F442825
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 433 | 267 | 393 | 298 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10026303|Ga0105237_100263035 |
| Length | 313 |
| Sequence | MTDILTNPETTQTPTGGIILGPNQYGKAEVRVVKVTRDTDRHEIEDLNVTSQLRGDLARAHLAGDNAHVVPTDTQKNTVYAFARDGIGSPEAFLLRLADHFTSEFEWITGGRWLAESYAWERIVLEGDEHDHAFVRKGQEVRTAGVVADGDERHVVSGLKDLKVLKSTGSGFEGYPKDRYTTLKETNDRILATSVATQWRYLPGTVDADFNAIYDDVKRILLEEFSRRYSAALQTTLFDMGKAVLEAHPEIGEIRFSMPNSHHFVVDLSPFGLDNPNEVFYAADRPYGLIEATVTREGLAPAPEVWASVVPFV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 2 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 3 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 4 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 5 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 6 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 7 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 8 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 9 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 10 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 11 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 12 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 13 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 14 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 15 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 16 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 17 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 18 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 19 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 20 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 21 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 22 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 23 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 24 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 25 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 26 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 27 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 28 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 29 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 30 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 31 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 32 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 33 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 34 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 35 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 36 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 37 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 38 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 39 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 40 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 42 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 141 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 142 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 143 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 144 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 145 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 146 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 147 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 148 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 149 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 150 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 151 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 153 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 154 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 155 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 156 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 157 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 159 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 160 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 162 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 163 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 164 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 168 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 169 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 170 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 171 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 173 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 174 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 175 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 176 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 177 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 178 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 179 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 180 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 181 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 182 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 183 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 184 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 185 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 186 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 187 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 188 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 189 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 190 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 191 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 192 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 193 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 194 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 195 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 196 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 197 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 198 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 199 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 200 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 201 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 227 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 228 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 229 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 230 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 231 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 234 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 238 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 239 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 240 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 241 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 242 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 243 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 256 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 257 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 258 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 260 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 261 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 262 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 266 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 267 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.07 |
| Metatranscriptomes | 0.69 |
| Isolates | 9.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.54 |
| Nodule | 0 |
| Rhizoplane | 16.4 |
| Rhizosphere | 74.36 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.7 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10001647 | 3300001979 | Bacteria | 10257 |
| 2 | rootL2_10254473 | 3300003322 | Bacteria | 1614 |
| 3 | Ga0070676_10003557 | 3300005328 | Bacteria | 8150 |
| 4 | Ga0070690_100167681 | 3300005330 | Bacteria | 1509 |
| 5 | Ga0070670_100029688 | 3300005331 | Bacteria | 4708 |
| 6 | Ga0070677_10004518 | 3300005333 | Bacteria | 4543 |
| 7 | Ga0070666_10010854 | 3300005335 | Bacteria | 5706 |
| 8 | Ga0070682_100023950 | 3300005337 | Bacteria | 3629 |
| 9 | Ga0070682_100038952 | 3300005337 | Bacteria | 2918 |
| 10 | Ga0070682_100177579 | 3300005337 | Bacteria | 1485 |
