F442825

General Info

Members Datasets Scaffolds Average Seq Length
433 267 393 298

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10026303|Ga0105237_100263035
Length 313
Sequence MTDILTNPETTQTPTGGIILGPNQYGKAEVRVVKVTRDTDRHEIEDLNVTSQLRGDLARAHLAGDNAHVVPTDTQKNTVYAFARDGIGSPEAFLLRLADHFTSEFEWITGGRWLAESYAWERIVLEGDEHDHAFVRKGQEVRTAGVVADGDERHVVSGLKDLKVLKSTGSGFEGYPKDRYTTLKETNDRILATSVATQWRYLPGTVDADFNAIYDDVKRILLEEFSRRYSAALQTTLFDMGKAVLEAHPEIGEIRFSMPNSHHFVVDLSPFGLDNPNEVFYAADRPYGLIEATVTREGLAPAPEVWASVVPFV

Samples

Sample ID Description Type Environment
1 2643221549 Agromyces sp. Root1464 Isolate Unclassified
2 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
3 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
4 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
5 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
6 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
7 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
8 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
9 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
10 2808606372 Agromyces sp. 23-23 Isolate Unclassified
11 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
12 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
13 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
14 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
15 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
16 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
17 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
18 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
19 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
20 2919395869 Microbacterium resistens 2980 Isolate Unclassified
21 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
22 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
23 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
24 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
25 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
26 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
27 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
28 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
29 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
30 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
31 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
32 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
33 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
34 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
35 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
36 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
37 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
38 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
39 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
40 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
41 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
42 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
43 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
46 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
47 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
50 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
51 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
54 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
142 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
150 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
157 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
168 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
169 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
170 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
171 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
172 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
173 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
174 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
175 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
178 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
179 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
180 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
181 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
184 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
185 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
186 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
187 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
188 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
189 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
190 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
191 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
253 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
260 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
261 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
262 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
266 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
267 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.07
Metatranscriptomes 0.69
Isolates 9.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.54
Nodule 0
Rhizoplane 16.4
Rhizosphere 74.36
Stem 0
Stem Tuber 0
Unclassified 6.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001647 3300001979 Bacteria 10257
2 rootL2_10254473 3300003322 Bacteria 1614
3 Ga0070676_10003557 3300005328 Bacteria 8150
4 Ga0070690_100167681 3300005330 Bacteria 1509
5 Ga0070670_100029688 3300005331 Bacteria 4708
6 Ga0070677_10004518 3300005333 Bacteria 4543
7 Ga0070666_10010854 3300005335 Bacteria 5706
8 Ga0070682_100023950 3300005337 Bacteria 3629
9 Ga0070682_100038952 3300005337 Bacteria 2918
10 Ga0070682_100177579 3300005337 Bacteria 1485
11 Ga0070691_10145508 3300005341 Bacteria 1211
12 Ga0070668_100020216 3300005347 Bacteria 5022
13 Ga0070668_100084164 3300005347 Bacteria 2498
14 Ga0070669_100000071 3300005353 Bacteria 99275
15 Ga0070669_100155461 3300005353 Bacteria 1773
16 Ga0070675_100016214 3300005354 Bacteria 5911
17 Ga0070675_100208590 3300005354 Bacteria 1698
18 Ga0070671_100048009 3300005355 Bacteria 3549
19 Ga0070673_100006222 3300005364 Bacteria 7745
20 Ga0070667_100020891 3300005367 Bacteria 5438
21 Ga0070700_100039216 3300005441 Bacteria 2892
22 Ga0070694_100005861 3300005444 Bacteria 7453
23 Ga0070663_100197035 3300005455 Bacteria 1570
24 Ga0070663_100233851 3300005455 Bacteria 1448
25 Ga0070678_100004892 3300005456 Bacteria 7660
26 Ga0070662_100057122 3300005457 Bacteria 2835
27 Ga0070681_10223764 3300005458 Bacteria 1797
28 Ga0068867_100389048 3300005459 Bacteria 1173
29 Ga0070706_100000392 3300005467 Bacteria 52726
30 Ga0070698_100093926 3300005471 Bacteria 2979
31 Ga0070684_100241091 3300005535 Bacteria 1652
32 Ga0068853_100081264 3300005539 Bacteria 2837
33 Ga0070672_100059821 3300005543 Bacteria 2998
34 Ga0070696_100002316 3300005546 Bacteria 12565
35 Ga0070696_100015109 3300005546 Bacteria 5183
36 Ga0070665_100259091 3300005548 Bacteria 1740
37 Ga0070704_100286224 3300005549 Unclassified 1368
38 Ga0068857_100373145 3300005577 Bacteria 1324
39 Ga0068854_100111246 3300005578 Bacteria 2066
40 Ga0068852_100193604 3300005616 Bacteria 1920
41 Ga0068866_10035622 3300005718 Bacteria 2432
42 Ga0068861_100053111 3300005719 Bacteria 3082
43 Ga0068861_100103564 3300005719 Bacteria 2269
44 Ga0068870_10177729 3300005840 Bacteria 1275
45 Ga0075364_10018490 3300006051 Bacteria 4363
46 Ga0075364_10062495 3300006051 Bacteria 2443
47 Ga0075432_10000394 3300006058 Bacteria 12698
48 Ga0075362_10058974 3300006177 Bacteria 1732
49 Ga0097621_100259507 3300006237 Bacteria 1524
50 Ga0075428_100667745 3300006844 Bacteria 1108
51 Ga0068865_100012938 3300006881 Bacteria 5262
52 Ga0105251_10011240 3300009011 Bacteria 5124
53 Ga0105244_10014738 3300009036 Bacteria 4512
54 Ga0105244_10018145 3300009036 Bacteria 3957
55 Ga0105244_10026484 3300009036 Bacteria 3137
56 Ga0105245_10008834 3300009098 Bacteria 8791
57 Ga0105245_10024388 3300009098 Bacteria 5310
58 Ga0105245_10589534 3300009098 Bacteria 1137
