
765 Ga0207640_10395738
766 Ga0207658_11001678
767 Ga0207677_10062880
768 Ga0207703_10023440
769 Ga0207703_10086227
770 Ga0207703_10134022
771 Ga0207639_10726331
772 Ga0207708_10000016
773 Ga0207708_10015453
774 Ga0207708_10046071
775 Ga0207708_10051279
776 Ga0207708_10051507
777 Ga0207708_10306422
778 Ga0207641_10045554
779 Ga0207641_10053148
780 Ga0207641_10135111
781 Ga0207641_10152055
782 Ga0207648_10004065
783 Ga0207648_10007267
784 Ga0207648_10114406
785 Ga0207648_10510927
786 Ga0207676_10010685
787 Ga0207676_10013380
788 Ga0207676_10840088
789 Ga0207676_10843138
790 Ga0207676_11172353
791 Ga0207674_10104343
792 Ga0207674_10410042
793 Ga0207674_10414652
794 Ga0207674_10863258
795 Ga0207675_100065327
796 Ga0207675_101010475
797 Ga0207698_10085708
798 Ga0207698_10256192
799 Ga0207428_10014113
800 Ga0207428_10110265
801 Ga0268265_10066991
802 Ga0268265_10363520
803 Ga0268265_10465568
804 Ga0268264_10157909
805 Ga0268264_10254736
806 Ga0268264_10471968
807 Ga0268264_10622790
808 Ga0268264_10977999
809 Ga0307513_10164869
810 Ga0307408_100172112
811 Ga0307408_100305798
812 Ga0307406_10316204
813 Ga0307409_100803560
814 Ga0307416_100446798
815 Ga0307416_100513961
816 Ga0307414_10206863
817 Ga0307411_10035625
818 Ga0373951_0000825
819 Ga0373941_0033353
820 Ga0395898_0086499
821 Ga0395898_0403516
822 Ga0495610_0152502
823 Ga0495636_0004904
824 Ga0496106_0352457
825 Ga0496108_0640266
826 Ga0496112_0294156
827 Ga0501291_003313
828 Ga0501292_009703
829 Ga0501298_013342
830 Ga0501299_009108
831 Ga0501038_0008522
832 Ga0501198_014909
833 Ga0501206_005230
834 Ga0501206_008293
835 Ga0501207_018684
836 Ga0501227_006476
837 Ga0501227_118298
838 Ga0501235_036520
839 Ga0501235_050006
840 Ga0501239_004030
841 Ga0501249_085237
842 Ga0501251_001688
843 Ga0501252_019576
844 Ga0501257_032322
845 Ga0501258_008274
846 Ga0501258_011980
847 Ga0501260_003606
848 Ga0501221_013688
849 Ga0501221_073288
850 Ga0501225_0097570
851 Ga0501245_022324
852 Ga0501245_027992
853 Ga0501267_002432
854 Ga0501212_006033
855 nmdc:mga05p37_60254_c1
856 nmdc:mga06r32_1006565_c1
857 nmdc:mga08y16_13322_c1
858 nmdc:mga08y16_35018_c1
859 nmdc:mga08y16_4683_c1
860 nmdc:mga08y16_793167_c1
861 nmdc:mga0n895_47412_c1
862 nmdc:mga0rr50_34521_c1
863 nmdc:mga08x19_39903_c1
864 nmdc:mga0a205_187085_c1
865 nmdc:mga0a205_270668_c1
866 nmdc:mga0a205_33369_c1
867 nmdc:mga0a205_96543_c1
868 Ga0530510_0028900

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

75

153

0.94

PF13620

CarboxypepD_reg

Carboxypeptidase regulatory-like domain

165

249

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hif-assembly1.cif.gz_Y kuenenia stuttgartiensis hydrazine dehydrogenase complex 0.8819 114 203
5aq0-assembly1.cif.gz_A the structure of the transthyretin-like domain of the first catalytic domain of the human carboxypeptidase d 0.8396 30 112
4v4c-assembly3.cif.gz_F crystal structure of pyrogallol-phloroglucinol transhydroxylase from pelobacter acidigallici 0.8317 108 202
4q14-assembly1.cif.gz_B crystal structure of 5-hydroxyisourate hydrolase from brucella melitensis 0.8264 117 202
3djs-assembly1.cif.gz_B crystal structure of transthyretin variant l58h at acidic ph 0.825 119 202
ID Description Score Start End Superfamily
af_Q54LD6_18_133_2.60.40.180 Mainly Beta;Sandwich;Immunoglobulin-like;Transthyretin/hydroxyisourate hydrolase domain 0.8609 114 202 2.60.40.180
af_P0CG96_23_100_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8484 120 202 2.60.40.1120
af_B7Z0Z5_381_464_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8475 119 206 2.60.40.1120
af_E7FFQ7_314_405_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.8473 30 112 2.60.40.1120
1ti2B03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8347 115 204 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A356UGU4-F1-model_v4 Dockerin domain-containing protein 0.9333 28 113 GO:0000272
GO:0004553
GO:0030246
AF-A0A356UHL3-F1-model_v4 Dockerin domain-containing protein 0.9303 28 113 GO:0000272
GO:0004553
GO:0008237
AF-A0A2V8THH8-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9253 115 206
AF-A0A849D4N0-F1-model_v4 DUF4382 domain-containing protein 0.9219 25 112 GO:0030246
AF-A0A2V8N489-F1-model_v4 Carboxypeptidase regulatory-like domain-containing protein 0.9197 103 206

Map