| 11 | Ga0070691_10145508 | 3300005341 | Bacteria | 1211 |
| 12 | Ga0070668_100020216 | 3300005347 | Bacteria | 5022 |
| 13 | Ga0070668_100084164 | 3300005347 | Bacteria | 2498 |
| 14 | Ga0070669_100000071 | 3300005353 | Bacteria | 99275 |
| 15 | Ga0070669_100155461 | 3300005353 | Bacteria | 1773 |
| 16 | Ga0070675_100016214 | 3300005354 | Bacteria | 5911 |
| 17 | Ga0070675_100208590 | 3300005354 | Bacteria | 1698 |
| 18 | Ga0070671_100048009 | 3300005355 | Bacteria | 3549 |
| 19 | Ga0070673_100006222 | 3300005364 | Bacteria | 7745 |
| 20 | Ga0070667_100020891 | 3300005367 | Bacteria | 5438 |
| 21 | Ga0070700_100039216 | 3300005441 | Bacteria | 2892 |
| 22 | Ga0070694_100005861 | 3300005444 | Bacteria | 7453 |
| 23 | Ga0070663_100197035 | 3300005455 | Bacteria | 1570 |
| 24 | Ga0070663_100233851 | 3300005455 | Bacteria | 1448 |
| 25 | Ga0070678_100004892 | 3300005456 | Bacteria | 7660 |
| 26 | Ga0070662_100057122 | 3300005457 | Bacteria | 2835 |
| 27 | Ga0070681_10223764 | 3300005458 | Bacteria | 1797 |
| 28 | Ga0068867_100389048 | 3300005459 | Bacteria | 1173 |
| 29 | Ga0070706_100000392 | 3300005467 | Bacteria | 52726 |
| 30 | Ga0070698_100093926 | 3300005471 | Bacteria | 2979 |
| 31 | Ga0070684_100241091 | 3300005535 | Bacteria | 1652 |
| 32 | Ga0068853_100081264 | 3300005539 | Bacteria | 2837 |
| 33 | Ga0070672_100059821 | 3300005543 | Bacteria | 2998 |
| 34 | Ga0070696_100002316 | 3300005546 | Bacteria | 12565 |
| 35 | Ga0070696_100015109 | 3300005546 | Bacteria | 5183 |
| 36 | Ga0070665_100259091 | 3300005548 | Bacteria | 1740 |
| 37 | Ga0070704_100286224 | 3300005549 | Unclassified | 1368 |
| 38 | Ga0068857_100373145 | 3300005577 | Bacteria | 1324 |
| 39 | Ga0068854_100111246 | 3300005578 | Bacteria | 2066 |
| 40 | Ga0068852_100193604 | 3300005616 | Bacteria | 1920 |
| 41 | Ga0068866_10035622 | 3300005718 | Bacteria | 2432 |
| 42 | Ga0068861_100053111 | 3300005719 | Bacteria | 3082 |
| 43 | Ga0068861_100103564 | 3300005719 | Bacteria | 2269 |
| 44 | Ga0068870_10177729 | 3300005840 | Bacteria | 1275 |
| 45 | Ga0075364_10018490 | 3300006051 | Bacteria | 4363 |
| 46 | Ga0075364_10062495 | 3300006051 | Bacteria | 2443 |
| 47 | Ga0075432_10000394 | 3300006058 | Bacteria | 12698 |
| 48 | Ga0075362_10058974 | 3300006177 | Bacteria | 1732 |
| 49 | Ga0097621_100259507 | 3300006237 | Bacteria | 1524 |
| 50 | Ga0075428_100667745 | 3300006844 | Bacteria | 1108 |
| 51 | Ga0068865_100012938 | 3300006881 | Bacteria | 5262 |
| 52 | Ga0105251_10011240 | 3300009011 | Bacteria | 5124 |
| 53 | Ga0105244_10014738 | 3300009036 | Bacteria | 4512 |
| 54 | Ga0105244_10018145 | 3300009036 | Bacteria | 3957 |
| 55 | Ga0105244_10026484 | 3300009036 | Bacteria | 3137 |
| 56 | Ga0105245_10008834 | 3300009098 | Bacteria | 8791 |
| 57 | Ga0105245_10024388 | 3300009098 | Bacteria | 5310 |
| 58 | Ga0105245_10589534 | 3300009098 | Bacteria | 1137 |
| 59 | Ga0105247_10075218 | 3300009101 | Bacteria | 2119 |
| 60 | Ga0105243_10010102 | 3300009148 | Bacteria | 7180 |
| 61 | Ga0105243_10014944 | 3300009148 | Bacteria | 5876 |
| 62 | Ga0105243_10070009 | 3300009148 | Bacteria | 2831 |
| 63 | Ga0105242_10015926 | 3300009176 | Bacteria | 5842 |
| 64 | Ga0105248_10081628 | 3300009177 | Bacteria | 3634 |
| 65 | Ga0105237_10026303 | 3300009545 | Bacteria | 5947 |
| 66 | Ga0105238_10070630 | 3300009551 | Bacteria | 3491 |
| 67 | Ga0105249_10005243 | 3300009553 | Bacteria | 11189 |
| 68 | Ga0105239_10146848 | 3300010375 | Bacteria | 2631 |
| 69 | Ga0105246_10004658 | 3300011119 | Bacteria | 8348 |
| 70 | Ga0105246_10051465 | 3300011119 | Bacteria | 2828 |
| 71 | Ga0157373_10141046 | 3300013100 | Bacteria | 1695 |
| 72 | Ga0157371_10170926 | 3300013102 | Bacteria | 1553 |
| 73 | Ga0157370_10014675 | 3300013104 | Bacteria | 8003 |
| 74 | Ga0157370_10627147 | 3300013104 | Bacteria | 983 |
| 75 | Ga0157369_10077411 | 3300013105 | Bacteria | 3564 |
| 76 | Ga0157369_10141381 | 3300013105 | Bacteria | 2547 |
| 77 | Ga0157369_10293179 | 3300013105 | Bacteria | 1693 |
| 78 | Ga0157374_10217633 | 3300013296 | Bacteria | 1874 |
| 79 | Ga0157378_10058923 | 3300013297 | Bacteria | 3425 |
| 80 | Ga0157378_10069002 | 3300013297 | Unclassified | 3171 |
| 81 | Ga0163162_10025189 | 3300013306 | Bacteria | 5880 |
| 82 | Ga0163162_10030727 | 3300013306 | Bacteria | 5323 |
| 83 | Ga0163162_10052863 | 3300013306 | Bacteria | 4081 |
| 84 | Ga0163162_10106350 | 3300013306 | Bacteria | 2901 |
| 85 | Ga0163162_10222090 | 3300013306 | Bacteria | 2019 |
| 86 | Ga0163162_10304422 | 3300013306 | Bacteria | 1726 |
| 87 | Ga0157372_10113401 | 3300013307 | Bacteria | 3107 |
| 88 | Ga0157375_10040275 | 3300013308 | Bacteria | 4503 |
| 89 | Ga0157375_10050348 | 3300013308 | Bacteria | 4086 |
| 90 | Ga0157375_10325153 | 3300013308 | Bacteria | 1703 |
| 91 | Ga0157375_10773201 | 3300013308 | Bacteria | 1110 |
| 92 | Ga0157380_10040417 | 3300014326 | Bacteria | 3632 |
| 93 | Ga0157380_10046636 | 3300014326 | Bacteria | 3405 |
| 94 | Ga0157380_10438535 | 3300014326 | Bacteria | 1251 |
| 95 | Ga0157377_10281689 | 3300014745 | Bacteria | 1090 |
| 96 | Ga0163161_10029728 | 3300017792 | Bacteria | 3885 |
| 97 | Ga0207697_10001798 | 3300025315 | Bacteria | 11484 |
| 98 | Ga0207697_10005059 | 3300025315 | Bacteria | 6176 |
| 99 | Ga0207655_1008593 | 3300025728 | Bacteria | 6460 |
| 100 | Ga0207655_1036256 | 3300025728 | Bacteria | 2189 |
| 101 | Ga0207713_1027839 | 3300025735 | Bacteria | 2559 |
| 102 | Ga0207682_10000910 | 3300025893 | Bacteria | 13708 |
| 103 | Ga0207642_10024367 | 3300025899 | Bacteria | 2432 |
| 104 | Ga0207688_10055679 | 3300025901 | Bacteria | 2220 |
| 105 | Ga0207680_10042095 | 3300025903 | Bacteria | 2669 |
| 106 | Ga0207645_10000494 | 3300025907 | Bacteria | 32513 |
| 107 | Ga0207643_10151589 | 3300025908 | Bacteria | 1390 |
| 108 | Ga0207684_10000852 | 3300025910 | Bacteria | 35040 |
| 109 | Ga0207707_10030688 | 3300025912 | Unclassified | 4702 |
| 110 | Ga0207671_10074888 | 3300025914 | Bacteria | 2531 |
| 111 | Ga0207681_10041892 | 3300025923 | Bacteria | 3055 |
| 112 | Ga0207681_10221234 | 3300025923 | Bacteria | 1465 |
| 113 | Ga0207650_10030318 | 3300025925 | Bacteria | 3895 |
| 114 | Ga0207659_10092402 | 3300025926 | Bacteria | 2262 |
| 115 | Ga0207659_10253670 | 3300025926 | Bacteria | 1428 |
| 116 | Ga0207687_10046183 | 3300025927 | Bacteria | 3014 |
| 117 | Ga0207644_10023850 | 3300025931 | Bacteria | 4195 |
| 118 | Ga0207706_10029209 | 3300025933 | Bacteria | 4923 |
| 119 | Ga0207686_10062194 | 3300025934 | Bacteria | 2370 |
| 120 | Ga0207709_10044203 | 3300025935 | Bacteria | 2690 |
| 121 | Ga0207709_10081372 | 3300025935 | Bacteria | 2088 |
| 122 | Ga0207709_10296394 | 3300025935 | Bacteria | 1201 |
| 123 | Ga0207669_10067641 | 3300025937 | Bacteria | 2227 |
| 124 | Ga0207704_10054687 | 3300025938 | Bacteria | 2435 |
| 125 | Ga0207691_10002730 | 3300025940 | Bacteria | 17235 |
| 126 | Ga0207711_10521420 | 3300025941 | Bacteria | 1108 |
| 127 | Ga0207689_10304871 | 3300025942 | Bacteria | 1320 |
| 128 | Ga0207689_10408200 | 3300025942 | Bacteria | 1133 |
| 129 | Ga0207668_10031243 | 3300025972 | Bacteria | 3506 |
| 130 | Ga0207668_10148382 | 3300025972 | Bacteria | 1812 |
| 131 | Ga0207678_10145951 | 3300026067 | Bacteria | 2019 |
| 132 | Ga0207708_10032060 | 3300026075 | Bacteria | 3990 |
| 133 | Ga0207648_10250098 | 3300026089 | Bacteria | 1580 |
| 134 | Ga0207648_10303227 | 3300026089 | Bacteria | 1433 |
| 135 | Ga0207674_10587726 | 3300026116 | Bacteria | 1076 |
| 136 | Ga0207675_100072254 | 3300026118 | Bacteria | 3227 |
| 137 | Ga0207675_100136235 | 3300026118 | Bacteria | 2330 |
| 138 | Ga0207675_100693749 | 3300026118 | Bacteria | 1026 |
| 139 | Ga0207683_10004822 | 3300026121 | Bacteria | 11614 |
| 140 | Ga0207683_10006854 | 3300026121 | Bacteria | 9757 |
| 141 | Ga0207698_10031251 | 3300026142 | Bacteria | 3841 |
| 142 | Ga0207428_10042413 | 3300027907 | Bacteria | 3680 |
| 143 | Ga0268266_10270201 | 3300028379 | Bacteria | 1578 |
| 144 | Ga0268265_10057347 | 3300028380 | Bacteria | 2968 |