59 Ga0105247_10075218 3300009101 Bacteria 2119
60 Ga0105243_10010102 3300009148 Bacteria 7180
61 Ga0105243_10014944 3300009148 Bacteria 5876
62 Ga0105243_10070009 3300009148 Bacteria 2831
63 Ga0105242_10015926 3300009176 Bacteria 5842
64 Ga0105248_10081628 3300009177 Bacteria 3634
65 Ga0105237_10026303 3300009545 Bacteria 5947
66 Ga0105238_10070630 3300009551 Bacteria 3491
67 Ga0105249_10005243 3300009553 Bacteria 11189
68 Ga0105239_10146848 3300010375 Bacteria 2631
69 Ga0105246_10004658 3300011119 Bacteria 8348
70 Ga0105246_10051465 3300011119 Bacteria 2828
71 Ga0157373_10141046 3300013100 Bacteria 1695
72 Ga0157371_10170926 3300013102 Bacteria 1553
73 Ga0157370_10014675 3300013104 Bacteria 8003
74 Ga0157370_10627147 3300013104 Bacteria 983
75 Ga0157369_10077411 3300013105 Bacteria 3564
76 Ga0157369_10141381 3300013105 Bacteria 2547
77 Ga0157369_10293179 3300013105 Bacteria 1693
78 Ga0157374_10217633 3300013296 Bacteria 1874
79 Ga0157378_10058923 3300013297 Bacteria 3425
80 Ga0157378_10069002 3300013297 Unclassified 3171
81 Ga0163162_10025189 3300013306 Bacteria 5880
82 Ga0163162_10030727 3300013306 Bacteria 5323
83 Ga0163162_10052863 3300013306 Bacteria 4081
84 Ga0163162_10106350 3300013306 Bacteria 2901
85 Ga0163162_10222090 3300013306 Bacteria 2019
86 Ga0163162_10304422 3300013306 Bacteria 1726
87 Ga0157372_10113401 3300013307 Bacteria 3107
88 Ga0157375_10040275 3300013308 Bacteria 4503
89 Ga0157375_10050348 3300013308 Bacteria 4086
90 Ga0157375_10325153 3300013308 Bacteria 1703
91 Ga0157375_10773201 3300013308 Bacteria 1110
92 Ga0157380_10040417 3300014326 Bacteria 3632
93 Ga0157380_10046636 3300014326 Bacteria 3405
94 Ga0157380_10438535 3300014326 Bacteria 1251
95 Ga0157377_10281689 3300014745 Bacteria 1090
96 Ga0163161_10029728 3300017792 Bacteria 3885
97 Ga0207697_10001798 3300025315 Bacteria 11484
98 Ga0207697_10005059 3300025315 Bacteria 6176
99 Ga0207655_1008593 3300025728 Bacteria 6460
100 Ga0207655_1036256 3300025728 Bacteria 2189
101 Ga0207713_1027839 3300025735 Bacteria 2559
102 Ga0207682_10000910 3300025893 Bacteria 13708
103 Ga0207642_10024367 3300025899 Bacteria 2432
104 Ga0207688_10055679 3300025901 Bacteria 2220
105 Ga0207680_10042095 3300025903 Bacteria 2669
106 Ga0207645_10000494 3300025907 Bacteria 32513
107 Ga0207643_10151589 3300025908 Bacteria 1390
108 Ga0207684_10000852 3300025910 Bacteria 35040
109 Ga0207707_10030688 3300025912 Unclassified 4702
110 Ga0207671_10074888 3300025914 Bacteria 2531
111 Ga0207681_10041892 3300025923 Bacteria 3055
112 Ga0207681_10221234 3300025923 Bacteria 1465
113 Ga0207650_10030318 3300025925 Bacteria 3895
114 Ga0207659_10092402 3300025926 Bacteria 2262
115 Ga0207659_10253670 3300025926 Bacteria 1428
116 Ga0207687_10046183 3300025927 Bacteria 3014
117 Ga0207644_10023850 3300025931 Bacteria 4195
118 Ga0207706_10029209 3300025933 Bacteria 4923
119 Ga0207686_10062194 3300025934 Bacteria 2370
120 Ga0207709_10044203 3300025935 Bacteria 2690
121 Ga0207709_10081372 3300025935 Bacteria 2088
122 Ga0207709_10296394 3300025935 Bacteria 1201
123 Ga0207669_10067641 3300025937 Bacteria 2227
124 Ga0207704_10054687 3300025938 Bacteria 2435
125 Ga0207691_10002730 3300025940 Bacteria 17235
126 Ga0207711_10521420 3300025941 Bacteria 1108
127 Ga0207689_10304871 3300025942 Bacteria 1320
128 Ga0207689_10408200 3300025942 Bacteria 1133
129 Ga0207668_10031243 3300025972 Bacteria 3506
130 Ga0207668_10148382 3300025972 Bacteria 1812
131 Ga0207678_10145951 3300026067 Bacteria 2019
132 Ga0207708_10032060 3300026075 Bacteria 3990
133 Ga0207648_10250098 3300026089 Bacteria 1580
134 Ga0207648_10303227 3300026089 Bacteria 1433
135 Ga0207674_10587726 3300026116 Bacteria 1076
136 Ga0207675_100072254 3300026118 Bacteria 3227
137 Ga0207675_100136235 3300026118 Bacteria 2330
138 Ga0207675_100693749 3300026118 Bacteria 1026
139 Ga0207683_10004822 3300026121 Bacteria 11614
140 Ga0207683_10006854 3300026121 Bacteria 9757
141 Ga0207698_10031251 3300026142 Bacteria 3841
142 Ga0207428_10042413 3300027907 Bacteria 3680
143 Ga0268266_10270201 3300028379 Bacteria 1578
144 Ga0268265_10057347 3300028380 Bacteria 2968
145 Ga0268265_10689509 3300028380 Bacteria 986
146 Ga0307517_10108317 3300028786 Bacteria 2134
147 Ga0307515_10006764 3300028794 Bacteria 22817
148 Ga0307512_10004049 3300030522 Bacteria 16323
149 Ga0307408_100059498 3300031548 Bacteria 2780
150 Ga0307408_100112148 3300031548 Bacteria 2096
151 Ga0307408_100190830 3300031548 Bacteria 1650
152 Ga0307508_10017800 3300031616 Bacteria 6463
153 Ga0307516_10069042 3300031730 Bacteria 3400
154 Ga0307405_10073763 3300031731 Bacteria 2204
155 Ga0307405_10184403 3300031731 Bacteria 1501
156 Ga0307405_10443169 3300031731 Bacteria 1028
157 Ga0307413_10163121 3300031824 Bacteria 1568
158 Ga0307413_10236212 3300031824 Bacteria 1346
159 Ga0307413_10354022 3300031824 Bacteria 1134
160 Ga0307410_10004710 3300031852 Bacteria 7099
161 Ga0307410_10026067 3300031852 Bacteria 3674
162 Ga0307410_10036536 3300031852 Bacteria 3199
163 Ga0307410_10138848 3300031852 Bacteria 1795
164 Ga0307410_10217947 3300031852 Bacteria 1466
165 Ga0307410_10402966 3300031852 Bacteria 1106
166 Ga0307406_10000081 3300031901 Bacteria 53682
167 Ga0307406_10000107 3300031901 Bacteria 48696
168 Ga0307407_10002638 3300031903 Bacteria 7089
169 Ga0307412_10021976 3300031911 Bacteria 3904
170 Ga0307412_10039424 3300031911 Bacteria 3049
171 Ga0307412_10066236 3300031911 Bacteria 2447
172 Ga0307412_10145065 3300031911 Bacteria 1743
173 Ga0307412_10520755 3300031911 Bacteria 993
174 Ga0307409_100000155 3300031995 Bacteria 26095
175 Ga0307409_100000479 3300031995 Bacteria 17090
176 Ga0307409_100054443 3300031995 Bacteria 3081
177 Ga0307409_100062558 3300031995 Bacteria 2914
178 Ga0307409_100343030 3300031995 Bacteria 1406
179 Ga0307409_100370872 3300031995 Bacteria 1357
180 Ga0307416_100000458 3300032002 Bacteria 20945
181 Ga0307416_100439213 3300032002 Bacteria 1354
182 Ga0307416_100445960 3300032002 Bacteria 1345
183 Ga0307416_100594506 3300032002 Bacteria 1185
184 Ga0307414_10021524 3300032004 Bacteria 4049
185 Ga0307414_10047799 3300032004 Bacteria 2948
186 Ga0307414_10095453 3300032004 Bacteria 2222
187 Ga0307414_10153003 3300032004 Bacteria 1822
188 Ga0307414_10430060 3300032004 Bacteria 1153
189 Ga0307415_100002229 3300032126 Bacteria 9601
190 Ga0307415_100057084 3300032126 Bacteria 2681
191 Ga0307415_100110535 3300032126 Bacteria 2038
192 Ga0373946_0123368 3300035171 Bacteria 1185
193 Ga0373931_0161781 3300035691 Unclassified 1313
194 Ga0373927_0012924 3300035695 Bacteria 5552
195 Ga0373947_0001685 3300035725 Bacteria 13534
196 Ga0373947_0045068 3300035725 Bacteria 2639
197 Ga0373925_0000511 3300037068 Bacteria 39064
198 Ga0395899_0118168 3300037312 Bacteria 1901
199 Ga0395900_0002060 3300037418 Bacteria 22555
200 Ga0395900_0099365 3300037418 Bacteria 2989
201 Ga0395900_0134540 3300037418 Bacteria 2532
202 Ga0395898_0115438 3300037466 Bacteria 2572
203 Ga0395898_0187321 3300037466 Bacteria 1977
204 Ga0395898_0266998 3300037466 Bacteria 1632
205 Ga0395898_0330913 3300037466 Bacteria 1452
206 Ga0395905_0176919 3300037471 Bacteria 2003
207 Ga0395905_0280061 3300037471 Bacteria 1554
208 Ga0395901_0022620 3300038443 Bacteria 6444
209 Ga0395901_0051631 3300038443 Bacteria 4276
210 Ga0395901_0125302 3300038443 Bacteria 2699
211 Ga0395901_0127233 3300038443 Bacteria 2677
212 Ga0395901_0202160 3300038443 Bacteria 2082
213 Ga0436365_0341334 3300039437 Bacteria 1929
214 Ga0439436_0007585 3300041404 Bacteria 3339
215 Ga0439436_0067210 3300041404 Bacteria 1000
216 Ga0439438_002722 3300041405 Bacteria 7420
217 Ga0439439_0014351 3300041406 Bacteria 1928
218 Ga0439439_0021133 3300041406 Bacteria 1620
219 Ga0439466_0016861 3300041411 Bacteria 2635
220 Ga0451791_0442543 3300041451 Bacteria 7256
221 Ga0451793_0036142 3300041452 Bacteria 1149
222 Ga0451797_0675675 3300041453 Bacteria 1882
223 Ga0451795_0507404 3300041456 Bacteria 1851
224 Ga0451843_0626121 3300041509 Bacteria 1410
