F442891

General Info

Members Datasets Scaffolds Average Seq Length
433 201 867 119

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0000195|Ga0395899_0000195_88334_88723
Length 129
Sequence MAAWPQQRERKLMQRYYYALDLKDDAAAIAEYERWHRPGVVWPEIITSIRAAGIEEMEIFRTGNRLVMVVQMADDHAPAAKRESDDDARTKEWEQLMDRYQQRLPWAPEGVKWVPMGRIFSLKEALAVL

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
9 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
84 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
85 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
98 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
99 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
106 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
147 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
148 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
149 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
150 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
151 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
154 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
158 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
159 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
174 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
177 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
178 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
179 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
184 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
185 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
188 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
199 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
200 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
201 2842914999 Luteibacter sp. R-72151 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.92
Metatranscriptomes 1.85
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.78
Nodule 0
Rhizoplane 1.15
Rhizosphere 78.75
Stem 0
Stem Tuber 0
Unclassified 3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0000195 3300037312 Bacteria 89015
2 JGI24741J21665_1007211 3300001915 Bacteria 2169
3 JGI24740J21852_10005850 3300001979 Bacteria 5157
4 JGI24735J21928_10037937 3300002067 Bacteria 1411
5 JGI24735J21928_10088914 3300002067 Bacteria 885
6 JGI25156J39149_1001399 3300002705 Bacteria 10286
7 JGI25156J39149_1005352 3300002705 Bacteria 3722
8 JGI25156J39149_1016224 3300002705 Bacteria 1456
9 JGI25162J39368_1000623 3300002737 Bacteria 25375
10 JGI25157J39369_1000688 3300002741 Bacteria 18357
11 JGI25157J39369_1000957 3300002741 Bacteria 13522
12 JGI25157J39369_1001266 3300002741 Bacteria 10287
13 JGI25157J39369_1001843 3300002741 Bacteria 6634
14 JGI25164J39214_1000061 3300002772 Bacteria 110617
15 JGI25165J46597_1000151 3300003214 Bacteria 114835
16 rootH1_10001690 3300003316 Bacteria 3195
17 rootH1_10001690 3300003323 Bacteria 6112
18 rootH1_10015253 3300003316 Bacteria 4550
19 rootH1_10069259 3300003316 Bacteria 2223
20 rootH2_10188676 3300003320 Bacteria 2181
21 rootL2_10223282 3300003322 Bacteria 3125
22 Ga0055539_1000614 3300003752 Bacteria 9678
23 Ga0055533_1003355 3300003756 Bacteria 3248
24 Ga0055525_1000856 3300003759 Bacteria 8910
25 Ga0055527_1000271 3300003760 Bacteria 31313
26 Ga0055527_1000273 3300003760 Bacteria 30913
27 Ga0055527_1001390 3300003760 Bacteria 5128
28 Ga0055535_1000466 3300003761 Bacteria 37034
29 Ga0055535_1000567 3300003761 Bacteria 31313
30 Ga0055535_1000574 3300003761 Bacteria 30913
31 Ga0055535_1001249 3300003761 Bacteria 14116
32 Ga0055542_1000104 3300003762 Bacteria 113323
33 Ga0055542_1000591 3300003762 Bacteria 31313
34 Ga0055542_1000597 3300003762 Bacteria 30913
35 Ga0055542_1000689 3300003762 Bacteria 26733
36 Ga0055529_1000140 3300003763 Bacteria 102393
37 Ga0055529_1000556 3300003763 Bacteria 31313
38 Ga0055529_1000815 3300003763 Bacteria 18794
39 Ga0055540_1031184 3300003792 Bacteria 1227
40 Ga0065165_1003621 3300005262 Bacteria 10600
41 Ga0070658_10085707 3300005327 Bacteria 2591
42 Ga0070658_11438495 3300005327 Bacteria 598
43 Ga0070676_11273675 3300005328 Bacteria 561
44 Ga0070683_100996893 3300005329 Bacteria 804
45 Ga0070670_100044231 3300005331 Bacteria 3829
46 Ga0070670_100352941 3300005331 Bacteria 1292
47 Ga0070666_10000147 3300005335 Bacteria 48216