| 145 | Ga0268265_10689509 | 3300028380 | Bacteria | 986 |
| 146 | Ga0307517_10108317 | 3300028786 | Bacteria | 2134 |
| 147 | Ga0307515_10006764 | 3300028794 | Bacteria | 22817 |
| 148 | Ga0307512_10004049 | 3300030522 | Bacteria | 16323 |
| 149 | Ga0307408_100059498 | 3300031548 | Bacteria | 2780 |
| 150 | Ga0307408_100112148 | 3300031548 | Bacteria | 2096 |
| 151 | Ga0307408_100190830 | 3300031548 | Bacteria | 1650 |
| 152 | Ga0307508_10017800 | 3300031616 | Bacteria | 6463 |
| 153 | Ga0307516_10069042 | 3300031730 | Bacteria | 3400 |
| 154 | Ga0307405_10073763 | 3300031731 | Bacteria | 2204 |
| 155 | Ga0307405_10184403 | 3300031731 | Bacteria | 1501 |
| 156 | Ga0307405_10443169 | 3300031731 | Bacteria | 1028 |
| 157 | Ga0307413_10163121 | 3300031824 | Bacteria | 1568 |
| 158 | Ga0307413_10236212 | 3300031824 | Bacteria | 1346 |
| 159 | Ga0307413_10354022 | 3300031824 | Bacteria | 1134 |
| 160 | Ga0307410_10004710 | 3300031852 | Bacteria | 7099 |
| 161 | Ga0307410_10026067 | 3300031852 | Bacteria | 3674 |
| 162 | Ga0307410_10036536 | 3300031852 | Bacteria | 3199 |
| 163 | Ga0307410_10138848 | 3300031852 | Bacteria | 1795 |
| 164 | Ga0307410_10217947 | 3300031852 | Bacteria | 1466 |
| 165 | Ga0307410_10402966 | 3300031852 | Bacteria | 1106 |
| 166 | Ga0307406_10000081 | 3300031901 | Bacteria | 53682 |
| 167 | Ga0307406_10000107 | 3300031901 | Bacteria | 48696 |
| 168 | Ga0307407_10002638 | 3300031903 | Bacteria | 7089 |
| 169 | Ga0307412_10021976 | 3300031911 | Bacteria | 3904 |
| 170 | Ga0307412_10039424 | 3300031911 | Bacteria | 3049 |
| 171 | Ga0307412_10066236 | 3300031911 | Bacteria | 2447 |
| 172 | Ga0307412_10145065 | 3300031911 | Bacteria | 1743 |
| 173 | Ga0307412_10520755 | 3300031911 | Bacteria | 993 |
| 174 | Ga0307409_100000155 | 3300031995 | Bacteria | 26095 |
| 175 | Ga0307409_100000479 | 3300031995 | Bacteria | 17090 |
| 176 | Ga0307409_100054443 | 3300031995 | Bacteria | 3081 |
| 177 | Ga0307409_100062558 | 3300031995 | Bacteria | 2914 |
| 178 | Ga0307409_100343030 | 3300031995 | Bacteria | 1406 |
| 179 | Ga0307409_100370872 | 3300031995 | Bacteria | 1357 |
| 180 | Ga0307416_100000458 | 3300032002 | Bacteria | 20945 |
| 181 | Ga0307416_100439213 | 3300032002 | Bacteria | 1354 |
| 182 | Ga0307416_100445960 | 3300032002 | Bacteria | 1345 |
| 183 | Ga0307416_100594506 | 3300032002 | Bacteria | 1185 |
| 184 | Ga0307414_10021524 | 3300032004 | Bacteria | 4049 |
| 185 | Ga0307414_10047799 | 3300032004 | Bacteria | 2948 |
| 186 | Ga0307414_10095453 | 3300032004 | Bacteria | 2222 |
| 187 | Ga0307414_10153003 | 3300032004 | Bacteria | 1822 |
| 188 | Ga0307414_10430060 | 3300032004 | Bacteria | 1153 |
| 189 | Ga0307415_100002229 | 3300032126 | Bacteria | 9601 |
| 190 | Ga0307415_100057084 | 3300032126 | Bacteria | 2681 |
| 191 | Ga0307415_100110535 | 3300032126 | Bacteria | 2038 |
| 192 | Ga0373946_0123368 | 3300035171 | Bacteria | 1185 |
| 193 | Ga0373931_0161781 | 3300035691 | Unclassified | 1313 |
| 194 | Ga0373927_0012924 | 3300035695 | Bacteria | 5552 |
| 195 | Ga0373947_0001685 | 3300035725 | Bacteria | 13534 |
| 196 | Ga0373947_0045068 | 3300035725 | Bacteria | 2639 |
| 197 | Ga0373925_0000511 | 3300037068 | Bacteria | 39064 |
| 198 | Ga0395899_0118168 | 3300037312 | Bacteria | 1901 |
| 199 | Ga0395900_0002060 | 3300037418 | Bacteria | 22555 |
| 200 | Ga0395900_0099365 | 3300037418 | Bacteria | 2989 |
| 201 | Ga0395900_0134540 | 3300037418 | Bacteria | 2532 |
| 202 | Ga0395898_0115438 | 3300037466 | Bacteria | 2572 |
| 203 | Ga0395898_0187321 | 3300037466 | Bacteria | 1977 |
| 204 | Ga0395898_0266998 | 3300037466 | Bacteria | 1632 |
| 205 | Ga0395898_0330913 | 3300037466 | Bacteria | 1452 |
| 206 | Ga0395905_0176919 | 3300037471 | Bacteria | 2003 |
| 207 | Ga0395905_0280061 | 3300037471 | Bacteria | 1554 |
| 208 | Ga0395901_0022620 | 3300038443 | Bacteria | 6444 |
| 209 | Ga0395901_0051631 | 3300038443 | Bacteria | 4276 |
| 210 | Ga0395901_0125302 | 3300038443 | Bacteria | 2699 |
| 211 | Ga0395901_0127233 | 3300038443 | Bacteria | 2677 |
| 212 | Ga0395901_0202160 | 3300038443 | Bacteria | 2082 |
| 213 | Ga0436365_0341334 | 3300039437 | Bacteria | 1929 |
| 214 | Ga0439436_0007585 | 3300041404 | Bacteria | 3339 |
| 215 | Ga0439436_0067210 | 3300041404 | Bacteria | 1000 |
| 216 | Ga0439438_002722 | 3300041405 | Bacteria | 7420 |
| 217 | Ga0439439_0014351 | 3300041406 | Bacteria | 1928 |
| 218 | Ga0439439_0021133 | 3300041406 | Bacteria | 1620 |
| 219 | Ga0439466_0016861 | 3300041411 | Bacteria | 2635 |
| 220 | Ga0451791_0442543 | 3300041451 | Bacteria | 7256 |
| 221 | Ga0451793_0036142 | 3300041452 | Bacteria | 1149 |
| 222 | Ga0451797_0675675 | 3300041453 | Bacteria | 1882 |
| 223 | Ga0451795_0507404 | 3300041456 | Bacteria | 1851 |
| 224 | Ga0451843_0626121 | 3300041509 | Bacteria | 1410 |
| 225 | Ga0451853_2847913 | 3300041512 | Bacteria | 2213 |
| 226 | Ga0439431_0021287 | 3300041997 | Bacteria | 1556 |
| 227 | Ga0439433_0003681 | 3300041999 | Bacteria | 3293 |
| 228 | Ga0439433_0018871 | 3300041999 | Bacteria | 1536 |
| 229 | Ga0439442_000093 | 3300042002 | Bacteria | 21417 |
| 230 | Ga0439442_001278 | 3300042002 | Bacteria | 5008 |
| 231 | Ga0439448_0034323 | 3300042005 | Bacteria | 1621 |
| 232 | Ga0439432_013818 | 3300042006 | Bacteria | 2739 |
| 233 | Ga0439449_0002435 | 3300042007 | Bacteria | 7273 |
| 234 | Ga0439452_012758 | 3300042010 | Bacteria | 2378 |
| 235 | Ga0439455_0006307 | 3300042012 | Bacteria | 2457 |
| 236 | Ga0439457_007987 | 3300042014 | Bacteria | 2512 |
| 237 | Ga0439457_031820 | 3300042014 | Bacteria | 1170 |
| 238 | Ga0439457_045240 | 3300042014 | Bacteria | 983 |
| 239 | Ga0439462_0009040 | 3300042015 | Bacteria | 2519 |
| 240 | Ga0439462_0012330 | 3300042015 | Bacteria | 2182 |
| 241 | Ga0439462_0047861 | 3300042015 | Bacteria | 1146 |
| 242 | Ga0439463_001558 | 3300042016 | Bacteria | 6051 |
| 243 | Ga0450919_003393 | 3300042121 | Bacteria | 2003 |
| 244 | Ga0450920_017108 | 3300042122 | Bacteria | 1384 |
| 245 | Ga0450907_000188 | 3300042146 | Bacteria | 22583 |
| 246 | Ga0450908_015733 | 3300042184 | Bacteria | 1353 |
| 247 | Ga0439434_0009266 | 3300042435 | Bacteria | 2892 |
| 248 | Ga0439434_0021609 | 3300042435 | Bacteria | 1933 |
| 249 | Ga0439464_0006260 | 3300042439 | Bacteria | 3097 |
| 250 | Ga0450918_001159 | 3300042531 | Bacteria | 5404 |
| 251 | Ga0450918_005240 | 3300042531 | Bacteria | 2337 |
| 252 | Ga0451577_0006662 | 3300042876 | Bacteria | 11468 |
| 253 | Ga0439440_0002129 | 3300042993 | Bacteria | 3699 |
| 254 | Ga0466972_0020905 | 3300044658 | Bacteria | 3268 |
| 255 | Ga0453684_0091134 | 3300044712 | Bacteria | 3764 |
| 256 | Ga0466970_0000003 | 3300044765 | Bacteria | 130770 |
| 257 | Ga0466957_0011019 | 3300044842 | Bacteria | 5201 |
| 258 | Ga0495638_0134293 | 3300046460 | Bacteria | 1451 |
| 259 | Ga0495653_0106202 | 3300046463 | Bacteria | 2026 |
| 260 | Ga0495580_0019880 | 3300046472 | Bacteria | 4980 |
| 261 | Ga0495582_0060628 | 3300046473 | Bacteria | 2088 |
| 262 | Ga0495639_0002194 | 3300046475 | Bacteria | 8592 |
| 263 | Ga0495662_0346910 | 3300046476 | Unclassified | 730 |
| 264 | Ga0495664_0244268 | 3300046477 | Bacteria | 1086 |
| 265 | Ga0495630_0176137 | 3300046517 | Bacteria | 1630 |
| 266 | Ga0495631_0021245 | 3300046518 | Bacteria | 3024 |
| 267 | Ga0495643_0050788 | 3300046522 | Bacteria | 2233 |
| 268 | Ga0495665_0152020 | 3300046531 | Bacteria | 1208 |
| 269 | Ga0495586_0033643 | 3300046535 | Bacteria | 2751 |
| 270 | Ga0495586_0205302 | 3300046535 | Bacteria | 1118 |
| 271 | Ga0495645_0211908 | 3300046543 | Bacteria | 1308 |
| 272 | Ga0495633_0064993 | 3300046558 | Bacteria | 1705 |
| 273 | Ga0495656_0002415 | 3300046615 | Bacteria | 6194 |
| 274 | Ga0495656_0111467 | 3300046615 | Bacteria | 1280 |
| 275 | Ga0495659_0045057 | 3300046664 | Bacteria | 1588 |
| 276 | Ga0495588_0001124 | 3300046674 | Bacteria | 11531 |
| 277 | Ga0495588_0002936 | 3300046674 | Bacteria | 7361 |
| 278 | Ga0495588_0003646 | 3300046674 | Bacteria | 6737 |