225 Ga0451853_2847913 3300041512 Bacteria 2213
226 Ga0439431_0021287 3300041997 Bacteria 1556
227 Ga0439433_0003681 3300041999 Bacteria 3293
228 Ga0439433_0018871 3300041999 Bacteria 1536
229 Ga0439442_000093 3300042002 Bacteria 21417
230 Ga0439442_001278 3300042002 Bacteria 5008
231 Ga0439448_0034323 3300042005 Bacteria 1621
232 Ga0439432_013818 3300042006 Bacteria 2739
233 Ga0439449_0002435 3300042007 Bacteria 7273
234 Ga0439452_012758 3300042010 Bacteria 2378
235 Ga0439455_0006307 3300042012 Bacteria 2457
236 Ga0439457_007987 3300042014 Bacteria 2512
237 Ga0439457_031820 3300042014 Bacteria 1170
238 Ga0439457_045240 3300042014 Bacteria 983
239 Ga0439462_0009040 3300042015 Bacteria 2519
240 Ga0439462_0012330 3300042015 Bacteria 2182
241 Ga0439462_0047861 3300042015 Bacteria 1146
242 Ga0439463_001558 3300042016 Bacteria 6051
243 Ga0450919_003393 3300042121 Bacteria 2003
244 Ga0450920_017108 3300042122 Bacteria 1384
245 Ga0450907_000188 3300042146 Bacteria 22583
246 Ga0450908_015733 3300042184 Bacteria 1353
247 Ga0439434_0009266 3300042435 Bacteria 2892
248 Ga0439434_0021609 3300042435 Bacteria 1933
249 Ga0439464_0006260 3300042439 Bacteria 3097
250 Ga0450918_001159 3300042531 Bacteria 5404
251 Ga0450918_005240 3300042531 Bacteria 2337
252 Ga0451577_0006662 3300042876 Bacteria 11468
253 Ga0439440_0002129 3300042993 Bacteria 3699
254 Ga0466972_0020905 3300044658 Bacteria 3268
255 Ga0453684_0091134 3300044712 Bacteria 3764
256 Ga0466970_0000003 3300044765 Bacteria 130770
257 Ga0466957_0011019 3300044842 Bacteria 5201
258 Ga0495638_0134293 3300046460 Bacteria 1451
259 Ga0495653_0106202 3300046463 Bacteria 2026
260 Ga0495580_0019880 3300046472 Bacteria 4980
261 Ga0495582_0060628 3300046473 Bacteria 2088
262 Ga0495639_0002194 3300046475 Bacteria 8592
263 Ga0495662_0346910 3300046476 Unclassified 730
264 Ga0495664_0244268 3300046477 Bacteria 1086
265 Ga0495630_0176137 3300046517 Bacteria 1630
266 Ga0495631_0021245 3300046518 Bacteria 3024
267 Ga0495643_0050788 3300046522 Bacteria 2233
268 Ga0495665_0152020 3300046531 Bacteria 1208
269 Ga0495586_0033643 3300046535 Bacteria 2751
270 Ga0495586_0205302 3300046535 Bacteria 1118
271 Ga0495645_0211908 3300046543 Bacteria 1308
272 Ga0495633_0064993 3300046558 Bacteria 1705
273 Ga0495656_0002415 3300046615 Bacteria 6194
274 Ga0495656_0111467 3300046615 Bacteria 1280
275 Ga0495659_0045057 3300046664 Bacteria 1588
276 Ga0495588_0001124 3300046674 Bacteria 11531
277 Ga0495588_0002936 3300046674 Bacteria 7361
278 Ga0495588_0003646 3300046674 Bacteria 6737
279 Ga0495588_0033086 3300046674 Bacteria 2609
280 Ga0495588_0118107 3300046674 Bacteria 1398
281 Ga0495670_0000694 3300046691 Bacteria 16032
282 Ga0495600_0041007 3300046809 Bacteria 3017
283 Ga0495581_0064306 3300047315 Bacteria 2119
284 Ga0495581_0069756 3300047315 Bacteria 2033
285 Ga0495675_0003278 3300047444 Bacteria 9733
286 Ga0495593_0069116 3300047673 Bacteria 1837
287 Ga0496100_0034609 3300048903 Bacteria 3171
288 Ga0496100_0085212 3300048903 Bacteria 2144
289 Ga0496101_0047349 3300048904 Bacteria 3086
290 Ga0496102_0003570 3300048905 Bacteria 13180
291 Ga0496102_0078039 3300048905 Bacteria 3048
292 Ga0496102_0118563 3300048905 Bacteria 2470
293 Ga0496102_0180465 3300048905 Bacteria 1989
294 Ga0496102_0187478 3300048905 Bacteria 1949
295 Ga0496102_0224250 3300048905 Bacteria 1772
296 Ga0496102_0249069 3300048905 Bacteria 1675
297 Ga0496102_0369884 3300048905 Bacteria 1349
298 Ga0496102_0584586 3300048905 Bacteria 1039
299 Ga0496103_0059856 3300048906 Bacteria 2366
300 Ga0496103_0065381 3300048906 Bacteria 2268
301 Ga0496103_0178907 3300048906 Bacteria 1363
302 Ga0496104_0108157 3300048907 Bacteria 2664
303 Ga0496104_0110389 3300048907 Bacteria 2636
304 Ga0496104_0285055 3300048907 Bacteria 1564
305 Ga0496105_0033971 3300048908 Bacteria 4193
306 Ga0496105_0082318 3300048908 Bacteria 2658
307 Ga0496105_0136383 3300048908 Bacteria 2022
308 Ga0496105_0293518 3300048908 Bacteria 1308
309 Ga0496106_0009516 3300048909 Bacteria 7178
310 Ga0496106_0015947 3300048909 Bacteria 5556
311 Ga0496106_0038087 3300048909 Bacteria 3598
312 Ga0496106_0073158 3300048909 Bacteria 2621
313 Ga0496107_0019804 3300048910 Bacteria 4750
314 Ga0496107_0034472 3300048910 Bacteria 3626
315 Ga0496107_0046268 3300048910 Bacteria 3131
316 Ga0496107_0054809 3300048910 Bacteria 2878
317 Ga0496107_0115515 3300048910 Bacteria 1975
318 Ga0496107_0446805 3300048910 Bacteria 960
319 Ga0496108_0023326 3300048911 Bacteria 5090
320 Ga0496108_0027575 3300048911 Bacteria 4692
321 Ga0496108_0030459 3300048911 Bacteria 4472
322 Ga0496108_0037974 3300048911 Bacteria 4012
323 Ga0496108_0082738 3300048911 Bacteria 2722
324 Ga0496108_0431155 3300048911 Bacteria 1151
325 Ga0496109_0003558 3300048912 Bacteria 13009
326 Ga0496109_0042178 3300048912 Bacteria 4132
327 Ga0496109_0065370 3300048912 Bacteria 3329
328 Ga0496109_0084898 3300048912 Bacteria 2921
329 Ga0496109_0111434 3300048912 Bacteria 2544
330 Ga0496109_0137787 3300048912 Bacteria 2281
331 Ga0496109_0192545 3300048912 Bacteria 1916
332 Ga0496110_0010495 3300048913 Bacteria 7537
333 Ga0496110_0035883 3300048913 Bacteria 4305
334 Ga0496110_0069682 3300048913 Bacteria 3115
335 Ga0496110_0086397 3300048913 Bacteria 2800
336 Ga0496110_0117717 3300048913 Bacteria 2392
337 Ga0496110_0123472 3300048913 Bacteria 2335
338 Ga0496110_0183382 3300048913 Bacteria 1900
339 Ga0496111_0002522 3300048914 Bacteria 11045
340 Ga0496111_0024864 3300048914 Bacteria 4223
341 Ga0496111_0052877 3300048914 Bacteria 2933
342 Ga0496111_0062762 3300048914 Bacteria 2694
343 Ga0496111_0103496 3300048914 Bacteria 2094
344 Ga0496112_0025455 3300048915 Bacteria 5682
345 Ga0496112_0059321 3300048915 Bacteria 3770
346 Ga0496112_0091625 3300048915 Bacteria 3009
347 Ga0496113_0004700 3300048916 Bacteria 8424
348 Ga0496113_0169719 3300048916 Bacteria 1727
349 Ga0496114_0181554 3300048917 Bacteria 1838
350 Ga0496114_0237737 3300048917 Bacteria 1601
351 Ga0496114_0306647 3300048917 Bacteria 1402
352 Ga0496115_0032937 3300048918 Bacteria 4091
353 Ga0496115_0263384 3300048918 Bacteria 1417
354 Ga0496117_0138231 3300048920 Bacteria 1464
355 Ga0496124_0207207 3300048927 Bacteria 1486
356 Ga0496125_0034154 3300048928 Bacteria 4487
357 Ga0496126_0029257 3300048929 Bacteria 5235
358 Ga0501032_0024780 3300049569 Bacteria 4139
359 Ga0501032_0026857 3300049569 Bacteria 3957
360 Ga0501034_0000066 3300049571 Bacteria 184727
361 Ga0501034_0000590 3300049571 Bacteria 57381
362 Ga0501034_0007026 3300049571 Bacteria 12010
363 Ga0501034_0043281 3300049571 Bacteria 4558
364 Ga0501036_0346952 3300049572 Bacteria 1240
365 Ga0501037_0001842 3300049573 Bacteria 15387
366 Ga0501037_0107762 3300049573 Bacteria 2007
367 Ga0501038_0014197 3300049574 Bacteria 7256
368 Ga0501038_0037165 3300049574 Bacteria 4271
369 Ga0501038_0075186 3300049574 Bacteria 2856
370 Ga0501038_0177443 3300049574 Bacteria 1721
371 Ga0501039_0003194 3300049575 Bacteria 12254
372 Ga0501039_0488747 3300049575 Bacteria 967
373 Ga0501043_0005308 3300049579 Bacteria 10412
374 Ga0501043_0141161 3300049579 Bacteria 1886
375 Ga0501068_0050240 3300049584 Bacteria 2521
376 Ga0501070_0006551 3300049586 Bacteria 9906
377 Ga0501070_0518733 3300049586 Bacteria 956
378 Ga0501072_0423401 3300049588 Bacteria 1055
379 Ga0501073_0010365 3300049589 Bacteria 6837
380 Ga0501044_0066726 3300049823 Bacteria 3668
381 nmdc:mga00v17_13129_c1 3300050491 Bacteria 4589
382 nmdc:mga00v17_52052_c1 3300050491 Bacteria 2491
383 nmdc:mga06z11_129954_c1 3300050494 Bacteria 1413
384 nmdc:mga06z11_257766_c1 3300050494 Bacteria 1028
385 nmdc:mga07m45_39124_c1 3300050496 Bacteria 2649
386 Ga0495619_0079059 3300053085 Bacteria 2212
387 Ga0495619_0135529 3300053085 Bacteria 1694
388 Ga0500651_0059860 3300053093 Bacteria 2381
389 Ga0500650_0028775 3300053098 Bacteria 2512
390 Ga0500569_017403 3300053109 Bacteria 1837
391 Ga0587086_006510 3300059507 Bacteria 1307
392 Ga0587062_013033 3300059639 Bacteria 1075
393 Ga0587072_023088 3300059643 Bacteria 1115