48 Ga0070666_10386837 3300005335 Bacteria 1005
49 Ga0070666_10658871 3300005335 Bacteria 766
50 Ga0070680_100001573 3300005336 Bacteria 16644
51 Ga0070680_100003828 3300005336 Bacteria 11250
52 Ga0070680_100268359 3300005336 Bacteria 1445
53 Ga0070682_100021303 3300005337 Bacteria 3823
54 Ga0068868_100624736 3300005338 Bacteria 957
55 Ga0070660_100728879 3300005339 Bacteria 832
56 Ga0070660_100999572 3300005339 Bacteria 707
57 Ga0070691_10000632 3300005341 Bacteria 13561
58 Ga0070691_10014054 3300005341 Bacteria 3672
59 Ga0070691_10387550 3300005341 Bacteria 784
60 Ga0070661_100006470 3300005344 Bacteria 8077
61 Ga0070661_100068127 3300005344 Bacteria 2616
62 Ga0070661_100202639 3300005344 Bacteria 1517
63 Ga0070692_10012084 3300005345 Bacteria 3984
64 Ga0070675_101883672 3300005354 Bacteria 552
65 Ga0070671_100599497 3300005355 Bacteria 952
66 Ga0070688_100348317 3300005365 Bacteria 1084
67 Ga0070659_101817452 3300005366 Bacteria 546
68 Ga0070667_100075406 3300005367 Bacteria 2879
69 Ga0070667_100083316 3300005367 Bacteria 2739
70 Ga0070667_100197106 3300005367 Bacteria 1785
71 Ga0070667_100328708 3300005367 Bacteria 1381
72 Ga0070714_100027069 3300005435 Bacteria 4744
73 Ga0070713_100001768 3300005436 Bacteria 13947
74 Ga0070710_10583170 3300005437 Bacteria 776
75 Ga0070700_100509143 3300005441 Bacteria 928
76 Ga0070663_100003695 3300005455 Bacteria 8873
77 Ga0070663_100011678 3300005455 Bacteria 5523
78 Ga0070663_100012260 3300005455 Bacteria 5414
79 Ga0070663_100500802 3300005455 Bacteria 1009
80 Ga0070663_100530814 3300005455 Bacteria 981
81 Ga0070663_100839393 3300005455 Bacteria 790
82 Ga0070662_100249361 3300005457 Bacteria 1427
83 Ga0070681_10000170 3300005458 Bacteria 49540
84 Ga0070681_10000566 3300005458 Bacteria 30443
85 Ga0070681_10351753 3300005458 Bacteria 1384
86 Ga0070685_10002899 3300005466 Bacteria 8765
87 Ga0070679_100000116 3300005530 Bacteria 63019
88 Ga0070679_100000161 3300005530 Bacteria 53878
89 Ga0070679_100395718 3300005530 Bacteria 1328
90 Ga0068853_100110668 3300005539 Bacteria 2440
91 Ga0068853_100130277 3300005539 Bacteria 2251
92 Ga0068853_100514835 3300005539 Bacteria 1131
93 Ga0068853_100584877 3300005539 Bacteria 1059
94 Ga0068853_100839539 3300005539 Bacteria 881
95 Ga0070696_100051387 3300005546 Bacteria 2866
96 Ga0070693_100012351 3300005547 Bacteria 4319
97 Ga0070693_100346909 3300005547 Bacteria 1015
98 Ga0070665_100003246 3300005548 Bacteria 17482
99 Ga0068855_100001262 3300005563 Bacteria 31405
100 Ga0068855_100054841 3300005563 Bacteria 4684
101 Ga0068855_100160813 3300005563 Bacteria 2549
102 Ga0068855_100272037 3300005563 Bacteria 1884
103 Ga0068855_100689784 3300005563 Bacteria 1094
104 Ga0070664_100179554 3300005564 Bacteria 1881
105 Ga0068857_100031650 3300005577 Bacteria 4675
106 Ga0068857_100075200 3300005577 Bacteria 3011
107 Ga0068857_101001711 3300005577 Bacteria 804
108 Ga0068854_100003226 3300005578 Bacteria 10168
109 Ga0068854_100006415 3300005578 Bacteria 7482
110 Ga0068854_100008699 3300005578 Bacteria 6532
111 Ga0068854_100011439 3300005578 Bacteria 5780
112 Ga0068854_100135822 3300005578 Bacteria 1882
113 Ga0068856_100001887 3300005614 Bacteria 21829
114 Ga0068856_100014695 3300005614 Bacteria 7556
115 Ga0068856_100271655 3300005614 Bacteria 1711
116 Ga0068856_101393879 3300005614 Bacteria 715
117 Ga0068856_101414571 3300005614 Bacteria 710
118 Ga0068852_100003447 3300005616 Bacteria 11055
119 Ga0068852_100017791 3300005616 Bacteria 5586
120 Ga0068852_100022492 3300005616 Bacteria 5056
121 Ga0068852_100924884 3300005616 Bacteria 890
122 Ga0068852_101042303 3300005616 Bacteria 837
123 Ga0068861_101350143 3300005719 Unclassified 695
124 Ga0068851_10044389 3300005834 Bacteria 2243
125 Ga0068863_101078198 3300005841 Bacteria 807
126 Ga0068858_100001471 3300005842 Bacteria 24254
127 Ga0068858_100085962 3300005842 Bacteria 2926
128 Ga0068858_100461815 3300005842 Bacteria 1224
129 Ga0068860_100077355 3300005843 Bacteria 3164
130 Ga0097621_100890368 3300006237 Bacteria 828
131 Ga0068871_100452729 3300006358 Bacteria 1151
132 Ga0068865_100056151 3300006881 Bacteria 2742
133 Ga0105240_10000628 3300009093 Bacteria 65065
134 Ga0105240_10016106 3300009093 Bacteria 10130
135 Ga0105240_10037706 3300009093 Bacteria 6210