| 279 | Ga0495588_0033086 | 3300046674 | Bacteria | 2609 |
| 280 | Ga0495588_0118107 | 3300046674 | Bacteria | 1398 |
| 281 | Ga0495670_0000694 | 3300046691 | Bacteria | 16032 |
| 282 | Ga0495600_0041007 | 3300046809 | Bacteria | 3017 |
| 283 | Ga0495581_0064306 | 3300047315 | Bacteria | 2119 |
| 284 | Ga0495581_0069756 | 3300047315 | Bacteria | 2033 |
| 285 | Ga0495675_0003278 | 3300047444 | Bacteria | 9733 |
| 286 | Ga0495593_0069116 | 3300047673 | Bacteria | 1837 |
| 287 | Ga0496100_0034609 | 3300048903 | Bacteria | 3171 |
| 288 | Ga0496100_0085212 | 3300048903 | Bacteria | 2144 |
| 289 | Ga0496101_0047349 | 3300048904 | Bacteria | 3086 |
| 290 | Ga0496102_0003570 | 3300048905 | Bacteria | 13180 |
| 291 | Ga0496102_0078039 | 3300048905 | Bacteria | 3048 |
| 292 | Ga0496102_0118563 | 3300048905 | Bacteria | 2470 |
| 293 | Ga0496102_0180465 | 3300048905 | Bacteria | 1989 |
| 294 | Ga0496102_0187478 | 3300048905 | Bacteria | 1949 |
| 295 | Ga0496102_0224250 | 3300048905 | Bacteria | 1772 |
| 296 | Ga0496102_0249069 | 3300048905 | Bacteria | 1675 |
| 297 | Ga0496102_0369884 | 3300048905 | Bacteria | 1349 |
| 298 | Ga0496102_0584586 | 3300048905 | Bacteria | 1039 |
| 299 | Ga0496103_0059856 | 3300048906 | Bacteria | 2366 |
| 300 | Ga0496103_0065381 | 3300048906 | Bacteria | 2268 |
| 301 | Ga0496103_0178907 | 3300048906 | Bacteria | 1363 |
| 302 | Ga0496104_0108157 | 3300048907 | Bacteria | 2664 |
| 303 | Ga0496104_0110389 | 3300048907 | Bacteria | 2636 |
| 304 | Ga0496104_0285055 | 3300048907 | Bacteria | 1564 |
| 305 | Ga0496105_0033971 | 3300048908 | Bacteria | 4193 |
| 306 | Ga0496105_0082318 | 3300048908 | Bacteria | 2658 |
| 307 | Ga0496105_0136383 | 3300048908 | Bacteria | 2022 |
| 308 | Ga0496105_0293518 | 3300048908 | Bacteria | 1308 |
| 309 | Ga0496106_0009516 | 3300048909 | Bacteria | 7178 |
| 310 | Ga0496106_0015947 | 3300048909 | Bacteria | 5556 |
| 311 | Ga0496106_0038087 | 3300048909 | Bacteria | 3598 |
| 312 | Ga0496106_0073158 | 3300048909 | Bacteria | 2621 |
| 313 | Ga0496107_0019804 | 3300048910 | Bacteria | 4750 |
| 314 | Ga0496107_0034472 | 3300048910 | Bacteria | 3626 |
| 315 | Ga0496107_0046268 | 3300048910 | Bacteria | 3131 |
| 316 | Ga0496107_0054809 | 3300048910 | Bacteria | 2878 |
| 317 | Ga0496107_0115515 | 3300048910 | Bacteria | 1975 |
| 318 | Ga0496107_0446805 | 3300048910 | Bacteria | 960 |
| 319 | Ga0496108_0023326 | 3300048911 | Bacteria | 5090 |
| 320 | Ga0496108_0027575 | 3300048911 | Bacteria | 4692 |
| 321 | Ga0496108_0030459 | 3300048911 | Bacteria | 4472 |
| 322 | Ga0496108_0037974 | 3300048911 | Bacteria | 4012 |
| 323 | Ga0496108_0082738 | 3300048911 | Bacteria | 2722 |
| 324 | Ga0496108_0431155 | 3300048911 | Bacteria | 1151 |
| 325 | Ga0496109_0003558 | 3300048912 | Bacteria | 13009 |
| 326 | Ga0496109_0042178 | 3300048912 | Bacteria | 4132 |
| 327 | Ga0496109_0065370 | 3300048912 | Bacteria | 3329 |
| 328 | Ga0496109_0084898 | 3300048912 | Bacteria | 2921 |
| 329 | Ga0496109_0111434 | 3300048912 | Bacteria | 2544 |
| 330 | Ga0496109_0137787 | 3300048912 | Bacteria | 2281 |
| 331 | Ga0496109_0192545 | 3300048912 | Bacteria | 1916 |
| 332 | Ga0496110_0010495 | 3300048913 | Bacteria | 7537 |
| 333 | Ga0496110_0035883 | 3300048913 | Bacteria | 4305 |
| 334 | Ga0496110_0069682 | 3300048913 | Bacteria | 3115 |
| 335 | Ga0496110_0086397 | 3300048913 | Bacteria | 2800 |
| 336 | Ga0496110_0117717 | 3300048913 | Bacteria | 2392 |
| 337 | Ga0496110_0123472 | 3300048913 | Bacteria | 2335 |
| 338 | Ga0496110_0183382 | 3300048913 | Bacteria | 1900 |
| 339 | Ga0496111_0002522 | 3300048914 | Bacteria | 11045 |
| 340 | Ga0496111_0024864 | 3300048914 | Bacteria | 4223 |
| 341 | Ga0496111_0052877 | 3300048914 | Bacteria | 2933 |
| 342 | Ga0496111_0062762 | 3300048914 | Bacteria | 2694 |
| 343 | Ga0496111_0103496 | 3300048914 | Bacteria | 2094 |
| 344 | Ga0496112_0025455 | 3300048915 | Bacteria | 5682 |
| 345 | Ga0496112_0059321 | 3300048915 | Bacteria | 3770 |
| 346 | Ga0496112_0091625 | 3300048915 | Bacteria | 3009 |
| 347 | Ga0496113_0004700 | 3300048916 | Bacteria | 8424 |
| 348 | Ga0496113_0169719 | 3300048916 | Bacteria | 1727 |
| 349 | Ga0496114_0181554 | 3300048917 | Bacteria | 1838 |
| 350 | Ga0496114_0237737 | 3300048917 | Bacteria | 1601 |
| 351 | Ga0496114_0306647 | 3300048917 | Bacteria | 1402 |
| 352 | Ga0496115_0032937 | 3300048918 | Bacteria | 4091 |
| 353 | Ga0496115_0263384 | 3300048918 | Bacteria | 1417 |
| 354 | Ga0496117_0138231 | 3300048920 | Bacteria | 1464 |
| 355 | Ga0496124_0207207 | 3300048927 | Bacteria | 1486 |
| 356 | Ga0496125_0034154 | 3300048928 | Bacteria | 4487 |
| 357 | Ga0496126_0029257 | 3300048929 | Bacteria | 5235 |
| 358 | Ga0501032_0024780 | 3300049569 | Bacteria | 4139 |
| 359 | Ga0501032_0026857 | 3300049569 | Bacteria | 3957 |
| 360 | Ga0501034_0000066 | 3300049571 | Bacteria | 184727 |
| 361 | Ga0501034_0000590 | 3300049571 | Bacteria | 57381 |
| 362 | Ga0501034_0007026 | 3300049571 | Bacteria | 12010 |
| 363 | Ga0501034_0043281 | 3300049571 | Bacteria | 4558 |
| 364 | Ga0501036_0346952 | 3300049572 | Bacteria | 1240 |
| 365 | Ga0501037_0001842 | 3300049573 | Bacteria | 15387 |
| 366 | Ga0501037_0107762 | 3300049573 | Bacteria | 2007 |
| 367 | Ga0501038_0014197 | 3300049574 | Bacteria | 7256 |
| 368 | Ga0501038_0037165 | 3300049574 | Bacteria | 4271 |
| 369 | Ga0501038_0075186 | 3300049574 | Bacteria | 2856 |
| 370 | Ga0501038_0177443 | 3300049574 | Bacteria | 1721 |
| 371 | Ga0501039_0003194 | 3300049575 | Bacteria | 12254 |
| 372 | Ga0501039_0488747 | 3300049575 | Bacteria | 967 |
| 373 | Ga0501043_0005308 | 3300049579 | Bacteria | 10412 |
| 374 | Ga0501043_0141161 | 3300049579 | Bacteria | 1886 |
| 375 | Ga0501068_0050240 | 3300049584 | Bacteria | 2521 |
| 376 | Ga0501070_0006551 | 3300049586 | Bacteria | 9906 |
| 377 | Ga0501070_0518733 | 3300049586 | Bacteria | 956 |
| 378 | Ga0501072_0423401 | 3300049588 | Bacteria | 1055 |
| 379 | Ga0501073_0010365 | 3300049589 | Bacteria | 6837 |
| 380 | Ga0501044_0066726 | 3300049823 | Bacteria | 3668 |
| 381 | nmdc:mga00v17_13129_c1 | 3300050491 | Bacteria | 4589 |
| 382 | nmdc:mga00v17_52052_c1 | 3300050491 | Bacteria | 2491 |
| 383 | nmdc:mga06z11_129954_c1 | 3300050494 | Bacteria | 1413 |
| 384 | nmdc:mga06z11_257766_c1 | 3300050494 | Bacteria | 1028 |
| 385 | nmdc:mga07m45_39124_c1 | 3300050496 | Bacteria | 2649 |
| 386 | Ga0495619_0079059 | 3300053085 | Bacteria | 2212 |
| 387 | Ga0495619_0135529 | 3300053085 | Bacteria | 1694 |
| 388 | Ga0500651_0059860 | 3300053093 | Bacteria | 2381 |
| 389 | Ga0500650_0028775 | 3300053098 | Bacteria | 2512 |
| 390 | Ga0500569_017403 | 3300053109 | Bacteria | 1837 |
| 391 | Ga0587086_006510 | 3300059507 | Bacteria | 1307 |
| 392 | Ga0587062_013033 | 3300059639 | Bacteria | 1075 |
| 393 | Ga0587072_023088 | 3300059643 | Bacteria | 1115 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046476 | Ga0495662_0346910 | Ga0495662_0346910_24_704 | 225 |
| 2 | 3300049586 | Ga0501070_0518733 | Ga0501070_0518733_130_846 | 238 |
| 3 | 3300005444 | Ga0070694_100005861 | Ga0070694_1000058612 | 274 |
| 4 | 3300005546 | Ga0070696_100002316 | Ga0070696_1000023163 | 274 |
| 5 | 3300005546 | Ga0070696_100015109 | Ga0070696_1000151093 | 274 |
| 6 | 3300005549 | Ga0070704_100286224 | Ga0070704_1002862242 | 274 |
| 7 | 3300025912 | Ga0207707_10030688 | Ga0207707_100306883 | 274 |
| 8 | 3300025935 | Ga0207709_10296394 | Ga0207709_102963942 | 274 |
| 9 | 3300035171 | Ga0373946_0123368 | Ga0373946_0123368_279_1106 | 274 |
| 10 | 3300035695 | Ga0373927_0012924 | Ga0373927_0012924_590_1417 | 274 |
| 11 | 3300035725 | Ga0373947_0001685 | Ga0373947_0001685_6709_7536 | 274 |
| 12 | 3300037068 | Ga0373925_0000511 | Ga0373925_0000511_11540_12367 | 274 |
| 13 | 3300046517 | Ga0495630_0176137 | Ga0495630_0176137_80_907 | 274 |
| 14 | 3300046531 | Ga0495665_0152020 | Ga0495665_0152020_308_1135 | 274 |
| 15 | 3300048905 | Ga0496102_0249069 | Ga0496102_0249069_635_1465 | 274 |
| 16 | 3300048906 | Ga0496103_0178907 | Ga0496103_0178907_83_913 | 274 |