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046476 Ga0495662_0346910 Ga0495662_0346910_24_704 225
2 3300049586 Ga0501070_0518733 Ga0501070_0518733_130_846 238
3 3300005444 Ga0070694_100005861 Ga0070694_1000058612 274
4 3300005546 Ga0070696_100002316 Ga0070696_1000023163 274
5 3300005546 Ga0070696_100015109 Ga0070696_1000151093 274
6 3300005549 Ga0070704_100286224 Ga0070704_1002862242 274
7 3300025912 Ga0207707_10030688 Ga0207707_100306883 274
8 3300025935 Ga0207709_10296394 Ga0207709_102963942 274
9 3300035171 Ga0373946_0123368 Ga0373946_0123368_279_1106 274
10 3300035695 Ga0373927_0012924 Ga0373927_0012924_590_1417 274
11 3300035725 Ga0373947_0001685 Ga0373947_0001685_6709_7536 274
12 3300037068 Ga0373925_0000511 Ga0373925_0000511_11540_12367 274
13 3300046517 Ga0495630_0176137 Ga0495630_0176137_80_907 274
14 3300046531 Ga0495665_0152020 Ga0495665_0152020_308_1135 274
15 3300048905 Ga0496102_0249069 Ga0496102_0249069_635_1465 274
16 3300048906 Ga0496103_0178907 Ga0496103_0178907_83_913 274
17 3300005330 Ga0070690_100167681 Ga0070690_1001676812 275
18 3300005458 Ga0070681_10223764 Ga0070681_102237642 275
19 3300035691 Ga0373931_0161781 Ga0373931_0161781_374_1204 275
20 3300025942 Ga0207689_10408200 Ga0207689_104082002 276
21 3300039437 Ga0436365_0341334 Ga0436365_0341334_769_1608 277
22 3300049584 Ga0501068_0050240 Ga0501068_0050240_1480_2322 278
23 3300005353 Ga0070669_100000071 Ga0070669_10000007155 279
24 3300042876 Ga0451577_0006662 Ga0451577_0006662_6904_7746 279
25 3300044712 Ga0453684_0091134 Ga0453684_0091134_2615_3457 279
26 3300009098 Ga0105245_10589534 Ga0105245_105895341 280
27 3300013297 Ga0157378_10069002 Ga0157378_100690024 280
28 3300035725 Ga0373947_0045068 Ga0373947_0045068_1278_2126 280
29 3300048908 Ga0496105_0033971 Ga0496105_0033971_848_1696 280
30 3300048911 Ga0496108_0023326 Ga0496108_0023326_3437_4285 280
31 3300048912 Ga0496109_0065370 Ga0496109_0065370_1025_1873 280
32 3300048913 Ga0496110_0123472 Ga0496110_0123472_1189_2037 280
33 3300048914 Ga0496111_0103496 Ga0496111_0103496_307_1155 280
34 3300048915 Ga0496112_0059321 Ga0496112_0059321_1216_2064 280
35 3300048916 Ga0496113_0004700 Ga0496113_0004700_6846_7694 280
36 3300049572 Ga0501036_0346952 Ga0501036_0346952_123_971 280
37 3300049588 Ga0501072_0423401 Ga0501072_0423401_136_984 280
38 3300053085 Ga0495619_0079059 Ga0495619_0079059_715_1563 280
39 3300006844 Ga0075428_100667745 Ga0075428_1006677452 281
40 3300005467 Ga0070706_100000392 Ga0070706_10000039211 282
41 3300025910 Ga0207684_10000852 Ga0207684_100008528 282
42 3300026118 Ga0207675_100072254 Ga0207675_1000722542 283
43 3300028786 Ga0307517_10108317 Ga0307517_101083172 285
44 3300028794 Ga0307515_10006764 Ga0307515_100067644 285
45 3300030522 Ga0307512_10004049 Ga0307512_1000404912 285
46 3300031616 Ga0307508_10017800 Ga0307508_100178002 285
47 3300031730 Ga0307516_10069042 Ga0307516_100690424 285
48 3300037466 Ga0395898_0330913 Ga0395898_0330913_41_901 285
49 3300037471 Ga0395905_0176919 Ga0395905_0176919_423_1283 285
50 3300038443 Ga0395901_0127233 Ga0395901_0127233_831_1691 285
51 3300046460 Ga0495638_0134293 Ga0495638_0134293_448_1308 285
52 3300053093 Ga0500651_0059860 Ga0500651_0059860_1344_2204 285
53 3300053098 Ga0500650_0028775 Ga0500650_0028775_46_906 285
54 3300053109 Ga0500569_017403 Ga0500569_017403_879_1739 285
55 iso_pu_bacteria 2738543034 2739363855 292
56 3300005337 Ga0070682_100023950 Ga0070682_1000239503 293
57 3300005337 Ga0070682_100038952 Ga0070682_1000389522 293
58 3300005337 Ga0070682_100177579 Ga0070682_1001775791 293
59 3300005341 Ga0070691_10145508 Ga0070691_101455082 293
60 3300005347 Ga0070668_100084164 Ga0070668_1000841642 293
61 3300005353 Ga0070669_100155461 Ga0070669_1001554612 293
62 3300005441 Ga0070700_100039216 Ga0070700_1000392162 293
63 3300005455 Ga0070663_100197035 Ga0070663_1001970351 293
64 3300005455 Ga0070663_100233851 Ga0070663_1002338511 293
65 3300005457 Ga0070662_100057122 Ga0070662_1000571221 293
66 3300005459 Ga0068867_100389048 Ga0068867_1003890482 293
67 3300005535 Ga0070684_100241091 Ga0070684_1002410912 293
68 3300005539 Ga0068853_100081264 Ga0068853_1000812643 293
69 3300005548 Ga0070665_100259091 Ga0070665_1002590912 293
70 3300005578 Ga0068854_100111246 Ga0068854_1001112462 293
71 3300005616 Ga0068852_100193604 Ga0068852_1001936042 293
72 3300005718 Ga0068866_10035622 Ga0068866_100356224 293
73 3300005719 Ga0068861_100103564 Ga0068861_1001035643 293
74 3300006237 Ga0097621_100259507 Ga0097621_1002595072 293
75 3300006881 Ga0068865_100012938 Ga0068865_1000129382 293
76 3300009098 Ga0105245_10008834 Ga0105245_100088347 293
77 3300009098 Ga0105245_10024388 Ga0105245_100243882 293
78 3300009101 Ga0105247_10075218 Ga0105247_100752182 293
79 3300009148 Ga0105243_10010102 Ga0105243_100101027 293
80 3300009148 Ga0105243_10014944 Ga0105243_100149442 293
81 3300009176 Ga0105242_10015926 Ga0105242_100159266 293
82 3300009551 Ga0105238_10070630 Ga0105238_100706301 293
83 3300009553 Ga0105249_10005243 Ga0105249_100052432 293
84 3300010375 Ga0105239_10146848 Ga0105239_101468483 293
85 3300013296 Ga0157374_10217633 Ga0157374_102176332 293
86 3300013306 Ga0163162_10030727 Ga0163162_100307276 293
87 3300013306 Ga0163162_10222090 Ga0163162_102220903 293
88 3300013307 Ga0157372_10113401 Ga0157372_101134012 293
89 3300013308 Ga0157375_10325153 Ga0157375_103251531 293
90 3300014326 Ga0157380_10040417 Ga0157380_100404175 293
91 3300014326 Ga0157380_10438535 Ga0157380_104385352 293
92 3300014745 Ga0157377_10281689 Ga0157377_102816891 293
93 3300017792 Ga0163161_10029728 Ga0163161_100297283 293
94 3300025899 Ga0207642_10024367 Ga0207642_100243674 293
95 3300025901 Ga0207688_10055679 Ga0207688_100556792 293
96 3300025923 Ga0207681_10221234 Ga0207681_102212342 293
97 3300025927 Ga0207687_10046183 Ga0207687_100461833 293
98 3300025933 Ga0207706_10029209 Ga0207706_100292093 293
99 3300025934 Ga0207686_10062194 Ga0207686_100621942 293
100 3300025935 Ga0207709_10081372 Ga0207709_100813723 293
101 3300025938 Ga0207704_10054687 Ga0207704_100546872 293
102 3300025941 Ga0207711_10521420 Ga0207711_105214201 293
103 3300025972 Ga0207668_10148382 Ga0207668_101483822 293
104 3300026075 Ga0207708_10032060 Ga0207708_100320604 293
105 3300026089 Ga0207648_10250098 Ga0207648_102500982 293
106 3300026089 Ga0207648_10303227 Ga0207648_103032273 293
107 3300026118 Ga0207675_100136235 Ga0207675_1001362352 293
108 3300026118 Ga0207675_100693749 Ga0207675_1006937491 293
109 3300026121 Ga0207683_10006854 Ga0207683_100068546 293