136 Ga0105240_10089162 3300009093 Bacteria 3773
137 Ga0105240_10121260 3300009093 Bacteria 3148
138 Ga0105240_10142858 3300009093 Bacteria 2860
139 Ga0105240_11098089 3300009093 Bacteria 846
140 Ga0105240_11325699 3300009093 Unclassified 758
141 Ga0105247_11385324 3300009101 Bacteria 568
142 Ga0105241_10155446 3300009174 Bacteria 1875
143 Ga0105241_10209076 3300009174 Bacteria 1634
144 Ga0105242_10531240 3300009176 Bacteria 1124
145 Ga0105237_10000007 3300009545 Bacteria 367690
146 Ga0105237_10001579 3300009545 Bacteria 29663
147 Ga0105237_10145653 3300009545 Bacteria 2363
148 Ga0105237_10199452 3300009545 Bacteria 2000
149 Ga0105237_10265775 3300009545 Bacteria 1718
150 Ga0105237_10470028 3300009545 Bacteria 1263
151 Ga0105237_12161239 3300009545 Unclassified 566
152 Ga0105238_10009646 3300009551 Bacteria 9661
153 Ga0105238_10017994 3300009551 Bacteria 7183
154 Ga0105239_10038440 3300010375 Bacteria 5245
155 Ga0105239_10922815 3300010375 Bacteria 1002
156 Ga0105239_12249297 3300010375 Unclassified 634
157 Ga0157314_1000708 3300012500 Bacteria 2929
158 Ga0157373_10028369 3300013100 Bacteria 4037
159 Ga0157373_10104753 3300013100 Bacteria 1989
160 Ga0157373_10291051 3300013100 Bacteria 1158
161 Ga0157371_10036582 3300013102 Bacteria 3515
162 Ga0157371_10234939 3300013102 Bacteria 1318
163 Ga0157370_10005469 3300013104 Bacteria 14241
164 Ga0157370_10005994 3300013104 Bacteria 13522
165 Ga0157370_10015501 3300013104 Bacteria 7749
166 Ga0157370_10173497 3300013104 Bacteria 2004
167 Ga0157369_10029181 3300013105 Bacteria 6098
168 Ga0157369_10300904 3300013105 Bacteria 1668
169 Ga0157369_10670173 3300013105 Bacteria 1069
170 Ga0157369_10908426 3300013105 Bacteria 903
171 Ga0157372_10003063 3300013307 Bacteria 18011
172 Ga0157372_10042347 3300013307 Bacteria 5036
173 Ga0157372_10054209 3300013307 Bacteria 4472
174 Ga0157372_10682455 3300013307 Bacteria 1196
175 Ga0163163_10342204 3300014325 Bacteria 1551
176 Ga0163163_11808292 3300014325 Bacteria 671
177 Ga0182008_10079132 3300014497 Bacteria 1617
178 Ga0157379_10146214 3300014968 Bacteria 2132
179 Ga0157379_10470581 3300014968 Bacteria 1162
180 Ga0157376_12355077 3300014969 Bacteria 572
181 Ga0182006_1019506 3300015261 Bacteria 2854
182 Ga0182007_10068270 3300015262 Bacteria 1165
183 Ga0197907_10963472 3300020069 Bacteria 958
184 Ga0206356_11905613 3300020070 Bacteria 1239
185 Ga0206354_10073402 3300020081 Bacteria 2090
186 Ga0206354_10980198 3300020081 Bacteria 1319
187 Ga0206353_10006090 3300020082 Bacteria 3681
188 Ga0206353_11177962 3300020082 Bacteria 1858
189 Ga0154015_1149957 3300020610 Bacteria 711
190 Ga0154015_1387000 3300020610 Bacteria 765
191 Ga0213875_10588831 3300021388 Unclassified 537
192 Ga0209674_100053 3300025226 Bacteria 323159
193 Ga0209674_100898 3300025226 Bacteria 9646
194 Ga0209672_100009 3300025228 Bacteria 883623
195 Ga0209672_100024 3300025228 Bacteria 367869
196 Ga0209672_100107 3300025228 Bacteria 99267
197 Ga0209672_100742 3300025228 Bacteria 15916
198 Ga0209563_100127 3300025230 Bacteria 109913
199 Ga0207427_100021 3300025231 Bacteria 494115
200 Ga0209437_100150 3300025233 Bacteria 157430
201 Ga0209258_100011 3300025242 Bacteria 867542
202 Ga0209258_100045 3300025242 Bacteria 369941
203 Ga0209258_100047 3300025242 Bacteria 367869
204 Ga0209258_100299 3300025242 Bacteria 80970
205 Ga0209646_1000553 3300025246 Bacteria 15780
206 Ga0209646_1002921 3300025246 Bacteria 3561
207 Ga0209026_1000010 3300025250 Bacteria 511986
208 Ga0209026_1000163 3300025250 Bacteria 102814
209 Ga0209026_1000391 3300025250 Bacteria 39130
210 Ga0209677_102437 3300025253 Bacteria 7000
211 Ga0209148_1000013 3300025254 Bacteria 956684
212 Ga0209148_1000052 3300025254 Bacteria 399449
213 Ga0209148_1000054 3300025254 Bacteria 367869
214 Ga0209148_1000205 3300025254 Bacteria 104659
215 Ga0209759_1000622 3300025256 Bacteria 33847
216 Ga0209759_1001819 3300025256 Bacteria 10741
217 Ga0209759_1004122 3300025256 Bacteria 5547
218 Ga0209233_1000023 3300025261 Bacteria 738870
219 Ga0209233_1000754 3300025261 Bacteria 14657
220 Ga0209455_1000012 3300025272 Bacteria 867234
221 Ga0209455_1000052 3300025272 Bacteria 367804
222 Ga0209455_1000081 3300025272 Bacteria 263674
223 Ga0209455_1000357 3300025272 Bacteria 42718
224 Ga0209758_1068764 3300025297 Bacteria 1126