| 17 | 3300005330 | Ga0070690_100167681 | Ga0070690_1001676812 | 275 |
| 18 | 3300005458 | Ga0070681_10223764 | Ga0070681_102237642 | 275 |
| 19 | 3300035691 | Ga0373931_0161781 | Ga0373931_0161781_374_1204 | 275 |
| 20 | 3300025942 | Ga0207689_10408200 | Ga0207689_104082002 | 276 |
| 21 | 3300039437 | Ga0436365_0341334 | Ga0436365_0341334_769_1608 | 277 |
| 22 | 3300049584 | Ga0501068_0050240 | Ga0501068_0050240_1480_2322 | 278 |
| 23 | 3300005353 | Ga0070669_100000071 | Ga0070669_10000007155 | 279 |
| 24 | 3300042876 | Ga0451577_0006662 | Ga0451577_0006662_6904_7746 | 279 |
| 25 | 3300044712 | Ga0453684_0091134 | Ga0453684_0091134_2615_3457 | 279 |
| 26 | 3300009098 | Ga0105245_10589534 | Ga0105245_105895341 | 280 |
| 27 | 3300013297 | Ga0157378_10069002 | Ga0157378_100690024 | 280 |
| 28 | 3300035725 | Ga0373947_0045068 | Ga0373947_0045068_1278_2126 | 280 |
| 29 | 3300048908 | Ga0496105_0033971 | Ga0496105_0033971_848_1696 | 280 |
| 30 | 3300048911 | Ga0496108_0023326 | Ga0496108_0023326_3437_4285 | 280 |
| 31 | 3300048912 | Ga0496109_0065370 | Ga0496109_0065370_1025_1873 | 280 |
| 32 | 3300048913 | Ga0496110_0123472 | Ga0496110_0123472_1189_2037 | 280 |
| 33 | 3300048914 | Ga0496111_0103496 | Ga0496111_0103496_307_1155 | 280 |
| 34 | 3300048915 | Ga0496112_0059321 | Ga0496112_0059321_1216_2064 | 280 |
| 35 | 3300048916 | Ga0496113_0004700 | Ga0496113_0004700_6846_7694 | 280 |
| 36 | 3300049572 | Ga0501036_0346952 | Ga0501036_0346952_123_971 | 280 |
| 37 | 3300049588 | Ga0501072_0423401 | Ga0501072_0423401_136_984 | 280 |
| 38 | 3300053085 | Ga0495619_0079059 | Ga0495619_0079059_715_1563 | 280 |
| 39 | 3300006844 | Ga0075428_100667745 | Ga0075428_1006677452 | 281 |
| 40 | 3300005467 | Ga0070706_100000392 | Ga0070706_10000039211 | 282 |
| 41 | 3300025910 | Ga0207684_10000852 | Ga0207684_100008528 | 282 |
| 42 | 3300026118 | Ga0207675_100072254 | Ga0207675_1000722542 | 283 |
| 43 | 3300028786 | Ga0307517_10108317 | Ga0307517_101083172 | 285 |
| 44 | 3300028794 | Ga0307515_10006764 | Ga0307515_100067644 | 285 |
| 45 | 3300030522 | Ga0307512_10004049 | Ga0307512_1000404912 | 285 |
| 46 | 3300031616 | Ga0307508_10017800 | Ga0307508_100178002 | 285 |
| 47 | 3300031730 | Ga0307516_10069042 | Ga0307516_100690424 | 285 |
| 48 | 3300037466 | Ga0395898_0330913 | Ga0395898_0330913_41_901 | 285 |
| 49 | 3300037471 | Ga0395905_0176919 | Ga0395905_0176919_423_1283 | 285 |
| 50 | 3300038443 | Ga0395901_0127233 | Ga0395901_0127233_831_1691 | 285 |
| 51 | 3300046460 | Ga0495638_0134293 | Ga0495638_0134293_448_1308 | 285 |
| 52 | 3300053093 | Ga0500651_0059860 | Ga0500651_0059860_1344_2204 | 285 |
| 53 | 3300053098 | Ga0500650_0028775 | Ga0500650_0028775_46_906 | 285 |
| 54 | 3300053109 | Ga0500569_017403 | Ga0500569_017403_879_1739 | 285 |
| 55 | iso_pu_bacteria | 2738543034 | 2739363855 | 292 |
| 56 | 3300005337 | Ga0070682_100023950 | Ga0070682_1000239503 | 293 |
| 57 | 3300005337 | Ga0070682_100038952 | Ga0070682_1000389522 | 293 |
| 58 | 3300005337 | Ga0070682_100177579 | Ga0070682_1001775791 | 293 |
| 59 | 3300005341 | Ga0070691_10145508 | Ga0070691_101455082 | 293 |
| 60 | 3300005347 | Ga0070668_100084164 | Ga0070668_1000841642 | 293 |
| 61 | 3300005353 | Ga0070669_100155461 | Ga0070669_1001554612 | 293 |
| 62 | 3300005441 | Ga0070700_100039216 | Ga0070700_1000392162 | 293 |
| 63 | 3300005455 | Ga0070663_100197035 | Ga0070663_1001970351 | 293 |
| 64 | 3300005455 | Ga0070663_100233851 | Ga0070663_1002338511 | 293 |
| 65 | 3300005457 | Ga0070662_100057122 | Ga0070662_1000571221 | 293 |
| 66 | 3300005459 | Ga0068867_100389048 | Ga0068867_1003890482 | 293 |
| 67 | 3300005535 | Ga0070684_100241091 | Ga0070684_1002410912 | 293 |
| 68 | 3300005539 | Ga0068853_100081264 | Ga0068853_1000812643 | 293 |
| 69 | 3300005548 | Ga0070665_100259091 | Ga0070665_1002590912 | 293 |
| 70 | 3300005578 | Ga0068854_100111246 | Ga0068854_1001112462 | 293 |
| 71 | 3300005616 | Ga0068852_100193604 | Ga0068852_1001936042 | 293 |
| 72 | 3300005718 | Ga0068866_10035622 | Ga0068866_100356224 | 293 |
| 73 | 3300005719 | Ga0068861_100103564 | Ga0068861_1001035643 | 293 |
| 74 | 3300006237 | Ga0097621_100259507 | Ga0097621_1002595072 | 293 |
| 75 | 3300006881 | Ga0068865_100012938 | Ga0068865_1000129382 | 293 |
| 76 | 3300009098 | Ga0105245_10008834 | Ga0105245_100088347 | 293 |
| 77 | 3300009098 | Ga0105245_10024388 | Ga0105245_100243882 | 293 |
| 78 | 3300009101 | Ga0105247_10075218 | Ga0105247_100752182 | 293 |
| 79 | 3300009148 | Ga0105243_10010102 | Ga0105243_100101027 | 293 |
| 80 | 3300009148 | Ga0105243_10014944 | Ga0105243_100149442 | 293 |
| 81 | 3300009176 | Ga0105242_10015926 | Ga0105242_100159266 | 293 |
| 82 | 3300009551 | Ga0105238_10070630 | Ga0105238_100706301 | 293 |
| 83 | 3300009553 | Ga0105249_10005243 | Ga0105249_100052432 | 293 |
| 84 | 3300010375 | Ga0105239_10146848 | Ga0105239_101468483 | 293 |
| 85 | 3300013296 | Ga0157374_10217633 | Ga0157374_102176332 | 293 |
| 86 | 3300013306 | Ga0163162_10030727 | Ga0163162_100307276 | 293 |
| 87 | 3300013306 | Ga0163162_10222090 | Ga0163162_102220903 | 293 |
| 88 | 3300013307 | Ga0157372_10113401 | Ga0157372_101134012 | 293 |
| 89 | 3300013308 | Ga0157375_10325153 | Ga0157375_103251531 | 293 |
| 90 | 3300014326 | Ga0157380_10040417 | Ga0157380_100404175 | 293 |
| 91 | 3300014326 | Ga0157380_10438535 | Ga0157380_104385352 | 293 |
| 92 | 3300014745 | Ga0157377_10281689 | Ga0157377_102816891 | 293 |
| 93 | 3300017792 | Ga0163161_10029728 | Ga0163161_100297283 | 293 |
| 94 | 3300025899 | Ga0207642_10024367 | Ga0207642_100243674 | 293 |
| 95 | 3300025901 | Ga0207688_10055679 | Ga0207688_100556792 | 293 |
| 96 | 3300025923 | Ga0207681_10221234 | Ga0207681_102212342 | 293 |
| 97 | 3300025927 | Ga0207687_10046183 | Ga0207687_100461833 | 293 |
| 98 | 3300025933 | Ga0207706_10029209 | Ga0207706_100292093 | 293 |
| 99 | 3300025934 | Ga0207686_10062194 | Ga0207686_100621942 | 293 |
| 100 | 3300025935 | Ga0207709_10081372 | Ga0207709_100813723 | 293 |
| 101 | 3300025938 | Ga0207704_10054687 | Ga0207704_100546872 | 293 |
| 102 | 3300025941 | Ga0207711_10521420 | Ga0207711_105214201 | 293 |
| 103 | 3300025972 | Ga0207668_10148382 | Ga0207668_101483822 | 293 |
| 104 | 3300026075 | Ga0207708_10032060 | Ga0207708_100320604 | 293 |
| 105 | 3300026089 | Ga0207648_10250098 | Ga0207648_102500982 | 293 |
| 106 | 3300026089 | Ga0207648_10303227 | Ga0207648_103032273 | 293 |
| 107 | 3300026118 | Ga0207675_100136235 | Ga0207675_1001362352 | 293 |
| 108 | 3300026118 | Ga0207675_100693749 | Ga0207675_1006937491 | 293 |
| 109 | 3300026121 | Ga0207683_10006854 | Ga0207683_100068546 | 293 |
| 110 | 3300026142 | Ga0207698_10031251 | Ga0207698_100312514 | 293 |
| 111 | 3300028380 | Ga0268265_10057347 | Ga0268265_100573472 | 293 |
| 112 | 3300031852 | Ga0307410_10004710 | Ga0307410_100047107 | 293 |
| 113 | 3300031901 | Ga0307406_10000081 | Ga0307406_1000008134 | 293 |
| 114 | 3300031903 | Ga0307407_10002638 | Ga0307407_100026387 | 293 |
| 115 | 3300031995 | Ga0307409_100000155 | Ga0307409_10000015513 | 293 |
| 116 | 3300032002 | Ga0307416_100000458 | Ga0307416_10000045817 | 293 |
| 117 | 3300032126 | Ga0307415_100002229 | Ga0307415_1000022297 | 293 |
| 118 | 3300041451 | Ga0451791_0442543 | Ga0451791_0442543_6267_7154 | 293 |
| 119 | 3300041452 | Ga0451793_0036142 | Ga0451793_0036142_11_898 | 293 |
| 120 | 3300041453 | Ga0451797_0675675 | Ga0451797_0675675_763_1650 | 293 |
| 121 | 3300041456 | Ga0451795_0507404 | Ga0451795_0507404_323_1210 | 293 |
| 122 | 3300041509 | Ga0451843_0626121 | Ga0451843_0626121_16_903 | 293 |
| 123 | 3300041512 | Ga0451853_2847913 | Ga0451853_2847913_845_1732 | 293 |
| 124 | 3300042005 | Ga0439448_0034323 | Ga0439448_0034323_466_1398 | 293 |
| 125 | 3300042012 | Ga0439455_0006307 | Ga0439455_0006307_295_1176 | 293 |
| 126 | 3300042016 | Ga0439463_001558 | Ga0439463_001558_487_1419 | 293 |
| 127 | 3300042439 | Ga0439464_0006260 | Ga0439464_0006260_739_1671 | 293 |
| 128 | 3300042993 | Ga0439440_0002129 | Ga0439440_0002129_2598_3530 | 293 |