110 3300026142 Ga0207698_10031251 Ga0207698_100312514 293
111 3300028380 Ga0268265_10057347 Ga0268265_100573472 293
112 3300031852 Ga0307410_10004710 Ga0307410_100047107 293
113 3300031901 Ga0307406_10000081 Ga0307406_1000008134 293
114 3300031903 Ga0307407_10002638 Ga0307407_100026387 293
115 3300031995 Ga0307409_100000155 Ga0307409_10000015513 293
116 3300032002 Ga0307416_100000458 Ga0307416_10000045817 293
117 3300032126 Ga0307415_100002229 Ga0307415_1000022297 293
118 3300041451 Ga0451791_0442543 Ga0451791_0442543_6267_7154 293
119 3300041452 Ga0451793_0036142 Ga0451793_0036142_11_898 293
120 3300041453 Ga0451797_0675675 Ga0451797_0675675_763_1650 293
121 3300041456 Ga0451795_0507404 Ga0451795_0507404_323_1210 293
122 3300041509 Ga0451843_0626121 Ga0451843_0626121_16_903 293
123 3300041512 Ga0451853_2847913 Ga0451853_2847913_845_1732 293
124 3300042005 Ga0439448_0034323 Ga0439448_0034323_466_1398 293
125 3300042012 Ga0439455_0006307 Ga0439455_0006307_295_1176 293
126 3300042016 Ga0439463_001558 Ga0439463_001558_487_1419 293
127 3300042439 Ga0439464_0006260 Ga0439464_0006260_739_1671 293
128 3300042993 Ga0439440_0002129 Ga0439440_0002129_2598_3530 293
129 3300046463 Ga0495653_0106202 Ga0495653_0106202_293_1174 293
130 3300046477 Ga0495664_0244268 Ga0495664_0244268_97_978 293
131 3300046543 Ga0495645_0211908 Ga0495645_0211908_378_1259 293
132 3300048903 Ga0496100_0085212 Ga0496100_0085212_56_937 293
133 3300048905 Ga0496102_0180465 Ga0496102_0180465_348_1229 293
134 3300048908 Ga0496105_0136383 Ga0496105_0136383_204_1085 293
135 3300048908 Ga0496105_0293518 Ga0496105_0293518_376_1266 293
136 3300048909 Ga0496106_0038087 Ga0496106_0038087_1801_2682 293
137 3300048910 Ga0496107_0034472 Ga0496107_0034472_1466_2347 293
138 3300048911 Ga0496108_0037974 Ga0496108_0037974_2896_3786 293
139 3300048912 Ga0496109_0003558 Ga0496109_0003558_8937_9818 293
140 3300048913 Ga0496110_0035883 Ga0496110_0035883_1083_1964 293
141 3300048917 Ga0496114_0181554 Ga0496114_0181554_391_1278 293
142 3300048917 Ga0496114_0237737 Ga0496114_0237737_70_951 293
143 3300048917 Ga0496114_0306647 Ga0496114_0306647_420_1301 293
144 3300049569 Ga0501032_0026857 Ga0501032_0026857_86_967 293
145 3300049571 Ga0501034_0007026 Ga0501034_0007026_793_1674 293
146 3300049573 Ga0501037_0001842 Ga0501037_0001842_10898_11779 293
147 3300049574 Ga0501038_0014197 Ga0501038_0014197_2767_3648 293
148 3300049575 Ga0501039_0003194 Ga0501039_0003194_4754_5635 293
149 3300049579 Ga0501043_0005308 Ga0501043_0005308_6765_7646 293
150 3300049586 Ga0501070_0006551 Ga0501070_0006551_7994_8875 293
151 3300049589 Ga0501073_0010365 Ga0501073_0010365_1061_1942 293
152 3300053085 Ga0495619_0135529 Ga0495619_0135529_327_1208 293
153 iso_pu_bacteria 2946041624 2946041757 293
154 iso_pu_bacteria 2946080515 2946083569 293
155 iso_pu_bacteria 2690315906 2691515330 294
156 iso_pu_bacteria 2775506735 2775658168 294
157 iso_pu_bacteria 2808606357 2808828525 294
158 iso_pu_bacteria 2808606360 2808849770 294
159 iso_pu_bacteria 2808606366 2808877639 294
160 iso_pu_bacteria 2808606370 2808892737 294
161 iso_pu_bacteria 2811994871 2812319769 294
162 iso_pu_bacteria 2857740372 2857743675 294
163 iso_pu_bacteria 2904497146 2904500749 294
164 iso_pu_bacteria 2904776348 2904779605 294
165 iso_pu_bacteria 2910809715 2910812252 294
166 iso_pu_bacteria 2919034639 2919037466 294
167 iso_pu_bacteria 2919059106 2919061260 294
168 iso_pu_bacteria 2919391150 2919394234 294
169 iso_pu_bacteria 2919538618 2919542650 294
170 iso_pu_bacteria 2939598168 2939601501 294
171 iso_pu_bacteria 2945916053 2945917515 294
172 iso_pu_bacteria 2945920336 2945922193 294
173 iso_pu_bacteria 2945941187 2945941644 294
174 iso_pu_bacteria 2945956166 2945960650 294
175 iso_pu_bacteria 2946037020 2946037548 294
176 iso_pu_bacteria 2946059875 2946061340 294
177 iso_pu_bacteria 2953998280 2953998815 294
178 iso_pu_bacteria 2974302888 2974305579 294
179 iso_pu_bacteria 8054107350 8054109582 294
180 iso_pu_bacteria 2808606372 2808903149 295
181 3300006051 Ga0075364_10018490 Ga0075364_100184903 296
182 3300006051 Ga0075364_10062495 Ga0075364_100624952 296
183 3300006177 Ga0075362_10058974 Ga0075362_100589742 296
184 3300044658 Ga0466972_0020905 Ga0466972_0020905_555_1445 296
185 3300050491 nmdc:mga00v17_13129_c1 nmdc:mga00v17_13129_c1_2162_3052 296
186 3300050491 nmdc:mga00v17_52052_c1 nmdc:mga00v17_52052_c1_1557_2447 296
187 3300050494 nmdc:mga06z11_257766_c1 nmdc:mga06z11_257766_c1_48_938 296
188 iso_pu_bacteria 2932426870 2932429725 296
189 iso_pu_bacteria 2933418574 2933419232 296
190 iso_pu_bacteria 2939647034 2939650601 296
191 iso_pu_bacteria 2939674588 2939675966 296
192 iso_pu_bacteria 8004021418 8004023126 296
193 iso_pu_bacteria 8004025490 8004027556 296
194 3300001979 JGI24740J21852_10001647 JGI24740J21852_100016476 297
195 3300003322 rootL2_10254473 rootL2_102544732 297
196 3300005328 Ga0070676_10003557 Ga0070676_100035575 297
197 3300005331 Ga0070670_100029688 Ga0070670_1000296884 297
198 3300005333 Ga0070677_10004518 Ga0070677_100045182 297
199 3300005335 Ga0070666_10010854 Ga0070666_100108544 297
200 3300005347 Ga0070668_100020216 Ga0070668_1000202166 297
201 3300005354 Ga0070675_100016214 Ga0070675_1000162142 297
202 3300005354 Ga0070675_100208590 Ga0070675_1002085903 297
203 3300005355 Ga0070671_100048009 Ga0070671_1000480092 297
204 3300005364 Ga0070673_100006222 Ga0070673_1000062225 297
205 3300005367 Ga0070667_100020891 Ga0070667_1000208912 297
206 3300005456 Ga0070678_100004892 Ga0070678_1000048924 297
207 3300005471 Ga0070698_100093926 Ga0070698_1000939261 297
208 3300005543 Ga0070672_100059821 Ga0070672_1000598212 297
209 3300005577 Ga0068857_100373145 Ga0068857_1003731452 297
210 3300005719 Ga0068861_100053111 Ga0068861_1000531111 297
211 3300005840 Ga0068870_10177729 Ga0068870_101777291 297
212 3300006058 Ga0075432_10000394 Ga0075432_100003944 297
213 3300009011 Ga0105251_10011240 Ga0105251_100112404 297
214 3300009036 Ga0105244_10014738 Ga0105244_100147383 297
215 3300009036 Ga0105244_10018145 Ga0105244_100181453 297
216 3300009036 Ga0105244_10026484 Ga0105244_100264843 297
217 3300009148 Ga0105243_10070009 Ga0105243_100700093 297
218 3300009177 Ga0105248_10081628 Ga0105248_100816283 297
219 3300009545 Ga0105237_10026303 Ga0105237_100263035 297
220 3300011119 Ga0105246_10004658 Ga0105246_100046583 297
221 3300011119 Ga0105246_10051465 Ga0105246_100514652 297
222 3300013100 Ga0157373_10141046 Ga0157373_101410462 297