225 Ga0207426_1122274 3300025302 Bacteria 642
226 Ga0209051_1039305 3300025303 Bacteria 1710
227 Ga0207656_10032328 3300025321 Bacteria 2173
228 Ga0207680_10001024 3300025903 Bacteria 13188
229 Ga0207647_10000055 3300025904 Bacteria 86547
230 Ga0207647_10006694 3300025904 Bacteria 8372
231 Ga0207647_10016475 3300025904 Bacteria 5045
232 Ga0207647_10034514 3300025904 Bacteria 3228
233 Ga0207705_10002078 3300025909 Bacteria 15568
234 Ga0207705_10042417 3300025909 Bacteria 3266
235 Ga0207705_10064918 3300025909 Bacteria 2638
236 Ga0207705_10645540 3300025909 Bacteria 823
237 Ga0207705_11069045 3300025909 Bacteria 622
238 Ga0207654_10604929 3300025911 Bacteria 782
239 Ga0207707_10000181 3300025912 Bacteria 66031
240 Ga0207707_10000249 3300025912 Bacteria 59150
241 Ga0207707_10225057 3300025912 Bacteria 1633
242 Ga0207695_10000040 3300025913 Bacteria 452787
243 Ga0207695_10001115 3300025913 Bacteria 46659
244 Ga0207695_10001214 3300025913 Bacteria 44135
245 Ga0207695_10006440 3300025913 Bacteria 15246
246 Ga0207695_10007575 3300025913 Bacteria 13765
247 Ga0207695_10033408 3300025913 Bacteria 5611
248 Ga0207695_10098510 3300025913 Bacteria 2923
249 Ga0207695_10506546 3300025913 Bacteria 1089
250 Ga0207695_11314760 3300025913 Unclassified 603
251 Ga0207671_10000074 3300025914 Bacteria 156482
252 Ga0207671_10001275 3300025914 Bacteria 29656
253 Ga0207671_10117571 3300025914 Bacteria 2029
254 Ga0207671_10301182 3300025914 Bacteria 1267
255 Ga0207671_10358967 3300025914 Bacteria 1156
256 Ga0207660_10000392 3300025917 Bacteria 28841
257 Ga0207660_10001068 3300025917 Bacteria 18208
258 Ga0207660_10052724 3300025917 Bacteria 2897
259 Ga0207657_10005252 3300025919 Bacteria 13566
260 Ga0207657_10027032 3300025919 Bacteria 5260
261 Ga0207657_10354480 3300025919 Bacteria 1157
262 Ga0207649_10036263 3300025920 Bacteria 2969
263 Ga0207652_10000017 3300025921 Bacteria 188391
264 Ga0207652_10000134 3300025921 Bacteria 78533
265 Ga0207652_10554159 3300025921 Bacteria 1033
266 Ga0207694_10011485 3300025924 Bacteria 6684
267 Ga0207694_10013173 3300025924 Bacteria 6226
268 Ga0207694_10072728 3300025924 Bacteria 2688
269 Ga0207694_10443235 3300025924 Bacteria 1083
270 Ga0207659_11496921 3300025926 Bacteria 577
271 Ga0207700_10001549 3300025928 Bacteria 13039
272 Ga0207664_10027619 3300025929 Bacteria 4305
273 Ga0207690_10013292 3300025932 Bacteria 4944
274 Ga0207706_10038728 3300025933 Bacteria 4229
275 Ga0207706_10139233 3300025933 Bacteria 2135
276 Ga0207661_10761339 3300025944 Bacteria 891
277 Ga0207667_10000292 3300025949 Bacteria 69279
278 Ga0207667_10000486 3300025949 Bacteria 52631
279 Ga0207667_10013808 3300025949 Bacteria 9227
280 Ga0207667_10019145 3300025949 Bacteria 7656
281 Ga0207667_10022774 3300025949 Bacteria 6910
282 Ga0207667_10141687 3300025949 Bacteria 2475
283 Ga0207712_10000120 3300025961 Bacteria 84214
284 Ga0207640_10000042 3300025981 Bacteria 102885
285 Ga0207640_10000454 3300025981 Bacteria 24951
286 Ga0207640_10011131 3300025981 Bacteria 5086
287 Ga0207640_10017776 3300025981 Bacteria 4167
288 Ga0207640_10035289 3300025981 Bacteria 3128
289 Ga0207640_10088387 3300025981 Bacteria 2139
290 Ga0207658_10007176 3300025986 Bacteria 7594
291 Ga0207658_10037444 3300025986 Bacteria 3486
292 Ga0207658_10090521 3300025986 Bacteria 2371
293 Ga0207677_10607810 3300026023 Bacteria 960
294 Ga0207703_10000422 3300026035 Bacteria 44878
295 Ga0207703_10338515 3300026035 Bacteria 1382
296 Ga0207639_10010801 3300026041 Bacteria 6330
297 Ga0207639_10025396 3300026041 Bacteria 4295
298 Ga0207639_10078959 3300026041 Bacteria 2600
299 Ga0207639_10437987 3300026041 Bacteria 1184
300 Ga0207678_10002963 3300026067 Bacteria 15378
301 Ga0207678_10005003 3300026067 Bacteria 11886
302 Ga0207678_10024920 3300026067 Bacteria 5223
303 Ga0207678_10068890 3300026067 Bacteria 3035
304 Ga0207678_10107290 3300026067 Bacteria 2382
305 Ga0207678_10340436 3300026067 Bacteria 1292
306 Ga0207702_10000185 3300026078 Bacteria 74602
307 Ga0207702_10007958 3300026078 Bacteria 8981
308 Ga0207702_10013707 3300026078 Bacteria 6734
309 Ga0207702_10054129 3300026078 Bacteria 3399
310 Ga0207702_10674167 3300026078 Bacteria 1018
311 Ga0207648_11416608 3300026089 Bacteria 653
312 Ga0207674_10005801 3300026116 Bacteria 14650