| 129 | 3300046463 | Ga0495653_0106202 | Ga0495653_0106202_293_1174 | 293 |
| 130 | 3300046477 | Ga0495664_0244268 | Ga0495664_0244268_97_978 | 293 |
| 131 | 3300046543 | Ga0495645_0211908 | Ga0495645_0211908_378_1259 | 293 |
| 132 | 3300048903 | Ga0496100_0085212 | Ga0496100_0085212_56_937 | 293 |
| 133 | 3300048905 | Ga0496102_0180465 | Ga0496102_0180465_348_1229 | 293 |
| 134 | 3300048908 | Ga0496105_0136383 | Ga0496105_0136383_204_1085 | 293 |
| 135 | 3300048908 | Ga0496105_0293518 | Ga0496105_0293518_376_1266 | 293 |
| 136 | 3300048909 | Ga0496106_0038087 | Ga0496106_0038087_1801_2682 | 293 |
| 137 | 3300048910 | Ga0496107_0034472 | Ga0496107_0034472_1466_2347 | 293 |
| 138 | 3300048911 | Ga0496108_0037974 | Ga0496108_0037974_2896_3786 | 293 |
| 139 | 3300048912 | Ga0496109_0003558 | Ga0496109_0003558_8937_9818 | 293 |
| 140 | 3300048913 | Ga0496110_0035883 | Ga0496110_0035883_1083_1964 | 293 |
| 141 | 3300048917 | Ga0496114_0181554 | Ga0496114_0181554_391_1278 | 293 |
| 142 | 3300048917 | Ga0496114_0237737 | Ga0496114_0237737_70_951 | 293 |
| 143 | 3300048917 | Ga0496114_0306647 | Ga0496114_0306647_420_1301 | 293 |
| 144 | 3300049569 | Ga0501032_0026857 | Ga0501032_0026857_86_967 | 293 |
| 145 | 3300049571 | Ga0501034_0007026 | Ga0501034_0007026_793_1674 | 293 |
| 146 | 3300049573 | Ga0501037_0001842 | Ga0501037_0001842_10898_11779 | 293 |
| 147 | 3300049574 | Ga0501038_0014197 | Ga0501038_0014197_2767_3648 | 293 |
| 148 | 3300049575 | Ga0501039_0003194 | Ga0501039_0003194_4754_5635 | 293 |
| 149 | 3300049579 | Ga0501043_0005308 | Ga0501043_0005308_6765_7646 | 293 |
| 150 | 3300049586 | Ga0501070_0006551 | Ga0501070_0006551_7994_8875 | 293 |
| 151 | 3300049589 | Ga0501073_0010365 | Ga0501073_0010365_1061_1942 | 293 |
| 152 | 3300053085 | Ga0495619_0135529 | Ga0495619_0135529_327_1208 | 293 |
| 153 | iso_pu_bacteria | 2946041624 | 2946041757 | 293 |
| 154 | iso_pu_bacteria | 2946080515 | 2946083569 | 293 |
| 155 | iso_pu_bacteria | 2690315906 | 2691515330 | 294 |
| 156 | iso_pu_bacteria | 2775506735 | 2775658168 | 294 |
| 157 | iso_pu_bacteria | 2808606357 | 2808828525 | 294 |
| 158 | iso_pu_bacteria | 2808606360 | 2808849770 | 294 |
| 159 | iso_pu_bacteria | 2808606366 | 2808877639 | 294 |
| 160 | iso_pu_bacteria | 2808606370 | 2808892737 | 294 |
| 161 | iso_pu_bacteria | 2811994871 | 2812319769 | 294 |
| 162 | iso_pu_bacteria | 2857740372 | 2857743675 | 294 |
| 163 | iso_pu_bacteria | 2904497146 | 2904500749 | 294 |
| 164 | iso_pu_bacteria | 2904776348 | 2904779605 | 294 |
| 165 | iso_pu_bacteria | 2910809715 | 2910812252 | 294 |
| 166 | iso_pu_bacteria | 2919034639 | 2919037466 | 294 |
| 167 | iso_pu_bacteria | 2919059106 | 2919061260 | 294 |
| 168 | iso_pu_bacteria | 2919391150 | 2919394234 | 294 |
| 169 | iso_pu_bacteria | 2919538618 | 2919542650 | 294 |
| 170 | iso_pu_bacteria | 2939598168 | 2939601501 | 294 |
| 171 | iso_pu_bacteria | 2945916053 | 2945917515 | 294 |
| 172 | iso_pu_bacteria | 2945920336 | 2945922193 | 294 |
| 173 | iso_pu_bacteria | 2945941187 | 2945941644 | 294 |
| 174 | iso_pu_bacteria | 2945956166 | 2945960650 | 294 |
| 175 | iso_pu_bacteria | 2946037020 | 2946037548 | 294 |
| 176 | iso_pu_bacteria | 2946059875 | 2946061340 | 294 |
| 177 | iso_pu_bacteria | 2953998280 | 2953998815 | 294 |
| 178 | iso_pu_bacteria | 2974302888 | 2974305579 | 294 |
| 179 | iso_pu_bacteria | 8054107350 | 8054109582 | 294 |
| 180 | iso_pu_bacteria | 2808606372 | 2808903149 | 295 |
| 181 | 3300006051 | Ga0075364_10018490 | Ga0075364_100184903 | 296 |
| 182 | 3300006051 | Ga0075364_10062495 | Ga0075364_100624952 | 296 |
| 183 | 3300006177 | Ga0075362_10058974 | Ga0075362_100589742 | 296 |
| 184 | 3300044658 | Ga0466972_0020905 | Ga0466972_0020905_555_1445 | 296 |
| 185 | 3300050491 | nmdc:mga00v17_13129_c1 | nmdc:mga00v17_13129_c1_2162_3052 | 296 |
| 186 | 3300050491 | nmdc:mga00v17_52052_c1 | nmdc:mga00v17_52052_c1_1557_2447 | 296 |
| 187 | 3300050494 | nmdc:mga06z11_257766_c1 | nmdc:mga06z11_257766_c1_48_938 | 296 |
| 188 | iso_pu_bacteria | 2932426870 | 2932429725 | 296 |
| 189 | iso_pu_bacteria | 2933418574 | 2933419232 | 296 |
| 190 | iso_pu_bacteria | 2939647034 | 2939650601 | 296 |
| 191 | iso_pu_bacteria | 2939674588 | 2939675966 | 296 |
| 192 | iso_pu_bacteria | 8004021418 | 8004023126 | 296 |
| 193 | iso_pu_bacteria | 8004025490 | 8004027556 | 296 |
| 194 | 3300001979 | JGI24740J21852_10001647 | JGI24740J21852_100016476 | 297 |
| 195 | 3300003322 | rootL2_10254473 | rootL2_102544732 | 297 |
| 196 | 3300005328 | Ga0070676_10003557 | Ga0070676_100035575 | 297 |
| 197 | 3300005331 | Ga0070670_100029688 | Ga0070670_1000296884 | 297 |
| 198 | 3300005333 | Ga0070677_10004518 | Ga0070677_100045182 | 297 |
| 199 | 3300005335 | Ga0070666_10010854 | Ga0070666_100108544 | 297 |
| 200 | 3300005347 | Ga0070668_100020216 | Ga0070668_1000202166 | 297 |
| 201 | 3300005354 | Ga0070675_100016214 | Ga0070675_1000162142 | 297 |
| 202 | 3300005354 | Ga0070675_100208590 | Ga0070675_1002085903 | 297 |
| 203 | 3300005355 | Ga0070671_100048009 | Ga0070671_1000480092 | 297 |
| 204 | 3300005364 | Ga0070673_100006222 | Ga0070673_1000062225 | 297 |
| 205 | 3300005367 | Ga0070667_100020891 | Ga0070667_1000208912 | 297 |
| 206 | 3300005456 | Ga0070678_100004892 | Ga0070678_1000048924 | 297 |
| 207 | 3300005471 | Ga0070698_100093926 | Ga0070698_1000939261 | 297 |
| 208 | 3300005543 | Ga0070672_100059821 | Ga0070672_1000598212 | 297 |
| 209 | 3300005577 | Ga0068857_100373145 | Ga0068857_1003731452 | 297 |
| 210 | 3300005719 | Ga0068861_100053111 | Ga0068861_1000531111 | 297 |
| 211 | 3300005840 | Ga0068870_10177729 | Ga0068870_101777291 | 297 |
| 212 | 3300006058 | Ga0075432_10000394 | Ga0075432_100003944 | 297 |
| 213 | 3300009011 | Ga0105251_10011240 | Ga0105251_100112404 | 297 |
| 214 | 3300009036 | Ga0105244_10014738 | Ga0105244_100147383 | 297 |
| 215 | 3300009036 | Ga0105244_10018145 | Ga0105244_100181453 | 297 |
| 216 | 3300009036 | Ga0105244_10026484 | Ga0105244_100264843 | 297 |
| 217 | 3300009148 | Ga0105243_10070009 | Ga0105243_100700093 | 297 |
| 218 | 3300009177 | Ga0105248_10081628 | Ga0105248_100816283 | 297 |
| 219 | 3300009545 | Ga0105237_10026303 | Ga0105237_100263035 | 297 |
| 220 | 3300011119 | Ga0105246_10004658 | Ga0105246_100046583 | 297 |
| 221 | 3300011119 | Ga0105246_10051465 | Ga0105246_100514652 | 297 |
| 222 | 3300013100 | Ga0157373_10141046 | Ga0157373_101410462 | 297 |
| 223 | 3300013102 | Ga0157371_10170926 | Ga0157371_101709262 | 297 |
| 224 | 3300013104 | Ga0157370_10014675 | Ga0157370_100146756 | 297 |
| 225 | 3300013104 | Ga0157370_10627147 | Ga0157370_106271471 | 297 |
| 226 | 3300013105 | Ga0157369_10077411 | Ga0157369_100774113 | 297 |
| 227 | 3300013105 | Ga0157369_10141381 | Ga0157369_101413812 | 297 |
| 228 | 3300013105 | Ga0157369_10293179 | Ga0157369_102931792 | 297 |
| 229 | 3300013297 | Ga0157378_10058923 | Ga0157378_100589232 | 297 |
| 230 | 3300013306 | Ga0163162_10025189 | Ga0163162_100251895 | 297 |
| 231 | 3300013306 | Ga0163162_10052863 | Ga0163162_100528635 | 297 |
| 232 | 3300013306 | Ga0163162_10106350 | Ga0163162_101063503 | 297 |
| 233 | 3300013306 | Ga0163162_10304422 | Ga0163162_103044222 | 297 |
| 234 | 3300013308 | Ga0157375_10040275 | Ga0157375_100402754 | 297 |
| 235 | 3300013308 | Ga0157375_10050348 | Ga0157375_100503481 | 297 |
| 236 | 3300013308 | Ga0157375_10773201 | Ga0157375_107732012 | 297 |
| 237 | 3300014326 | Ga0157380_10046636 | Ga0157380_100466362 | 297 |
| 238 | 3300025315 | Ga0207697_10001798 | Ga0207697_100017984 | 297 |
| 239 | 3300025315 | Ga0207697_10005059 | Ga0207697_100050593 | 297 |
| 240 | 3300025728 | Ga0207655_1008593 | Ga0207655_10085934 | 297 |
| 241 | 3300025728 | Ga0207655_1036256 | Ga0207655_10362562 | 297 |
| 242 | 3300025735 | Ga0207713_1027839 | Ga0207713_10278393 | 297 |
| 243 | 3300025893 | Ga0207682_10000910 | Ga0207682_100009105 | 297 |
| 244 | 3300025903 | Ga0207680_10042095 | Ga0207680_100420951 | 297 |
| 245 | 3300025907 | Ga0207645_10000494 | Ga0207645_1000049421 | 297 |