223 3300013102 Ga0157371_10170926 Ga0157371_101709262 297
224 3300013104 Ga0157370_10014675 Ga0157370_100146756 297
225 3300013104 Ga0157370_10627147 Ga0157370_106271471 297
226 3300013105 Ga0157369_10077411 Ga0157369_100774113 297
227 3300013105 Ga0157369_10141381 Ga0157369_101413812 297
228 3300013105 Ga0157369_10293179 Ga0157369_102931792 297
229 3300013297 Ga0157378_10058923 Ga0157378_100589232 297
230 3300013306 Ga0163162_10025189 Ga0163162_100251895 297
231 3300013306 Ga0163162_10052863 Ga0163162_100528635 297
232 3300013306 Ga0163162_10106350 Ga0163162_101063503 297
233 3300013306 Ga0163162_10304422 Ga0163162_103044222 297
234 3300013308 Ga0157375_10040275 Ga0157375_100402754 297
235 3300013308 Ga0157375_10050348 Ga0157375_100503481 297
236 3300013308 Ga0157375_10773201 Ga0157375_107732012 297
237 3300014326 Ga0157380_10046636 Ga0157380_100466362 297
238 3300025315 Ga0207697_10001798 Ga0207697_100017984 297
239 3300025315 Ga0207697_10005059 Ga0207697_100050593 297
240 3300025728 Ga0207655_1008593 Ga0207655_10085934 297
241 3300025728 Ga0207655_1036256 Ga0207655_10362562 297
242 3300025735 Ga0207713_1027839 Ga0207713_10278393 297
243 3300025893 Ga0207682_10000910 Ga0207682_100009105 297
244 3300025903 Ga0207680_10042095 Ga0207680_100420951 297
245 3300025907 Ga0207645_10000494 Ga0207645_1000049421 297
246 3300025908 Ga0207643_10151589 Ga0207643_101515891 297
247 3300025914 Ga0207671_10074888 Ga0207671_100748884 297
248 3300025923 Ga0207681_10041892 Ga0207681_100418922 297
249 3300025925 Ga0207650_10030318 Ga0207650_100303183 297
250 3300025926 Ga0207659_10092402 Ga0207659_100924022 297
251 3300025926 Ga0207659_10253670 Ga0207659_102536701 297
252 3300025931 Ga0207644_10023850 Ga0207644_100238502 297
253 3300025935 Ga0207709_10044203 Ga0207709_100442032 297
254 3300025937 Ga0207669_10067641 Ga0207669_100676412 297
255 3300025940 Ga0207691_10002730 Ga0207691_100027309 297
256 3300025942 Ga0207689_10304871 Ga0207689_103048712 297
257 3300025972 Ga0207668_10031243 Ga0207668_100312432 297
258 3300026067 Ga0207678_10145951 Ga0207678_101459512 297
259 3300026116 Ga0207674_10587726 Ga0207674_105877261 297
260 3300026121 Ga0207683_10004822 Ga0207683_100048224 297
261 3300027907 Ga0207428_10042413 Ga0207428_100424131 297
262 3300028379 Ga0268266_10270201 Ga0268266_102702012 297
263 3300028380 Ga0268265_10689509 Ga0268265_106895091 297
264 3300031548 Ga0307408_100059498 Ga0307408_1000594983 297
265 3300031548 Ga0307408_100112148 Ga0307408_1001121481 297
266 3300031548 Ga0307408_100190830 Ga0307408_1001908302 297
267 3300031731 Ga0307405_10073763 Ga0307405_100737632 297
268 3300031731 Ga0307405_10184403 Ga0307405_101844031 297
269 3300031731 Ga0307405_10443169 Ga0307405_104431691 297
270 3300031824 Ga0307413_10163121 Ga0307413_101631211 297
271 3300031824 Ga0307413_10236212 Ga0307413_102362121 297
272 3300031824 Ga0307413_10354022 Ga0307413_103540221 297
273 3300031852 Ga0307410_10026067 Ga0307410_100260671 297
274 3300031852 Ga0307410_10036536 Ga0307410_100365362 297
275 3300031852 Ga0307410_10138848 Ga0307410_101388482 297
276 3300031852 Ga0307410_10217947 Ga0307410_102179471 297
277 3300031852 Ga0307410_10402966 Ga0307410_104029661 297
278 3300031901 Ga0307406_10000107 Ga0307406_1000010726 297
279 3300031911 Ga0307412_10021976 Ga0307412_100219764 297
280 3300031911 Ga0307412_10039424 Ga0307412_100394242 297
281 3300031911 Ga0307412_10066236 Ga0307412_100662361 297
282 3300031911 Ga0307412_10145065 Ga0307412_101450651 297
283 3300031911 Ga0307412_10520755 Ga0307412_105207551 297
284 3300031995 Ga0307409_100000479 Ga0307409_10000047914 297
285 3300031995 Ga0307409_100054443 Ga0307409_1000544432 297
286 3300031995 Ga0307409_100062558 Ga0307409_1000625583 297
287 3300031995 Ga0307409_100343030 Ga0307409_1003430301 297
288 3300031995 Ga0307409_100370872 Ga0307409_1003708721 297
289 3300032002 Ga0307416_100439213 Ga0307416_1004392132 297
290 3300032002 Ga0307416_100445960 Ga0307416_1004459601 297
291 3300032002 Ga0307416_100594506 Ga0307416_1005945061 297
292 3300032004 Ga0307414_10021524 Ga0307414_100215244 297
293 3300032004 Ga0307414_10047799 Ga0307414_100477991 297
294 3300032004 Ga0307414_10095453 Ga0307414_100954532 297
295 3300032004 Ga0307414_10153003 Ga0307414_101530031 297
296 3300032004 Ga0307414_10430060 Ga0307414_104300601 297
297 3300032126 Ga0307415_100057084 Ga0307415_1000570842 297
298 3300032126 Ga0307415_100110535 Ga0307415_1001105352 297
299 3300037312 Ga0395899_0118168 Ga0395899_0118168_953_1861 297
300 3300037418 Ga0395900_0002060 Ga0395900_0002060_1900_2793 297
301 3300037418 Ga0395900_0099365 Ga0395900_0099365_33_941 297
302 3300037418 Ga0395900_0134540 Ga0395900_0134540_1030_1938 297
303 3300037466 Ga0395898_0115438 Ga0395898_0115438_320_1228 297
304 3300037466 Ga0395898_0187321 Ga0395898_0187321_826_1734 297
305 3300037466 Ga0395898_0266998 Ga0395898_0266998_284_1198 297
306 3300037471 Ga0395905_0280061 Ga0395905_0280061_404_1312 297
307 3300038443 Ga0395901_0022620 Ga0395901_0022620_5331_6239 297
308 3300038443 Ga0395901_0051631 Ga0395901_0051631_3299_4192 297
309 3300038443 Ga0395901_0125302 Ga0395901_0125302_1116_2030 297
310 3300038443 Ga0395901_0202160 Ga0395901_0202160_460_1368 297
311 3300041404 Ga0439436_0007585 Ga0439436_0007585_2000_2908 297
312 3300041404 Ga0439436_0067210 Ga0439436_0067210_31_939 297
313 3300041405 Ga0439438_002722 Ga0439438_002722_5888_6802 297
314 3300041406 Ga0439439_0014351 Ga0439439_0014351_400_1308 297
315 3300041406 Ga0439439_0021133 Ga0439439_0021133_630_1544 297
316 3300041411 Ga0439466_0016861 Ga0439466_0016861_810_1724 297
317 3300041997 Ga0439431_0021287 Ga0439431_0021287_18_932 297
318 3300041999 Ga0439433_0003681 Ga0439433_0003681_1013_1921 297
319 3300041999 Ga0439433_0018871 Ga0439433_0018871_565_1479 297
320 3300042002 Ga0439442_000093 Ga0439442_000093_522_1430 297
321 3300042002 Ga0439442_001278 Ga0439442_001278_2977_4014 297
322 3300042006 Ga0439432_013818 Ga0439432_013818_945_1859 297
323 3300042007 Ga0439449_0002435 Ga0439449_0002435_5349_6257 297
324 3300042010 Ga0439452_012758 Ga0439452_012758_897_1811 297
325 3300042014 Ga0439457_007987 Ga0439457_007987_487_1395 297
326 3300042014 Ga0439457_031820 Ga0439457_031820_141_1049 297
327 3300042014 Ga0439457_045240 Ga0439457_045240_12_926 297
328 3300042015 Ga0439462_0009040 Ga0439462_0009040_1508_2422 297
329 3300042015 Ga0439462_0012330 Ga0439462_0012330_664_1572 297
330 3300042015 Ga0439462_0047861 Ga0439462_0047861_205_1113 297
331 3300042121 Ga0450919_003393 Ga0450919_003393_285_1199 297