313 Ga0207674_10036889 3300026116 Bacteria 5088
314 Ga0207674_10909781 3300026116 Bacteria 848
315 Ga0207675_101349256 3300026118 Bacteria 734
316 Ga0207698_10001340 3300026142 Bacteria 14341
317 Ga0207698_10176903 3300026142 Bacteria 1885
318 Ga0207698_10728737 3300026142 Bacteria 989
319 Ga0207698_11061071 3300026142 Bacteria 822
320 Ga0268266_10000007 3300028379 Bacteria 1372921
321 Ga0307511_10000227 3300030521 Bacteria 57255
322 Ga0307508_10367712 3300031616 Bacteria 1029
323 Ga0373932_0269183 3300035112 Unclassified 627
324 Ga0395899_0002906 3300037312 Bacteria 13766
325 Ga0395899_0068099 3300037312 Bacteria 2611
326 Ga0395900_0000018 3300037418 Bacteria 363472
327 Ga0395900_0063004 3300037418 Bacteria 3811
328 Ga0395900_0073760 3300037418 Bacteria 3509
329 Ga0395898_0000530 3300037466 Bacteria 72663
330 Ga0395898_0000533 3300037466 Bacteria 72575
331 Ga0395898_0204837 3300037466 Bacteria 1882
332 Ga0395905_0216248 3300037471 Bacteria 1794
333 Ga0436364_0299690 3300037853 Unclassified 538
334 Ga0436364_1015581 3300037853 Unclassified 689
335 Ga0395901_0090499 3300038443 Bacteria 3202
336 Ga0395901_0107063 3300038443 Bacteria 2934
337 Ga0395901_0242555 3300038443 Bacteria 1879
338 Ga0395901_0751179 3300038443 Bacteria 968
339 Ga0436363_1087732 3300039450 Bacteria 550
340 Ga0451787_331953 3300041441 Bacteria 981
341 Ga0451787_345793 3300041441 Bacteria 581
342 Ga0451793_0174362 3300041452 Bacteria 1072
343 Ga0451802_1059221 3300041460 Bacteria 832
344 Ga0451807_2391893 3300041486 Bacteria 630
345 Ga0451849_0521976 3300041505 Bacteria 623
346 Ga0439432_027597 3300042006 Bacteria 1853
347 Ga0466969_0003759 3300044656 Bacteria 8068
348 Ga0466969_0018095 3300044656 Bacteria 3676
349 Ga0466969_0022787 3300044656 Bacteria 3230
350 Ga0466969_0045095 3300044656 Bacteria 2189
351 Ga0466969_0222466 3300044656 Bacteria 858
352 Ga0466972_0002849 3300044658 Bacteria 8559
353 Ga0466972_0024012 3300044658 Bacteria 3027
354 Ga0466972_0178568 3300044658 Unclassified 996
355 Ga0466975_0091725 3300044661 Bacteria 2164
356 Ga0466989_0245938 3300044663 Bacteria 1030
357 Ga0466982_0000013 3300044672 Bacteria 136227
358 Ga0466965_0015621 3300044683 Bacteria 3607
359 Ga0466965_0238957 3300044683 Bacteria 972
360 Ga0466966_0008164 3300044684 Bacteria 6939
361 Ga0466966_0016818 3300044684 Bacteria 4832
362 Ga0466966_0024873 3300044684 Bacteria 3915
363 Ga0466966_0041291 3300044684 Bacteria 2964
364 Ga0466961_0000604 3300044693 Bacteria 22628
365 Ga0466961_0002035 3300044693 Bacteria 12585
366 Ga0466961_0005214 3300044693 Bacteria 8179
367 Ga0466961_0156650 3300044693 Bacteria 1421
368 Ga0466961_0162207 3300044693 Bacteria 1393
369 Ga0466963_0361745 3300044694 Bacteria 1022
370 Ga0466963_0767469 3300044694 Unclassified 680
371 Ga0466963_0837378 3300044694 Bacteria 649
372 Ga0466964_0003523 3300044706 Bacteria 5719
373 Ga0466971_0010842 3300044719 Bacteria 3985
374 Ga0466971_0040654 3300044719 Bacteria 2088
375 Ga0466971_0329127 3300044719 Bacteria 737
376 Ga0466968_0024342 3300044735 Bacteria 2472
377 Ga0466968_0335974 3300044735 Bacteria 732
378 Ga0466968_0611689 3300044735 Unclassified 551
379 Ga0466970_0004581 3300044765 Bacteria 6823
380 Ga0466970_0009612 3300044765 Bacteria 4892
381 Ga0466970_0024231 3300044765 Bacteria 3172
382 Ga0466957_0004881 3300044842 Bacteria 7506
383 Ga0466957_0114200 3300044842 Bacteria 1715
384 Ga0466960_0003521 3300044901 Bacteria 6027
385 Ga0466959_0000043 3300045049 Bacteria 92533
386 Ga0466959_0082242 3300045049 Bacteria 2320
387 Ga0466959_0352316 3300045049 Bacteria 1003
388 Ga0466959_0674200 3300045049 Bacteria 693
389 Ga0466959_0697522 3300045049 Bacteria 680
390 Ga0466958_0017336 3300045836 Bacteria 4161
391 Ga0466958_0037486 3300045836 Bacteria 2905
392 Ga0466958_0044748 3300045836 Bacteria 2668
393 Ga0466958_0083028 3300045836 Bacteria 1974
394 Ga0466958_0166976 3300045836 Bacteria 1393
395 Ga0466967_0060508 3300045976 Bacteria 3356
396 Ga0495585_0000021 3300046492 Bacteria 155715
397 Ga0495631_0000060 3300046518 Bacteria 68239
398 Ga0495648_0000688 3300046524 Bacteria 36092
399 Ga0495661_0000353 3300046665 Bacteria 50121
400 Ga0495588_0170785 3300046674 Bacteria 1150
401 Ga0495687_093283 3300047443 Bacteria 1147
402 Ga0495687_130798 3300047443 Unclassified 889
403 Ga0495681_0375416 3300047470 Bacteria 536
404 Ga0495686_0136744 3300047472 Bacteria 1449
405 Ga0495626_0184827 3300048091 Bacteria 862
406 Ga0496118_0008276 3300048921 Bacteria 10780
407 Ga0496121_0120501 3300048924 Bacteria 1982
408 Ga0496124_0004848 3300048927 Bacteria 15474
409 Ga0496125_0000453 3300048928 Bacteria 74032
410 Ga0496126_0170718 3300048929 Bacteria 1853
411 Ga0495682_0000253 3300049460 Bacteria 42266
412 Ga0501031_0080158 3300049568 Bacteria 2128
413 Ga0501033_0381001 3300049570 Bacteria 985
414 Ga0501043_0669476 3300049579 Bacteria 761
415 Ga0501047_0006703 3300049581 Bacteria 10826
416 Ga0501047_0235380 3300049581 Bacteria 1683
417 Ga0501069_0027641 3300049585 Bacteria 3109
418 Ga0501069_0144479 3300049585 Bacteria 1365
419 Ga0501070_0017543 3300049586 Bacteria 6009
420 Ga0501070_0926725 3300049586 Bacteria 678
421 Ga0501074_0011233 3300049590 Bacteria 6508
422 Ga0501074_0026870 3300049590 Bacteria 4171
423 Ga0501080_0083128 3300049742 Bacteria 2974
424 Ga0501035_0001136 3300049822 Bacteria 27827
425 Ga0501035_0014043 3300049822 Bacteria 7389
426 Ga0501035_0025899 3300049822 Bacteria 5374
427 Ga0501044_0005139 3300049823 Bacteria 14596
428 Ga0501044_0040131 3300049823 Bacteria 4880
429 Ga0500637_0037708 3300053178 Bacteria 2718
430 Ga0500645_000125 3300053730 Bacteria 60408
431 Ga0466962_0011701 3300061719 Bacteria 4224
432 Ga0466962_0026235 3300061719 Bacteria 2798
433 Ga0466962_0101933 3300061719 Bacteria 1378
434 2842915263 2842914999 Bacteria 4419378
435 Ga0395899_0000195
436 JGI24741J21665_1007211
437 JGI24740J21852_10005850
438 JGI24735J21928_10037937
439 JGI24735J21928_10088914
440 JGI25156J39149_1001399
441 JGI25156J39149_1005352
442 JGI25156J39149_1016224
443 JGI25162J39368_1000623
444 JGI25157J39369_1000688
445 JGI25157J39369_1000957
446 JGI25157J39369_1001266
447 JGI25157J39369_1001843
448 JGI25164J39214_1000061
449 JGI25165J46597_1000151
450 rootH1_10001690
451 rootH1_10015253
452 rootH1_10069259
453 rootH2_10188676
454 rootL2_10223282
455 Ga0055539_1000614
456 Ga0055533_1003355
457 Ga0055525_1000856
458 Ga0055527_1000271
459 Ga0055527_1000273
460 Ga0055527_1001390
461 Ga0055535_1000466
462 Ga0055535_1000567
463 Ga0055535_1000574
464 Ga0055535_1001249
465 Ga0055542_1000104
466 Ga0055542_1000591
467 Ga0055542_1000597
468 Ga0055542_1000689
469 Ga0055529_1000140
470 Ga0055529_1000556
471 Ga0055529_1000815
472 Ga0055540_1031184
473 Ga0065165_1003621
474 Ga0070658_10085707
475 Ga0070658_11438495
476 Ga0070676_11273675
477 Ga0070683_100996893
478 Ga0070670_100044231
479 Ga0070670_100352941
480 Ga0070666_10000147
481 Ga0070666_10386837
482 Ga0070666_10658871
483 Ga0070680_100001573
484 Ga0070680_100003828
485 Ga0070680_100268359
486 Ga0070682_100021303
487 Ga0068868_100624736
488 Ga0070660_100728879
489 Ga0070660_100999572
490 Ga0070691_10000632
491 Ga0070691_10014054
492 Ga0070691_10387550
493 Ga0070661_100006470
494 Ga0070661_100068127
495 Ga0070661_100202639
496 Ga0070692_10012084
497 Ga0070675_101883672
498 Ga0070671_100599497
499 Ga0070688_100348317
500 Ga0070659_101817452
501 Ga0070667_100075406
502 Ga0070667_100083316
503 Ga0070667_100197106
504 Ga0070667_100328708
505 Ga0070714_100027069
506 Ga0070713_100001768
507 Ga0070710_10583170
508 Ga0070700_100509143
509 Ga0070663_100003695
510 Ga0070663_100011678
511 Ga0070663_100012260
512 Ga0070663_100500802
513 Ga0070663_100530814
514 Ga0070663_100839393
515 Ga0070662_100249361
516 Ga0070681_10000170
517 Ga0070681_10000566
518 Ga0070681_10351753
519 Ga0070685_10002899
520 Ga0070679_100000116
521 Ga0070679_100000161
522 Ga0070679_100395718
523 Ga0068853_100110668
524 Ga0068853_100130277
525 Ga0068853_100514835
526 Ga0068853_100584877
527 Ga0068853_100839539
528 Ga0070696_100051387
529 Ga0070693_100012351
530 Ga0070693_100346909
531 Ga0070665_100003246
532 Ga0068855_100001262
533 Ga0068855_100054841
534 Ga0068855_100160813
535 Ga0068855_100272037
536 Ga0068855_100689784
537 Ga0070664_100179554
538 Ga0068857_100031650
539 Ga0068857_100075200
540 Ga0068857_101001711
541 Ga0068854_100003226
542 Ga0068854_100006415
543 Ga0068854_100008699
544 Ga0068854_100011439
545 Ga0068854_100135822
546 Ga0068856_100001887
547 Ga0068856_100014695
548 Ga0068856_100271655
549 Ga0068856_101393879
550 Ga0068856_101414571
551 Ga0068852_100003447
552 Ga0068852_100017791
553 Ga0068852_100022492
554 Ga0068852_100924884
555 Ga0068852_101042303
556 Ga0068861_101350143
557 Ga0068851_10044389
558 Ga0068863_101078198
559 Ga0068858_100001471
560 Ga0068858_100085962
561 Ga0068858_100461815
562 Ga0068860_100077355
563 Ga0097621_100890368
564 Ga0068871_100452729
565 Ga0068865_100056151
566 Ga0105240_10000628
567 Ga0105240_10016106
568 Ga0105240_10037706
569 Ga0105240_10089162
570 Ga0105240_10121260
571 Ga0105240_10142858
572 Ga0105240_11098089
573 Ga0105240_11325699
574 Ga0105247_11385324
575 Ga0105241_10155446
576 Ga0105241_10209076
577 Ga0105242_10531240
578 Ga0105237_10000007
579 Ga0105237_10001579
580 Ga0105237_10145653
581 Ga0105237_10199452
582 Ga0105237_10265775
583 Ga0105237_10470028
584 Ga0105237_12161239
585 Ga0105238_10009646
586 Ga0105238_10017994
587 Ga0105239_10038440
588 Ga0105239_10922815
589 Ga0105239_12249297
590 Ga0157314_1000708
591 Ga0157373_10028369
592 Ga0157373_10104753
593 Ga0157373_10291051
594 Ga0157371_10036582
595 Ga0157371_10234939
596 Ga0157370_10005469
597 Ga0157370_10005994
598 Ga0157370_10015501
599 Ga0157370_10173497
600 Ga0157369_10029181
601 Ga0157369_10300904
602 Ga0157369_10670173
603 Ga0157369_10908426
604 Ga0157372_10003063
605 Ga0157372_10042347
606 Ga0157372_10054209
607 Ga0157372_10682455
608 Ga0163163_10342204
609 Ga0163163_11808292
610 Ga0182008_10079132
611 Ga0157379_10146214
612 Ga0157379_10470581
613 Ga0157376_12355077
614 Ga0182006_1019506
615 Ga0182007_10068270
616 Ga0197907_10963472
617 Ga0206356_11905613
618 Ga0206354_10073402
619 Ga0206354_10980198
620 Ga0206353_10006090
621 Ga0206353_11177962
622 Ga0154015_1149957
623 Ga0154015_1387000
624 Ga0213875_10588831
625 Ga0209674_100053
626 Ga0209674_100898
627 Ga0209672_100009
628 Ga0209672_100024
629 Ga0209672_100107
630 Ga0209672_100742
631 Ga0209563_100127
632 Ga0207427_100021
633 Ga0209437_100150
634 Ga0209258_100011
635 Ga0209258_100045
636 Ga0209258_100047
637 Ga0209258_100299
638 Ga0209646_1000553
639 Ga0209646_1002921
640 Ga0209026_1000010
641 Ga0209026_1000163
642 Ga0209026_1000391
643 Ga0209677_102437
644 Ga0209148_1000013
645 Ga0209148_1000052
646 Ga0209148_1000054
647 Ga0209148_1000205
648 Ga0209759_1000622
649 Ga0209759_1001819
650 Ga0209759_1004122
651 Ga0209233_1000023
652 Ga0209233_1000754
653 Ga0209455_1000012
654 Ga0209455_1000052
655 Ga0209455_1000081
656 Ga0209455_1000357
657 Ga0209758_1068764
658 Ga0207426_1122274
659 Ga0209051_1039305
660 Ga0207656_10032328
661 Ga0207680_10001024
662 Ga0207647_10000055
663 Ga0207647_10006694
664 Ga0207647_10016475
665 Ga0207647_10034514
666 Ga0207705_10002078
667 Ga0207705_10042417
668 Ga0207705_10064918
669 Ga0207705_10645540
670 Ga0207705_11069045
671 Ga0207654_10604929
672 Ga0207707_10000181
673 Ga0207707_10000249
674 Ga0207707_10225057
675 Ga0207695_10000040
676 Ga0207695_10001115
677 Ga0207695_10001214
678 Ga0207695_10006440
679 Ga0207695_10007575
680 Ga0207695_10033408
681 Ga0207695_10098510
682 Ga0207695_10506546
683 Ga0207695_11314760
684 Ga0207671_10000074
685 Ga0207671_10001275
686 Ga0207671_10117571
687 Ga0207671_10301182
688 Ga0207671_10358967
689 Ga0207660_10000392
690 Ga0207660_10001068
691 Ga0207660_10052724
692 Ga0207657_10005252
693 Ga0207657_10027032
694 Ga0207657_10354480
695 Ga0207649_10036263
696 Ga0207652_10000017
697 Ga0207652_10000134
698 Ga0207652_10554159
699 Ga0207694_10011485
700 Ga0207694_10013173
701 Ga0207694_10072728
702 Ga0207694_10443235
703 Ga0207659_11496921
704 Ga0207700_10001549
705 Ga0207664_10027619
706 Ga0207690_10013292
707 Ga0207706_10038728
708 Ga0207706_10139233
709 Ga0207661_10761339
710 Ga0207667_10000292
711 Ga0207667_10000486
712 Ga0207667_10013808
713 Ga0207667_10019145
714 Ga0207667_10022774
715 Ga0207667_10141687
716 Ga0207712_10000120
717 Ga0207640_10000042
718 Ga0207640_10000454
719 Ga0207640_10011131
720 Ga0207640_10017776
721 Ga0207640_10035289
722 Ga0207640_10088387
723 Ga0207658_10007176
724 Ga0207658_10037444
725 Ga0207658_10090521
726 Ga0207677_10607810
727 Ga0207703_10000422
728 Ga0207703_10338515
729 Ga0207639_10010801
730 Ga0207639_10025396
731 Ga0207639_10078959
732 Ga0207639_10437987
733 Ga0207678_10002963
734 Ga0207678_10005003
735 Ga0207678_10024920
736 Ga0207678_10068890
737 Ga0207678_10107290
738 Ga0207678_10340436
739 Ga0207702_10000185
740 Ga0207702_10007958
741 Ga0207702_10013707
742 Ga0207702_10054129
743 Ga0207702_10674167
744 Ga0207648_11416608
745 Ga0207674_10005801
746 Ga0207674_10036889
747 Ga0207674_10909781
748 Ga0207675_101349256
749 Ga0207698_10001340
750 Ga0207698_10176903
751 Ga0207698_10728737
752 Ga0207698_11061071
753 Ga0268266_10000007
754 Ga0307511_10000227
755 Ga0307508_10367712
756 Ga0373932_0269183
757 Ga0395899_0002906
758 Ga0395899_0068099
759 Ga0395900_0000018
760 Ga0395900_0063004
761 Ga0395900_0073760
762 Ga0395898_0000530
763 Ga0395898_0000533
764 Ga0395898_0204837
765 Ga0395905_0216248
766 Ga0436364_0299690
767 Ga0436364_1015581
768 Ga0395901_0090499
769 Ga0395901_0107063
770 Ga0395901_0242555
771 Ga0395901_0751179
772 Ga0436363_1087732
773 Ga0451787_331953
774 Ga0451787_345793
775 Ga0451793_0174362
776 Ga0451802_1059221
777 Ga0451807_2391893
778 Ga0451849_0521976
779 Ga0439432_027597
780 Ga0466969_0003759
781 Ga0466969_0018095
782 Ga0466969_0022787
783 Ga0466969_0045095
784 Ga0466969_0222466
785 Ga0466972_0002849
786 Ga0466972_0024012
787 Ga0466972_0178568
788 Ga0466975_0091725
789 Ga0466989_0245938
790 Ga0466982_0000013
791 Ga0466965_0015621
792 Ga0466965_0238957
793 Ga0466966_0008164
794 Ga0466966_0016818
795 Ga0466966_0024873
796 Ga0466966_0041291
797 Ga0466961_0000604
798 Ga0466961_0002035
799 Ga0466961_0005214
800 Ga0466961_0156650
801 Ga0466961_0162207
802 Ga0466963_0361745
803 Ga0466963_0767469
804 Ga0466963_0837378
805 Ga0466964_0003523
806 Ga0466971_0010842
807 Ga0466971_0040654
808 Ga0466971_0329127
809 Ga0466968_0024342
810 Ga0466968_0335974
811 Ga0466968_0611689
812 Ga0466970_0004581
813 Ga0466970_0009612
814 Ga0466970_0024231
815 Ga0466957_0004881
816 Ga0466957_0114200
817 Ga0466960_0003521
818 Ga0466959_0000043
819 Ga0466959_0082242
820 Ga0466959_0352316
821 Ga0466959_0674200
822 Ga0466959_0697522
823 Ga0466958_0017336
824 Ga0466958_0037486
825 Ga0466958_0044748
826 Ga0466958_0083028
827 Ga0466958_0166976
828 Ga0466967_0060508
829 Ga0495585_0000021
830 Ga0495631_0000060
831 Ga0495648_0000688
832 Ga0495661_0000353
833 Ga0495588_0170785
834 Ga0495687_093283
835 Ga0495687_130798
836 Ga0495681_0375416
837 Ga0495686_0136744
838 Ga0495626_0184827
839 Ga0496118_0008276
840 Ga0496121_0120501
841 Ga0496124_0004848
842 Ga0496125_0000453
843 Ga0496126_0170718
844 Ga0495682_0000253
845 Ga0501031_0080158
846 Ga0501033_0381001
847 Ga0501043_0669476
848 Ga0501047_0006703
849 Ga0501047_0235380
850 Ga0501069_0027641
851 Ga0501069_0144479
852 Ga0501070_0017543
853 Ga0501070_0926725
854 Ga0501074_0011233
855 Ga0501074_0026870
856 Ga0501080_0083128
857 Ga0501035_0001136
858 Ga0501035_0014043
859 Ga0501035_0025899
860 Ga0501044_0005139
861 Ga0501044_0040131
862 Ga0500637_0037708
863 Ga0500645_000125
864 Ga0466962_0011701
865 Ga0466962_0026235
866 Ga0466962_0101933
867 2842915263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05336

rhaM

L-rhamnose mutarotase

15

122

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.8847 1 110
7byw-assembly1.cif.gz_B crystal structure of acidovorax avenae l-fucose mutarotase (l-fucose-bound form) 0.8697 1 110
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.8075 1 110
2qlw-assembly1.cif.gz_A crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum 0.792 1 110
6hhn-assembly1.cif.gz_A-2 crystal structure of l-rhamnose mutarotase fa22100 from formosa agariphila 0.7852 1 110
ID Description Score Start End Superfamily
af_Q556R9_3_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8961 1 96 3.30.70.100
af_Q556R9_3_105_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8228 1 96 3.30.70.100
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8169 1 93 3.30.70.100
5ds1C00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7793 41 58 2.60.40.790
1x8dD01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.7333 1 93 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A1I2AT11-F1-model_v4 L-rhamnose mutarotase 0.9956 4 112 GO:0016857
AF-A0A4R0N005-F1-model_v4 L-rhamnose mutarotase 0.994 1 110 GO:0016857
AF-A0A3M1YH93-F1-model_v4 L-rhamnose mutarotase 0.9932 1 112 GO:0016857
AF-A0A1V3PGZ2-F1-model_v4 L-fucose mutarotase 0.9925 1 117 GO:0016857
AF-A0A1H0ZWE0-F1-model_v4 L-rhamnose mutarotase 0.9921 1 116 GO:0016857

Map