| 246 | 3300025908 | Ga0207643_10151589 | Ga0207643_101515891 | 297 |
| 247 | 3300025914 | Ga0207671_10074888 | Ga0207671_100748884 | 297 |
| 248 | 3300025923 | Ga0207681_10041892 | Ga0207681_100418922 | 297 |
| 249 | 3300025925 | Ga0207650_10030318 | Ga0207650_100303183 | 297 |
| 250 | 3300025926 | Ga0207659_10092402 | Ga0207659_100924022 | 297 |
| 251 | 3300025926 | Ga0207659_10253670 | Ga0207659_102536701 | 297 |
| 252 | 3300025931 | Ga0207644_10023850 | Ga0207644_100238502 | 297 |
| 253 | 3300025935 | Ga0207709_10044203 | Ga0207709_100442032 | 297 |
| 254 | 3300025937 | Ga0207669_10067641 | Ga0207669_100676412 | 297 |
| 255 | 3300025940 | Ga0207691_10002730 | Ga0207691_100027309 | 297 |
| 256 | 3300025942 | Ga0207689_10304871 | Ga0207689_103048712 | 297 |
| 257 | 3300025972 | Ga0207668_10031243 | Ga0207668_100312432 | 297 |
| 258 | 3300026067 | Ga0207678_10145951 | Ga0207678_101459512 | 297 |
| 259 | 3300026116 | Ga0207674_10587726 | Ga0207674_105877261 | 297 |
| 260 | 3300026121 | Ga0207683_10004822 | Ga0207683_100048224 | 297 |
| 261 | 3300027907 | Ga0207428_10042413 | Ga0207428_100424131 | 297 |
| 262 | 3300028379 | Ga0268266_10270201 | Ga0268266_102702012 | 297 |
| 263 | 3300028380 | Ga0268265_10689509 | Ga0268265_106895091 | 297 |
| 264 | 3300031548 | Ga0307408_100059498 | Ga0307408_1000594983 | 297 |
| 265 | 3300031548 | Ga0307408_100112148 | Ga0307408_1001121481 | 297 |
| 266 | 3300031548 | Ga0307408_100190830 | Ga0307408_1001908302 | 297 |
| 267 | 3300031731 | Ga0307405_10073763 | Ga0307405_100737632 | 297 |
| 268 | 3300031731 | Ga0307405_10184403 | Ga0307405_101844031 | 297 |
| 269 | 3300031731 | Ga0307405_10443169 | Ga0307405_104431691 | 297 |
| 270 | 3300031824 | Ga0307413_10163121 | Ga0307413_101631211 | 297 |
| 271 | 3300031824 | Ga0307413_10236212 | Ga0307413_102362121 | 297 |
| 272 | 3300031824 | Ga0307413_10354022 | Ga0307413_103540221 | 297 |
| 273 | 3300031852 | Ga0307410_10026067 | Ga0307410_100260671 | 297 |
| 274 | 3300031852 | Ga0307410_10036536 | Ga0307410_100365362 | 297 |
| 275 | 3300031852 | Ga0307410_10138848 | Ga0307410_101388482 | 297 |
| 276 | 3300031852 | Ga0307410_10217947 | Ga0307410_102179471 | 297 |
| 277 | 3300031852 | Ga0307410_10402966 | Ga0307410_104029661 | 297 |
| 278 | 3300031901 | Ga0307406_10000107 | Ga0307406_1000010726 | 297 |
| 279 | 3300031911 | Ga0307412_10021976 | Ga0307412_100219764 | 297 |
| 280 | 3300031911 | Ga0307412_10039424 | Ga0307412_100394242 | 297 |
| 281 | 3300031911 | Ga0307412_10066236 | Ga0307412_100662361 | 297 |
| 282 | 3300031911 | Ga0307412_10145065 | Ga0307412_101450651 | 297 |
| 283 | 3300031911 | Ga0307412_10520755 | Ga0307412_105207551 | 297 |
| 284 | 3300031995 | Ga0307409_100000479 | Ga0307409_10000047914 | 297 |
| 285 | 3300031995 | Ga0307409_100054443 | Ga0307409_1000544432 | 297 |
| 286 | 3300031995 | Ga0307409_100062558 | Ga0307409_1000625583 | 297 |
| 287 | 3300031995 | Ga0307409_100343030 | Ga0307409_1003430301 | 297 |
| 288 | 3300031995 | Ga0307409_100370872 | Ga0307409_1003708721 | 297 |
| 289 | 3300032002 | Ga0307416_100439213 | Ga0307416_1004392132 | 297 |
| 290 | 3300032002 | Ga0307416_100445960 | Ga0307416_1004459601 | 297 |
| 291 | 3300032002 | Ga0307416_100594506 | Ga0307416_1005945061 | 297 |
| 292 | 3300032004 | Ga0307414_10021524 | Ga0307414_100215244 | 297 |
| 293 | 3300032004 | Ga0307414_10047799 | Ga0307414_100477991 | 297 |
| 294 | 3300032004 | Ga0307414_10095453 | Ga0307414_100954532 | 297 |
| 295 | 3300032004 | Ga0307414_10153003 | Ga0307414_101530031 | 297 |
| 296 | 3300032004 | Ga0307414_10430060 | Ga0307414_104300601 | 297 |
| 297 | 3300032126 | Ga0307415_100057084 | Ga0307415_1000570842 | 297 |
| 298 | 3300032126 | Ga0307415_100110535 | Ga0307415_1001105352 | 297 |
| 299 | 3300037312 | Ga0395899_0118168 | Ga0395899_0118168_953_1861 | 297 |
| 300 | 3300037418 | Ga0395900_0002060 | Ga0395900_0002060_1900_2793 | 297 |
| 301 | 3300037418 | Ga0395900_0099365 | Ga0395900_0099365_33_941 | 297 |
| 302 | 3300037418 | Ga0395900_0134540 | Ga0395900_0134540_1030_1938 | 297 |
| 303 | 3300037466 | Ga0395898_0115438 | Ga0395898_0115438_320_1228 | 297 |
| 304 | 3300037466 | Ga0395898_0187321 | Ga0395898_0187321_826_1734 | 297 |
| 305 | 3300037466 | Ga0395898_0266998 | Ga0395898_0266998_284_1198 | 297 |
| 306 | 3300037471 | Ga0395905_0280061 | Ga0395905_0280061_404_1312 | 297 |
| 307 | 3300038443 | Ga0395901_0022620 | Ga0395901_0022620_5331_6239 | 297 |
| 308 | 3300038443 | Ga0395901_0051631 | Ga0395901_0051631_3299_4192 | 297 |
| 309 | 3300038443 | Ga0395901_0125302 | Ga0395901_0125302_1116_2030 | 297 |
| 310 | 3300038443 | Ga0395901_0202160 | Ga0395901_0202160_460_1368 | 297 |
| 311 | 3300041404 | Ga0439436_0007585 | Ga0439436_0007585_2000_2908 | 297 |
| 312 | 3300041404 | Ga0439436_0067210 | Ga0439436_0067210_31_939 | 297 |
| 313 | 3300041405 | Ga0439438_002722 | Ga0439438_002722_5888_6802 | 297 |
| 314 | 3300041406 | Ga0439439_0014351 | Ga0439439_0014351_400_1308 | 297 |
| 315 | 3300041406 | Ga0439439_0021133 | Ga0439439_0021133_630_1544 | 297 |
| 316 | 3300041411 | Ga0439466_0016861 | Ga0439466_0016861_810_1724 | 297 |
| 317 | 3300041997 | Ga0439431_0021287 | Ga0439431_0021287_18_932 | 297 |
| 318 | 3300041999 | Ga0439433_0003681 | Ga0439433_0003681_1013_1921 | 297 |
| 319 | 3300041999 | Ga0439433_0018871 | Ga0439433_0018871_565_1479 | 297 |
| 320 | 3300042002 | Ga0439442_000093 | Ga0439442_000093_522_1430 | 297 |
| 321 | 3300042002 | Ga0439442_001278 | Ga0439442_001278_2977_4014 | 297 |
| 322 | 3300042006 | Ga0439432_013818 | Ga0439432_013818_945_1859 | 297 |
| 323 | 3300042007 | Ga0439449_0002435 | Ga0439449_0002435_5349_6257 | 297 |
| 324 | 3300042010 | Ga0439452_012758 | Ga0439452_012758_897_1811 | 297 |
| 325 | 3300042014 | Ga0439457_007987 | Ga0439457_007987_487_1395 | 297 |
| 326 | 3300042014 | Ga0439457_031820 | Ga0439457_031820_141_1049 | 297 |
| 327 | 3300042014 | Ga0439457_045240 | Ga0439457_045240_12_926 | 297 |
| 328 | 3300042015 | Ga0439462_0009040 | Ga0439462_0009040_1508_2422 | 297 |
| 329 | 3300042015 | Ga0439462_0012330 | Ga0439462_0012330_664_1572 | 297 |
| 330 | 3300042015 | Ga0439462_0047861 | Ga0439462_0047861_205_1113 | 297 |
| 331 | 3300042121 | Ga0450919_003393 | Ga0450919_003393_285_1199 | 297 |
| 332 | 3300042122 | Ga0450920_017108 | Ga0450920_017108_49_957 | 297 |
| 333 | 3300042146 | Ga0450907_000188 | Ga0450907_000188_20149_21057 | 297 |
| 334 | 3300042184 | Ga0450908_015733 | Ga0450908_015733_139_1053 | 297 |
| 335 | 3300042435 | Ga0439434_0009266 | Ga0439434_0009266_653_1561 | 297 |
| 336 | 3300042435 | Ga0439434_0021609 | Ga0439434_0021609_780_1694 | 297 |
| 337 | 3300042531 | Ga0450918_001159 | Ga0450918_001159_170_1078 | 297 |
| 338 | 3300042531 | Ga0450918_005240 | Ga0450918_005240_471_1385 | 297 |
| 339 | 3300044765 | Ga0466970_0000003 | Ga0466970_0000003_125958_126851 | 297 |
| 340 | 3300044842 | Ga0466957_0011019 | Ga0466957_0011019_328_1221 | 297 |
| 341 | 3300046472 | Ga0495580_0019880 | Ga0495580_0019880_4043_4951 | 297 |
| 342 | 3300046473 | Ga0495582_0060628 | Ga0495582_0060628_1077_1985 | 297 |
| 343 | 3300046475 | Ga0495639_0002194 | Ga0495639_0002194_3356_4264 | 297 |
| 344 | 3300046518 | Ga0495631_0021245 | Ga0495631_0021245_329_1237 | 297 |
| 345 | 3300046522 | Ga0495643_0050788 | Ga0495643_0050788_443_1351 | 297 |
| 346 | 3300046535 | Ga0495586_0033643 | Ga0495586_0033643_1773_2681 | 297 |
| 347 | 3300046535 | Ga0495586_0205302 | Ga0495586_0205302_142_1056 | 297 |
| 348 | 3300046558 | Ga0495633_0064993 | Ga0495633_0064993_419_1327 | 297 |
| 349 | 3300046615 | Ga0495656_0002415 | Ga0495656_0002415_1795_2703 | 297 |
| 350 | 3300046615 | Ga0495656_0111467 | Ga0495656_0111467_337_1245 | 297 |
| 351 | 3300046664 | Ga0495659_0045057 | Ga0495659_0045057_448_1356 | 297 |
| 352 | 3300046674 | Ga0495588_0001124 | Ga0495588_0001124_5950_6858 | 297 |
| 353 | 3300046674 | Ga0495588_0002936 | Ga0495588_0002936_4362_5270 | 297 |
| 354 | 3300046674 | Ga0495588_0003646 | Ga0495588_0003646_3028_3936 | 297 |