332 3300042122 Ga0450920_017108 Ga0450920_017108_49_957 297
333 3300042146 Ga0450907_000188 Ga0450907_000188_20149_21057 297
334 3300042184 Ga0450908_015733 Ga0450908_015733_139_1053 297
335 3300042435 Ga0439434_0009266 Ga0439434_0009266_653_1561 297
336 3300042435 Ga0439434_0021609 Ga0439434_0021609_780_1694 297
337 3300042531 Ga0450918_001159 Ga0450918_001159_170_1078 297
338 3300042531 Ga0450918_005240 Ga0450918_005240_471_1385 297
339 3300044765 Ga0466970_0000003 Ga0466970_0000003_125958_126851 297
340 3300044842 Ga0466957_0011019 Ga0466957_0011019_328_1221 297
341 3300046472 Ga0495580_0019880 Ga0495580_0019880_4043_4951 297
342 3300046473 Ga0495582_0060628 Ga0495582_0060628_1077_1985 297
343 3300046475 Ga0495639_0002194 Ga0495639_0002194_3356_4264 297
344 3300046518 Ga0495631_0021245 Ga0495631_0021245_329_1237 297
345 3300046522 Ga0495643_0050788 Ga0495643_0050788_443_1351 297
346 3300046535 Ga0495586_0033643 Ga0495586_0033643_1773_2681 297
347 3300046535 Ga0495586_0205302 Ga0495586_0205302_142_1056 297
348 3300046558 Ga0495633_0064993 Ga0495633_0064993_419_1327 297
349 3300046615 Ga0495656_0002415 Ga0495656_0002415_1795_2703 297
350 3300046615 Ga0495656_0111467 Ga0495656_0111467_337_1245 297
351 3300046664 Ga0495659_0045057 Ga0495659_0045057_448_1356 297
352 3300046674 Ga0495588_0001124 Ga0495588_0001124_5950_6858 297
353 3300046674 Ga0495588_0002936 Ga0495588_0002936_4362_5270 297
354 3300046674 Ga0495588_0003646 Ga0495588_0003646_3028_3936 297
355 3300046674 Ga0495588_0033086 Ga0495588_0033086_867_1775 297
356 3300046674 Ga0495588_0118107 Ga0495588_0118107_314_1207 297
357 3300046691 Ga0495670_0000694 Ga0495670_0000694_6263_7171 297
358 3300046809 Ga0495600_0041007 Ga0495600_0041007_1813_2721 297
359 3300047315 Ga0495581_0064306 Ga0495581_0064306_284_1192 297
360 3300047315 Ga0495581_0069756 Ga0495581_0069756_43_951 297
361 3300047444 Ga0495675_0003278 Ga0495675_0003278_385_1293 297
362 3300047673 Ga0495593_0069116 Ga0495593_0069116_62_970 297
363 3300048903 Ga0496100_0034609 Ga0496100_0034609_38_946 297
364 3300048904 Ga0496101_0047349 Ga0496101_0047349_2068_3009 297
365 3300048905 Ga0496102_0003570 Ga0496102_0003570_1941_2849 297
366 3300048905 Ga0496102_0078039 Ga0496102_0078039_392_1300 297
367 3300048905 Ga0496102_0118563 Ga0496102_0118563_75_1016 297
368 3300048905 Ga0496102_0187478 Ga0496102_0187478_393_1301 297
369 3300048905 Ga0496102_0224250 Ga0496102_0224250_837_1736 297
370 3300048905 Ga0496102_0369884 Ga0496102_0369884_146_1054 297
371 3300048905 Ga0496102_0584586 Ga0496102_0584586_121_1029 297
372 3300048906 Ga0496103_0059856 Ga0496103_0059856_1178_2119 297
373 3300048906 Ga0496103_0065381 Ga0496103_0065381_565_1473 297
374 3300048907 Ga0496104_0108157 Ga0496104_0108157_69_1010 297
375 3300048907 Ga0496104_0110389 Ga0496104_0110389_1446_2354 297
376 3300048907 Ga0496104_0285055 Ga0496104_0285055_582_1490 297
377 3300048908 Ga0496105_0082318 Ga0496105_0082318_1161_2069 297
378 3300048909 Ga0496106_0009516 Ga0496106_0009516_39_947 297
379 3300048909 Ga0496106_0015947 Ga0496106_0015947_3011_3919 297
380 3300048909 Ga0496106_0073158 Ga0496106_0073158_590_1498 297
381 3300048910 Ga0496107_0019804 Ga0496107_0019804_1875_2783 297
382 3300048910 Ga0496107_0046268 Ga0496107_0046268_891_1799 297
383 3300048910 Ga0496107_0054809 Ga0496107_0054809_1378_2286 297
384 3300048910 Ga0496107_0115515 Ga0496107_0115515_147_1088 297
385 3300048910 Ga0496107_0446805 Ga0496107_0446805_12_920 297
386 3300048911 Ga0496108_0027575 Ga0496108_0027575_3502_4410 297
387 3300048911 Ga0496108_0030459 Ga0496108_0030459_1621_2529 297
388 3300048911 Ga0496108_0082738 Ga0496108_0082738_1249_2157 297
389 3300048911 Ga0496108_0431155 Ga0496108_0431155_215_1123 297
390 3300048912 Ga0496109_0042178 Ga0496109_0042178_2185_3093 297
391 3300048912 Ga0496109_0084898 Ga0496109_0084898_1679_2587 297
392 3300048912 Ga0496109_0111434 Ga0496109_0111434_1026_1934 297
393 3300048912 Ga0496109_0137787 Ga0496109_0137787_365_1306 297
394 3300048912 Ga0496109_0192545 Ga0496109_0192545_376_1284 297
395 3300048913 Ga0496110_0010495 Ga0496110_0010495_3262_4170 297
396 3300048913 Ga0496110_0069682 Ga0496110_0069682_1071_2012 297
397 3300048913 Ga0496110_0086397 Ga0496110_0086397_1854_2762 297
398 3300048913 Ga0496110_0117717 Ga0496110_0117717_1446_2354 297
399 3300048913 Ga0496110_0183382 Ga0496110_0183382_336_1244 297
400 3300048914 Ga0496111_0002522 Ga0496111_0002522_4313_5221 297
401 3300048914 Ga0496111_0024864 Ga0496111_0024864_1144_2052 297
402 3300048914 Ga0496111_0052877 Ga0496111_0052877_1337_2245 297
403 3300048914 Ga0496111_0062762 Ga0496111_0062762_1762_2670 297
404 3300048915 Ga0496112_0025455 Ga0496112_0025455_3979_4893 297
405 3300048915 Ga0496112_0091625 Ga0496112_0091625_1614_2522 297
406 3300048916 Ga0496113_0169719 Ga0496113_0169719_154_1095 297
407 3300048918 Ga0496115_0032937 Ga0496115_0032937_2551_3492 297
408 3300048918 Ga0496115_0263384 Ga0496115_0263384_410_1318 297
409 3300048920 Ga0496117_0138231 Ga0496117_0138231_406_1299 297
410 3300048927 Ga0496124_0207207 Ga0496124_0207207_275_1183 297
411 3300048928 Ga0496125_0034154 Ga0496125_0034154_1660_2568 297
412 3300048929 Ga0496126_0029257 Ga0496126_0029257_1689_2582 297
413 3300049569 Ga0501032_0024780 Ga0501032_0024780_1621_2535 297
414 3300049571 Ga0501034_0000066 Ga0501034_0000066_170970_171884 297
415 3300049571 Ga0501034_0000590 Ga0501034_0000590_41483_42376 297
416 3300049571 Ga0501034_0043281 Ga0501034_0043281_755_1648 297
417 3300049573 Ga0501037_0107762 Ga0501037_0107762_1046_1954 297
418 3300049574 Ga0501038_0037165 Ga0501038_0037165_508_1401 297
419 3300049574 Ga0501038_0075186 Ga0501038_0075186_64_972 297
420 3300049574 Ga0501038_0177443 Ga0501038_0177443_785_1693 297
421 3300049575 Ga0501039_0488747 Ga0501039_0488747_23_922 297
422 3300049579 Ga0501043_0141161 Ga0501043_0141161_726_1634 297
423 3300049823 Ga0501044_0066726 Ga0501044_0066726_1819_2727 297
424 3300050494 nmdc:mga06z11_129954_c1 nmdc:mga06z11_129954_c1_495_1403 297
425 3300050496 nmdc:mga07m45_39124_c1 nmdc:mga07m45_39124_c1_814_1707 297
426 3300059507 Ga0587086_006510 Ga0587086_006510_168_1139 297
427 3300059639 Ga0587062_013033 Ga0587062_013033_13_921 297
428 3300059643 Ga0587072_023088 Ga0587072_023088_45_953 297
429 iso_pu_bacteria 2643221549 2643768396 297
430 iso_pu_bacteria 2721755702 2723641126 297
431 iso_pu_bacteria 2852646457 2852649176 297
432 iso_pu_bacteria 2919395869 2919398246 297
433 iso_pu_bacteria 2945968032 2945969612 297

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01014

Uricase

Uricase

155

291

0.97

PF01014

Uricase

Uricase

23

147

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vax-assembly1.cif.gz_A crystal structure of uricase from arthrobacter globiformis 0.9586 2 291
6oe8-assembly1.cif.gz_D the crystal structure of hyper-thermostable aguricase mutant k12c/e286c 0.9551 2 297
1vax-assembly1.cif.gz_A crystal structure of uricase from arthrobacter globiformis 0.9522 2 291
6oe8-assembly1.cif.gz_D the crystal structure of hyper-thermostable aguricase mutant k12c/e286c 0.9519 2 297
7f2v-assembly1.cif.gz_A urate oxidase from thermobispora bispora in apo form 0.9475 4 297
ID Description Score Start End Superfamily
1vaxB00 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.9602 2 291 3.10.270.10
1vaxB00 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.9537 2 291 3.10.270.10
af_Q54LT2_1_287_3.10.270.10 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.9414 4 283 3.10.270.10
af_P16163_26_350_3.10.270.10 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.9392 3 285 3.10.270.10
5ll1A00 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.9299 3 280 3.10.270.10
ID Description Score Start End GO Terms
AF-A0A7X8WZ66-F1-model_v4 factor independent urate hydroxylase (EC 1.7.3.3) (Urate oxidase) 0.9861 2 109 GO:0006144
GO:0016491
GO:0019628
AF-A0A536EGS0-F1-model_v4 factor independent urate hydroxylase (EC 1.7.3.3) (Urate oxidase) 0.9742 2 94 GO:0004846
GO:0006144
GO:0019628
AF-A0A2S8ZUZ7-F1-model_v4 Uricase (EC 1.7.3.3) (Urate oxidase) 0.9721 1 297 GO:0004846
GO:0006144
GO:0019628
AF-A0A519UJK5-F1-model_v4 factor independent urate hydroxylase (EC 1.7.3.3) (Urate oxidase) 0.9688 2 99 GO:0004846
GO:0006144
GO:0019628
AF-J2JIJ7-F1-model_v4 factor independent urate hydroxylase (EC 1.7.3.3) 0.9648 1 284 GO:0004846
GO:0005886
GO:0006144
GO:0019628
GO:0042907

Feature Viewer

pLDDT pTM Quality
92.2 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map