| 355 | 3300046674 | Ga0495588_0033086 | Ga0495588_0033086_867_1775 | 297 |
| 356 | 3300046674 | Ga0495588_0118107 | Ga0495588_0118107_314_1207 | 297 |
| 357 | 3300046691 | Ga0495670_0000694 | Ga0495670_0000694_6263_7171 | 297 |
| 358 | 3300046809 | Ga0495600_0041007 | Ga0495600_0041007_1813_2721 | 297 |
| 359 | 3300047315 | Ga0495581_0064306 | Ga0495581_0064306_284_1192 | 297 |
| 360 | 3300047315 | Ga0495581_0069756 | Ga0495581_0069756_43_951 | 297 |
| 361 | 3300047444 | Ga0495675_0003278 | Ga0495675_0003278_385_1293 | 297 |
| 362 | 3300047673 | Ga0495593_0069116 | Ga0495593_0069116_62_970 | 297 |
| 363 | 3300048903 | Ga0496100_0034609 | Ga0496100_0034609_38_946 | 297 |
| 364 | 3300048904 | Ga0496101_0047349 | Ga0496101_0047349_2068_3009 | 297 |
| 365 | 3300048905 | Ga0496102_0003570 | Ga0496102_0003570_1941_2849 | 297 |
| 366 | 3300048905 | Ga0496102_0078039 | Ga0496102_0078039_392_1300 | 297 |
| 367 | 3300048905 | Ga0496102_0118563 | Ga0496102_0118563_75_1016 | 297 |
| 368 | 3300048905 | Ga0496102_0187478 | Ga0496102_0187478_393_1301 | 297 |
| 369 | 3300048905 | Ga0496102_0224250 | Ga0496102_0224250_837_1736 | 297 |
| 370 | 3300048905 | Ga0496102_0369884 | Ga0496102_0369884_146_1054 | 297 |
| 371 | 3300048905 | Ga0496102_0584586 | Ga0496102_0584586_121_1029 | 297 |
| 372 | 3300048906 | Ga0496103_0059856 | Ga0496103_0059856_1178_2119 | 297 |
| 373 | 3300048906 | Ga0496103_0065381 | Ga0496103_0065381_565_1473 | 297 |
| 374 | 3300048907 | Ga0496104_0108157 | Ga0496104_0108157_69_1010 | 297 |
| 375 | 3300048907 | Ga0496104_0110389 | Ga0496104_0110389_1446_2354 | 297 |
| 376 | 3300048907 | Ga0496104_0285055 | Ga0496104_0285055_582_1490 | 297 |
| 377 | 3300048908 | Ga0496105_0082318 | Ga0496105_0082318_1161_2069 | 297 |
| 378 | 3300048909 | Ga0496106_0009516 | Ga0496106_0009516_39_947 | 297 |
| 379 | 3300048909 | Ga0496106_0015947 | Ga0496106_0015947_3011_3919 | 297 |
| 380 | 3300048909 | Ga0496106_0073158 | Ga0496106_0073158_590_1498 | 297 |
| 381 | 3300048910 | Ga0496107_0019804 | Ga0496107_0019804_1875_2783 | 297 |
| 382 | 3300048910 | Ga0496107_0046268 | Ga0496107_0046268_891_1799 | 297 |
| 383 | 3300048910 | Ga0496107_0054809 | Ga0496107_0054809_1378_2286 | 297 |
| 384 | 3300048910 | Ga0496107_0115515 | Ga0496107_0115515_147_1088 | 297 |
| 385 | 3300048910 | Ga0496107_0446805 | Ga0496107_0446805_12_920 | 297 |
| 386 | 3300048911 | Ga0496108_0027575 | Ga0496108_0027575_3502_4410 | 297 |
| 387 | 3300048911 | Ga0496108_0030459 | Ga0496108_0030459_1621_2529 | 297 |
| 388 | 3300048911 | Ga0496108_0082738 | Ga0496108_0082738_1249_2157 | 297 |
| 389 | 3300048911 | Ga0496108_0431155 | Ga0496108_0431155_215_1123 | 297 |
| 390 | 3300048912 | Ga0496109_0042178 | Ga0496109_0042178_2185_3093 | 297 |
| 391 | 3300048912 | Ga0496109_0084898 | Ga0496109_0084898_1679_2587 | 297 |
| 392 | 3300048912 | Ga0496109_0111434 | Ga0496109_0111434_1026_1934 | 297 |
| 393 | 3300048912 | Ga0496109_0137787 | Ga0496109_0137787_365_1306 | 297 |
| 394 | 3300048912 | Ga0496109_0192545 | Ga0496109_0192545_376_1284 | 297 |
| 395 | 3300048913 | Ga0496110_0010495 | Ga0496110_0010495_3262_4170 | 297 |
| 396 | 3300048913 | Ga0496110_0069682 | Ga0496110_0069682_1071_2012 | 297 |
| 397 | 3300048913 | Ga0496110_0086397 | Ga0496110_0086397_1854_2762 | 297 |
| 398 | 3300048913 | Ga0496110_0117717 | Ga0496110_0117717_1446_2354 | 297 |
| 399 | 3300048913 | Ga0496110_0183382 | Ga0496110_0183382_336_1244 | 297 |
| 400 | 3300048914 | Ga0496111_0002522 | Ga0496111_0002522_4313_5221 | 297 |
| 401 | 3300048914 | Ga0496111_0024864 | Ga0496111_0024864_1144_2052 | 297 |
| 402 | 3300048914 | Ga0496111_0052877 | Ga0496111_0052877_1337_2245 | 297 |
| 403 | 3300048914 | Ga0496111_0062762 | Ga0496111_0062762_1762_2670 | 297 |
| 404 | 3300048915 | Ga0496112_0025455 | Ga0496112_0025455_3979_4893 | 297 |
| 405 | 3300048915 | Ga0496112_0091625 | Ga0496112_0091625_1614_2522 | 297 |
| 406 | 3300048916 | Ga0496113_0169719 | Ga0496113_0169719_154_1095 | 297 |
| 407 | 3300048918 | Ga0496115_0032937 | Ga0496115_0032937_2551_3492 | 297 |
| 408 | 3300048918 | Ga0496115_0263384 | Ga0496115_0263384_410_1318 | 297 |
| 409 | 3300048920 | Ga0496117_0138231 | Ga0496117_0138231_406_1299 | 297 |
| 410 | 3300048927 | Ga0496124_0207207 | Ga0496124_0207207_275_1183 | 297 |
| 411 | 3300048928 | Ga0496125_0034154 | Ga0496125_0034154_1660_2568 | 297 |
| 412 | 3300048929 | Ga0496126_0029257 | Ga0496126_0029257_1689_2582 | 297 |
| 413 | 3300049569 | Ga0501032_0024780 | Ga0501032_0024780_1621_2535 | 297 |
| 414 | 3300049571 | Ga0501034_0000066 | Ga0501034_0000066_170970_171884 | 297 |
| 415 | 3300049571 | Ga0501034_0000590 | Ga0501034_0000590_41483_42376 | 297 |
| 416 | 3300049571 | Ga0501034_0043281 | Ga0501034_0043281_755_1648 | 297 |
| 417 | 3300049573 | Ga0501037_0107762 | Ga0501037_0107762_1046_1954 | 297 |
| 418 | 3300049574 | Ga0501038_0037165 | Ga0501038_0037165_508_1401 | 297 |
| 419 | 3300049574 | Ga0501038_0075186 | Ga0501038_0075186_64_972 | 297 |
| 420 | 3300049574 | Ga0501038_0177443 | Ga0501038_0177443_785_1693 | 297 |
| 421 | 3300049575 | Ga0501039_0488747 | Ga0501039_0488747_23_922 | 297 |
| 422 | 3300049579 | Ga0501043_0141161 | Ga0501043_0141161_726_1634 | 297 |
| 423 | 3300049823 | Ga0501044_0066726 | Ga0501044_0066726_1819_2727 | 297 |
| 424 | 3300050494 | nmdc:mga06z11_129954_c1 | nmdc:mga06z11_129954_c1_495_1403 | 297 |
| 425 | 3300050496 | nmdc:mga07m45_39124_c1 | nmdc:mga07m45_39124_c1_814_1707 | 297 |
| 426 | 3300059507 | Ga0587086_006510 | Ga0587086_006510_168_1139 | 297 |
| 427 | 3300059639 | Ga0587062_013033 | Ga0587062_013033_13_921 | 297 |
| 428 | 3300059643 | Ga0587072_023088 | Ga0587072_023088_45_953 | 297 |
| 429 | iso_pu_bacteria | 2643221549 | 2643768396 | 297 |
| 430 | iso_pu_bacteria | 2721755702 | 2723641126 | 297 |
| 431 | iso_pu_bacteria | 2852646457 | 2852649176 | 297 |
| 432 | iso_pu_bacteria | 2919395869 | 2919398246 | 297 |
| 433 | iso_pu_bacteria | 2945968032 | 2945969612 | 297 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vax-assembly1.cif.gz_A | crystal structure of uricase from arthrobacter globiformis | 0.9586 | 2 | 291 |
| 6oe8-assembly1.cif.gz_D | the crystal structure of hyper-thermostable aguricase mutant k12c/e286c | 0.9551 | 2 | 297 |
| 1vax-assembly1.cif.gz_A | crystal structure of uricase from arthrobacter globiformis | 0.9522 | 2 | 291 |
| 6oe8-assembly1.cif.gz_D | the crystal structure of hyper-thermostable aguricase mutant k12c/e286c | 0.9519 | 2 | 297 |
| 7f2v-assembly1.cif.gz_A | urate oxidase from thermobispora bispora in apo form | 0.9475 | 4 | 297 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1vaxB00 | Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; | 0.9602 | 2 | 291 | 3.10.270.10 |
| 1vaxB00 | Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; | 0.9537 | 2 | 291 | 3.10.270.10 |
| af_Q54LT2_1_287_3.10.270.10 | Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; | 0.9414 | 4 | 283 | 3.10.270.10 |
| af_P16163_26_350_3.10.270.10 | Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; | 0.9392 | 3 | 285 | 3.10.270.10 |
| 5ll1A00 | Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; | 0.9299 | 3 | 280 | 3.10.270.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X8WZ66-F1-model_v4 | factor independent urate hydroxylase (EC 1.7.3.3) (Urate oxidase) | 0.9861 | 2 | 109 |
GO:0006144
GO:0016491 GO:0019628 |
| AF-A0A536EGS0-F1-model_v4 | factor independent urate hydroxylase (EC 1.7.3.3) (Urate oxidase) | 0.9742 | 2 | 94 |
GO:0004846
GO:0006144 GO:0019628 |
| AF-A0A2S8ZUZ7-F1-model_v4 | Uricase (EC 1.7.3.3) (Urate oxidase) | 0.9721 | 1 | 297 |
GO:0004846
GO:0006144 GO:0019628 |
| AF-A0A519UJK5-F1-model_v4 | factor independent urate hydroxylase (EC 1.7.3.3) (Urate oxidase) | 0.9688 | 2 | 99 |
GO:0004846
GO:0006144 GO:0019628 |
| AF-J2JIJ7-F1-model_v4 | factor independent urate hydroxylase (EC 1.7.3.3) | 0.9648 | 1 | 284 |
GO:0004846
GO:0005886 GO:0006144 GO:0019628 GO:0042907 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar