F442795

General Info

Members Datasets Scaffolds Average Seq Length
433 207 866 176

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100388462|Ga0070697_1003884622
Length 206
Sequence VAASDEGASDEGRRCLKGAPQASGRYNLRARLSADPASVGSVEAALAELGLPAESPRPGAYLVRLEGQHKLATMTWLIVGTHSLHVEAFFCRQPDENHAAFYRFLLERNGRMYGVHFAVDPVGDVYLVGRLPLGSVTPEEIDRLLGCVLSYSDENFDPALTLGFASSIRREWAWRVKRGESLANLQAFASLADPGGDRNGRGRAGS

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
56 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
91 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
92 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
93 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
94 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
95 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
96 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
99 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
100 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
103 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
104 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
108 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
113 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
114 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
123 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
126 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
141 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
169 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
178 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
179 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.46
Metatranscriptomes 2.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 5.08
Rhizosphere 92.61
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100388462 3300005536 Bacteria 1210
2 Ga0070658_10066458 3300005327 Bacteria 2945
3 Ga0070683_100128117 3300005329 Bacteria 2400
4 Ga0070683_100933683 3300005329 Bacteria 833
5 Ga0070680_100336112 3300005336 Bacteria 1283
6 Ga0070682_100072736 3300005337 Bacteria 2204
7 Ga0070682_100169757 3300005337 Bacteria 1515
8 Ga0070691_10015562 3300005341 Bacteria 3494
9 Ga0070709_10035195 3300005434 Bacteria 3042
10 Ga0070709_10096198 3300005434 Bacteria 1963
11 Ga0070714_100003996 3300005435 Bacteria 11086
12 Ga0070714_100045502 3300005435 Bacteria 3720
13 Ga0070714_100106669 3300005435 Bacteria 2475
14 Ga0070714_100164393 3300005435 Bacteria 2010
15 Ga0070714_100816551 3300005435 Bacteria 903
16 Ga0070713_100100927 3300005436 Bacteria 2499
17 Ga0070713_100223899 3300005436 Bacteria 1707
18 Ga0070713_100230317 3300005436 Bacteria 1684
19 Ga0070713_100318673 3300005436 Bacteria 1435
20 Ga0070710_10064932 3300005437 Bacteria 2089
21 Ga0070710_10084033 3300005437 Bacteria 1864
22 Ga0070711_100057132 3300005439 Bacteria 2701
23 Ga0070711_100150857 3300005439 Bacteria 1752
24 Ga0070711_100182945 3300005439 Bacteria 1605
25 Ga0070711_100238324 3300005439 Bacteria 1421
26 Ga0070705_100050864 3300005440 Bacteria 2413
27 Ga0070694_100081999 3300005444 Bacteria 2245
28 Ga0070708_100017175 3300005445 Bacteria 6027
29 Ga0070708_100043635 3300005445 Bacteria 3940
30 Ga0070708_100048340 3300005445 Bacteria 3760
31 Ga0070708_100246021 3300005445 Bacteria 1679
32 Ga0070708_100577587 3300005445 Bacteria 1060
33 Ga0070663_100080748 3300005455 Bacteria 2389
34 Ga0070663_100101925 3300005455 Bacteria 2143
35 Ga0070678_100117986 3300005456 Bacteria 2088
36 Ga0070681_10998454 3300005458 Bacteria 757
37 Ga0070681_11093656 3300005458 Bacteria 718
38 Ga0070706_100005122 3300005467 Bacteria 12505
39 Ga0070706_100009991 3300005467 Bacteria 8813
40 Ga0070706_100010628 3300005467 Bacteria 8545
41 Ga0070706_100118946 3300005467 Bacteria 2462
42 Ga0070706_100148534 3300005467 Bacteria 2188
43 Ga0070706_100748175 3300005467 Bacteria 906
44 Ga0070707_100000293 3300005468 Bacteria 49051
45 Ga0070707_100003142 3300005468 Bacteria 15629
46 Ga0070707_100067249 3300005468 Bacteria 3447
47 Ga0070707_100083994 3300005468 Bacteria 3077
48 Ga0070707_100135382 3300005468 Bacteria 2397
49 Ga0070707_100215841 3300005468 Bacteria 1869
50 Ga0070707_101259784 3300005468 Bacteria 706
51 Ga0070698_100000106 3300005471 Bacteria 69519
52 Ga0070698_100004555 3300005471 Bacteria 15224
53 Ga0070698_100007047 3300005471 Bacteria 12176
54 Ga0070698_100014280 3300005471 Bacteria 8396
55 Ga0070698_100050660 3300005471 Bacteria 4232
56 Ga0070698_100054340 3300005471 Bacteria 4065
57 Ga0070698_100173135 3300005471 Bacteria 2099
58 Ga0070698_101180126 3300005471 Bacteria 715
59 Ga0070699_100000577 3300005518 Bacteria 34742
60 Ga0070699_100197443 3300005518 Bacteria 1789
61 Ga0070699_100663658 3300005518 Bacteria 952
62 Ga0070679_100216185 3300005530 Bacteria 1879
63 Ga0070684_100247358 3300005535 Bacteria 1629
64 Ga0070697_100022446 3300005536 Bacteria 5009
65 Ga0070697_100934769 3300005536 Bacteria 770
66 Ga0068855_100094076 3300005563 Bacteria 3456
67 Ga0068855_100340106 3300005563 Bacteria 1655
68 Ga0068855_100352078 3300005563 Bacteria 1622
69 Ga0068857_100114263 3300005577 Bacteria 2428
70 Ga0068856_100088984 3300005614 Bacteria 3070
71 Ga0068856_100247387 3300005614 Bacteria 1798
72 Ga0068856_100888649 3300005614 Bacteria 910
73 Ga0068856_100949455 3300005614 Bacteria 878
74 Ga0070702_100284836 3300005615 Bacteria 1136
75 Ga0068859_100298977 3300005617 Bacteria 1703
76 Ga0068864_100359244 3300005618 Bacteria 1376
77 Ga0068858_100047225 3300005842 Bacteria 3992
78 Ga0081540_1001613 3300005983 Bacteria 19226
79 Ga0070717_10017376 3300006028 Bacteria 5598
80 Ga0070717_10039619 3300006028 Bacteria 3834
81 Ga0070717_10064876 3300006028 Bacteria 3034
82 Ga0070717_10067448 3300006028 Bacteria 2976
83 Ga0070717_10113363 3300006028 Bacteria 2315
84 Ga0070717_10264146 3300006028 Bacteria 1523
85 Ga0070717_10384136 3300006028 Bacteria 1259
86 Ga0070717_11105205 3300006028 Bacteria 722
87 Ga0070715_10001293 3300006163 Bacteria 7179
88 Ga0070715_10030271 3300006163 Bacteria 2187
89 Ga0070715_10056484 3300006163 Bacteria 1708
90 Ga0070716_100009940 3300006173 Bacteria 4758
91 Ga0070716_100262407 3300006173 Bacteria 1183
92 Ga0070712_100014767 3300006175 Bacteria 5016
93 Ga0070712_100019388 3300006175 Bacteria 4436
94 Ga0070712_100099762 3300006175 Bacteria 2144
95 Ga0070712_100130005 3300006175 Bacteria 1907
96 Ga0070712_100183225 3300006175 Bacteria 1633
97 Ga0070712_101106958 3300006175 Bacteria 687
98 Ga0097621_100079931 3300006237 Bacteria 2719
99 Ga0075434_100276368 3300006871 Bacteria 1699
100 Ga0075434_101068624 3300006871 Bacteria 821
101 Ga0075436_100100933 3300006914 Bacteria 2010
102 Ga0075436_100108186 3300006914 Bacteria 1939
103 Ga0097620_100298957 3300006931 Bacteria 1703
104 Ga0105240_10019614 3300009093 Bacteria 9032
105 Ga0105247_10131478 3300009101 Bacteria 1632
106 Ga0105247_10171059 3300009101 Bacteria 1444
107 Ga0105241_10101413 3300009174 Bacteria 2288
108 Ga0105248_10178096 3300009177 Bacteria 2396
109 Ga0105237_10110962 3300009545 Bacteria 2734
110 Ga0105237_10245136 3300009545 Bacteria 1793
111 Ga0105237_10333791 3300009545 Unclassified 1520
112 Ga0105238_10187066 3300009551 Bacteria 2047
113 Ga0105238_10553932 3300009551 Bacteria 1154
114 Ga0157370_10001509 3300013104 Bacteria 28736
115 Ga0157370_10263365 3300013104 Bacteria 1593
116 Ga0157369_10062079 3300013105 Bacteria 4028
117 Ga0157369_10077576 3300013105 Bacteria 3561
118 Ga0157369_10082414 3300013105 Bacteria 3441
119 Ga0157369_10316824 3300013105 Bacteria 1622
120 Ga0157369_10480590 3300013105 Bacteria 1286
121 Ga0157378_10453130 3300013297 Bacteria 1274
122 Ga0163162_10548676 3300013306 Bacteria 1284
123 Ga0157372_10075210 3300013307 Bacteria 3811
124 Ga0157372_10405183 3300013307 Bacteria 1589
125 Ga0157375_10226546 3300013308 Bacteria 2028
126 Ga0163163_10040000 3300014325 Bacteria 4577
127 Ga0157379_10608761 3300014968 Bacteria 1020
128 Ga0157376_10017783 3300014969 Bacteria 5432
129 Ga0157376_10409753 3300014969 Bacteria 1313
130 Ga0206355_1203151 3300020076 Bacteria 1142
131 Ga0206352_10709319 3300020078 Bacteria 1199
132 Ga0206350_10472719 3300020080 Bacteria 1261
133 Ga0206350_11261755 3300020080 Bacteria 1262
134 Ga0154015_1139064 3300020610 Bacteria 829
135 Ga0154015_1631463 3300020610 Bacteria 1230
136 Ga0213875_10040473 3300021388 Bacteria 2194
137 Ga0224712_10014901 3300022467 Bacteria 2517
138 Ga0224712_10022008 3300022467 Bacteria 2191
139 Ga0224712_10173358 3300022467 Bacteria 968
140 Ga0228598_1014120 3300024227 Bacteria 1581
141 Ga0207692_10002006 3300025898 Bacteria 7775
142 Ga0207692_10010962 3300025898 Bacteria 3837
143 Ga0207692_10033020 3300025898 Bacteria 2492
144 Ga0207692_10044916 3300025898 Bacteria 2207
145 Ga0207685_10051135 3300025905 Bacteria 1595
146 Ga0207685_10071009 3300025905 Bacteria 1411
147 Ga0207699_10002656 3300025906 Bacteria 8440
148 Ga0207699_10005686 3300025906 Bacteria 5990
149 Ga0207699_10006520 3300025906 Bacteria 5658
150 Ga0207699_10075181 3300025906 Bacteria 2077
151 Ga0207699_10170823 3300025906 Bacteria 1454
152 Ga0207705_10219068 3300025909 Bacteria 1445
153 Ga0207705_10610334 3300025909 Bacteria 848
154 Ga0207684_10000571 3300025910 Bacteria 44831
155 Ga0207684_10009196 3300025910 Bacteria 8738
156 Ga0207684_10068314 3300025910 Bacteria 3020
157 Ga0207684_10190828 3300025910 Bacteria 1767
158 Ga0207684_10772602 3300025910 Bacteria 813
159 Ga0207695_10048250 3300025913 Bacteria 4499
160 Ga0207671_10111200 3300025914 Bacteria 2084
161 Ga0207693_10010872 3300025915 Bacteria 7385
162 Ga0207693_10029366 3300025915 Bacteria 4343
163 Ga0207693_10091383 3300025915 Bacteria 2386
164 Ga0207693_10121202 3300025915 Bacteria 2054
165 Ga0207693_10553964 3300025915 Bacteria 896
166 Ga0207663_10003417 3300025916 Bacteria 7767
167 Ga0207663_10014867 3300025916 Bacteria 4277
168 Ga0207663_10064339 3300025916 Bacteria 2340
169 Ga0207663_10138123 3300025916 Bacteria 1694
170 Ga0207657_10695867 3300025919 Unclassified 790
171 Ga0207649_10475939 3300025920 Bacteria 946
172 Ga0207652_10223557 3300025921 Bacteria 1696
173 Ga0207652_10702074 3300025921 Bacteria 902
174 Ga0207646_10000050 3300025922 Bacteria 171554
175 Ga0207646_10009108 3300025922 Bacteria 9854
176 Ga0207646_10131538 3300025922 Bacteria 2252
177 Ga0207646_10218306 3300025922 Bacteria 1722
178 Ga0207646_10239954 3300025922 Bacteria 1637
179 Ga0207700_10011993 3300025928 Bacteria 5562
180 Ga0207700_10105875 3300025928 Bacteria 2253
181 Ga0207700_10207307 3300025928 Bacteria 1655
182 Ga0207700_11069715 3300025928 Bacteria 721
183 Ga0207664_10004567 3300025929 Bacteria 9378
184 Ga0207664_10006510 3300025929 Bacteria 8038
185 Ga0207664_10030306 3300025929 Bacteria 4131
186 Ga0207664_10031184 3300025929 Bacteria 4076
187 Ga0207664_10613538 3300025929 Bacteria 977
188 Ga0207665_10007145 3300025939 Bacteria 7391
189 Ga0207661_10280100 3300025944 Bacteria 1490
190 Ga0207667_10031708 3300025949 Bacteria 5703
191 Ga0207667_10095389 3300025949 Bacteria 3071
192 Ga0207667_10343033 3300025949 Bacteria 1524
193 Ga0207712_10435266 3300025961 Bacteria 1109
194 Ga0207658_10025153 3300025986 Bacteria 4168
195 Ga0207677_10406417 3300026023 Bacteria 1156
196 Ga0207678_10022668 3300026067 Bacteria 5499
197 Ga0207702_10070270 3300026078 Bacteria 3011
198 Ga0207702_10685926 3300026078 Bacteria 1009
199 Ga0207674_10053896 3300026116 Bacteria 4097
200 Ga0207683_10097426 3300026121 Bacteria 2623
201 Ga0268266_10103469 3300028379 Bacteria 2513
202 Ga0265763_1000557 3300030763 Bacteria 2324
203 Ga0265760_10046083 3300031090 Bacteria 1307
204 Ga0265313_10066730 3300031595 Bacteria 1667
205 Ga0373928_0073831 3300035084 Bacteria 848
206 Ga0373934_0000058 3300035086 Bacteria 37451
207 Ga0373934_0068804 3300035086 Bacteria 1414
208 Ga0373940_0013608 3300035088 Bacteria 1972
209 Ga0373949_0065932 3300035090 Bacteria 940
210 Ga0373923_0022727 3300035111 Bacteria 2462
211 Ga0373923_0027813 3300035111 Bacteria 2258
212 Ga0373923_0084798 3300035111 Bacteria 1378
213 Ga0373932_0030564 3300035112 Bacteria 1494
214 Ga0373936_0078264 3300035113 Bacteria 1373
215 Ga0373939_0010759 3300035114 Bacteria 2296
216 Ga0373941_0152412 3300035115 Bacteria 849
217 Ga0373945_0044306 3300035116 Bacteria 1617
218 Ga0373953_0000217 3300035117 Bacteria 15671
219 Ga0373953_0013246 3300035117 Bacteria 2941
220 Ga0373954_0004267 3300035118 Bacteria 6144
221 Ga0373954_0046058 3300035118 Bacteria 2038
222 Ga0373954_0085283 3300035118 Bacteria 1512
223 Ga0373956_0004916 3300035119 Bacteria 5352
224 Ga0373956_0037282 3300035119 Bacteria 2149
225 Ga0373956_0056696 3300035119 Bacteria 1769
226 Ga0373957_0001103 3300035120 Bacteria 7150
227 Ga0373957_0038069 3300035120 Bacteria 1799
228 Ga0373957_0108289 3300035120 Bacteria 1117
229 Ga0373943_0107278 3300035170 Bacteria 1468
230 Ga0373946_0383237 3300035171 Bacteria 707
231 Ga0373955_0000156 3300035172 Bacteria 27424
232 Ga0373955_0037793 3300035172 Bacteria 2568
233 Ga0373955_0051356 3300035172 Bacteria 2245
234 Ga0373955_0053234 3300035172 Bacteria 2209
235 Ga0373961_0022338 3300035241 Bacteria 1692
236 Ga0373924_0002626 3300035410 Bacteria 6061
237 Ga0373924_0042700 3300035410 Bacteria 1861
238 Ga0373931_0056169 3300035691 Bacteria 2108
239 Ga0373935_0102392 3300035692 Bacteria 1889
240 Ga0373935_0117673 3300035692 Bacteria 1771
241 Ga0373935_0482207 3300035692 Bacteria 899
242 Ga0373927_0192680 3300035695 Bacteria 1337
243 Ga0373927_0211309 3300035695 Bacteria 1274
244 Ga0373933_0000009 3300035724 Bacteria 112662
245 Ga0373933_0004934 3300035724 Bacteria 7277
246 Ga0373933_0008160 3300035724 Bacteria 5715
247 Ga0373933_0066772 3300035724 Bacteria 2180
248 Ga0373947_0262584 3300035725 Bacteria 1144
249 Ga0373947_0340412 3300035725 Bacteria 1005
250 Ga0373937_0000012 3300036401 Bacteria 159418
251 Ga0373937_0034218 3300036401 Bacteria 4621
252 Ga0373937_0044547 3300036401 Bacteria 4053
253 Ga0373937_0083426 3300036401 Bacteria 2956
254 Ga0373937_0168820 3300036401 Bacteria 2052
255 Ga0373925_0070304 3300037068 Bacteria 2646
256 Ga0373925_0080134 3300037068 Bacteria 2481
257 Ga0373925_0557556 3300037068 Bacteria 942
258 Ga0436364_0291916 3300037853 Bacteria 14444
259 Ga0436364_0540530 3300037853 Bacteria 3612
260 Ga0436364_0630047 3300037853 Bacteria 4238
261 Ga0436364_0650829 3300037853 Bacteria 2042
262 Ga0395901_0071868 3300038443 Bacteria 3606
263 Ga0436365_0522855 3300039437 Bacteria 1323
264 Ga0436361_0577065 3300039447 Bacteria 684
265 Ga0436363_0253117 3300039450 Bacteria 828
266 Ga0436363_1267825 3300039450 Bacteria 856
267 Ga0436362_1185537 3300039453 Bacteria 831
268 Ga0451793_0746767 3300041452 Bacteria 876
269 Ga0466965_0031986 3300044683 Bacteria 2569
270 Ga0466961_0108306 3300044693 Bacteria 1749
271 Ga0466961_0341760 3300044693 Bacteria 911
272 Ga0466963_0079463 3300044694 Bacteria 2219
273 Ga0466963_0139988 3300044694 Bacteria 1676
274 Ga0466963_0165400 3300044694 Bacteria 1541
275 Ga0466957_0031041 3300044842 Bacteria 3192
276 Ga0466957_0050168 3300044842 Bacteria 2539
277 Ga0466957_0142716 3300044842 Bacteria 1544
278 Ga0466958_0168768 3300045836 Bacteria 1385
279 Ga0466958_0183406 3300045836 Bacteria 1328
280 Ga0466967_0018777 3300045976 Bacteria 5539
281 Ga0466967_0128017 3300045976 Bacteria 2354
282 Ga0466967_0250718 3300045976 Bacteria 1691
283 Ga0466967_0794860 3300045976 Bacteria 939
284 Ga0495592_0000049 3300046454 Bacteria 113704
285 Ga0495592_0023567 3300046454 Bacteria 4682
286 Ga0495592_0027923 3300046454 Bacteria 4275
287 Ga0495603_0041550 3300046455 Bacteria 2749
288 Ga0495629_0011887 3300046459 Bacteria 6312
289 Ga0495629_0185611 3300046459 Bacteria 1440
290 Ga0495641_0015482 3300046461 Bacteria 4068
291 Ga0495641_0077279 3300046461 Bacteria 1492
292 Ga0495651_0000007 3300046462 Bacteria 158577
293 Ga0495651_0032850 3300046462 Bacteria 4047
294 Ga0495651_0113952 3300046462 Bacteria 1995
295 Ga0495651_0320054 3300046462 Bacteria 1034
296 Ga0495653_0009356 3300046463 Bacteria 8017
297 Ga0495653_0011729 3300046463 Bacteria 7155
298 Ga0495653_0029134 3300046463 Bacteria 4410
299 Ga0495653_0177166 3300046463 Bacteria 1466
300 Ga0495653_0195849 3300046463 Bacteria 1375
301 Ga0495580_0017580 3300046472 Bacteria 5343
302 Ga0495582_0060001 3300046473 Bacteria 2098
303 Ga0495664_0082127 3300046477 Bacteria 1932
304 Ga0495594_0335636 3300046499 Bacteria 861
305 Ga0495608_0000015 3300046511 Bacteria 200266
306 Ga0495608_0041961 3300046511 Bacteria 3059
307 Ga0495618_0058342 3300046514 Bacteria 2444
308 Ga0495618_0273366 3300046514 Bacteria 1055
309 Ga0495628_0001681 3300046516 Bacteria 20199
310 Ga0495628_0242800 3300046516 Bacteria 1347
311 Ga0495628_0248219 3300046516 Bacteria 1329
312 Ga0495630_0194972 3300046517 Bacteria 1545
313 Ga0495630_0425178 3300046517 Bacteria 1018
314 Ga0495666_0283465 3300046526 Bacteria 751
315 Ga0495652_0001969 3300046529 Bacteria 21864
316 Ga0495652_0061687 3300046529 Bacteria 3163
317 Ga0495652_0065804 3300046529 Bacteria 3044
318 Ga0495652_0178098 3300046529 Bacteria 1634
319 Ga0495652_0435785 3300046529 Bacteria 920
320 Ga0495665_0094571 3300046531 Bacteria 1569
321 Ga0495665_0586767 3300046531 Bacteria 558
322 Ga0495640_0057845 3300046533 Bacteria 2645
323 Ga0495640_0085252 3300046533 Bacteria 2093
324 Ga0495587_0000032 3300046536 Bacteria 124143
325 Ga0495587_0050276 3300046536 Bacteria 2466
326 Ga0495587_0053336 3300046536 Bacteria 2384
327 Ga0495587_0110718 3300046536 Bacteria 1577
328 Ga0495645_0170480 3300046543 Bacteria 1498
329 Ga0495645_0197638 3300046543 Bacteria 1366
330 Ga0495645_0288630 3300046543 Bacteria 1076
331 Ga0495667_0000138 3300046559 Bacteria 50454
332 Ga0495667_0025556 3300046559 Bacteria 3979
333 Ga0495667_0346166 3300046559 Bacteria 939
334 Ga0495634_0214732 3300046642 Bacteria 1189
335 Ga0495634_0215953 3300046642 Bacteria 1185
336 Ga0495635_0020420 3300046663 Bacteria 4614
337 Ga0495635_0067826 3300046663 Bacteria 2446
338 Ga0495635_0155701 3300046663 Bacteria 1555
339 Ga0495588_0020093 3300046674 Bacteria 3277
340 Ga0495657_0000106 3300046675 Bacteria 74585
341 Ga0495657_0062978 3300046675 Bacteria 2448
342 Ga0495657_0080985 3300046675 Bacteria 2100
343 Ga0495657_0477207 3300046675 Bacteria 728
344 Ga0495599_0000414 3300046678 Bacteria 24387
345 Ga0495599_0042611 3300046678 Bacteria 2848
346 Ga0495599_0103749 3300046678 Bacteria 1772
347 Ga0495623_0000436 3300046679 Bacteria 27465
348 Ga0495646_0031738 3300046680 Bacteria 3290
349 Ga0495647_0125505 3300046681 Bacteria 1083
350 Ga0495658_0089806 3300046683 Bacteria 1817
351 Ga0495613_0143261 3300046689 Bacteria 1706
352 Ga0495613_0596569 3300046689 Bacteria 735
353 Ga0495613_0625365 3300046689 Bacteria 714
354 Ga0495624_0151852 3300046690 Bacteria 1417
355 Ga0495600_0010671 3300046809 Bacteria 5707
356 Ga0495600_0037518 3300046809 Bacteria 3151
357 Ga0495600_0176732 3300046809 Bacteria 1376
358 Ga0495581_0038528 3300047315 Bacteria 2766
359 Ga0495604_0000062 3300047317 Bacteria 93264
360 Ga0495604_0045402 3300047317 Bacteria 3429
361 Ga0495604_0055772 3300047317 Bacteria 3044
362 Ga0495674_0111102 3300047319 Bacteria 2323
363 Ga0495674_0144640 3300047319 Bacteria 1996
364 Ga0495676_0265085 3300047321 Bacteria 1167
365 Ga0495680_0001896 3300047322 Bacteria 21959
366 Ga0495680_0077044 3300047322 Bacteria 2526
367 Ga0495680_0100692 3300047322 Bacteria 2153
368 Ga0495680_0280848 3300047322 Bacteria 1173
369 Ga0495675_0005976 3300047444 Bacteria 7442
370 Ga0495675_0111745 3300047444 Bacteria 1705
371 Ga0495675_0248385 3300047444 Bacteria 1069
372 Ga0495684_0016230 3300047471 Bacteria 5734
373 Ga0495684_0030324 3300047471 Bacteria 4153
374 Ga0495684_0125380 3300047471 Bacteria 1932
375 Ga0495684_0477427 3300047471 Bacteria 861
376 Ga0495593_0037909 3300047673 Bacteria 2604
377 Ga0495602_0002545 3300048088 Bacteria 18578
378 Ga0495602_0092702 3300048088 Bacteria 2501
379 Ga0495602_0148412 3300048088 Bacteria 1846
380 Ga0495602_0267367 3300048088 Bacteria 1265
381 Ga0495614_0029472 3300048089 Bacteria 2362
382 Ga0496100_0184026 3300048903 Bacteria 1512
383 Ga0496101_0047346 3300048904 Bacteria 3086
384 Ga0496103_0146696 3300048906 Bacteria 1511
385 Ga0496104_0006175 3300048907 Bacteria 10521
386 Ga0496105_0000770 3300048908 Bacteria 21786
387 Ga0496106_0388466 3300048909 Bacteria 1121
388 Ga0496106_0782631 3300048909 Bacteria 757
389 Ga0496107_0019294 3300048910 Bacteria 4811
390 Ga0496108_0026501 3300048911 Bacteria 4781
391 Ga0496108_0053244 3300048911 Bacteria 3393
392 Ga0496108_0056776 3300048911 Bacteria 3290
393 Ga0496109_0196650 3300048912 Bacteria 1895
394 Ga0496109_0228967 3300048912 Bacteria 1748
395 Ga0496109_0254594 3300048912 Bacteria 1653
396 Ga0496110_0117832 3300048913 Bacteria 2391
397 Ga0496112_0000586 3300048915 Bacteria 24986
398 Ga0496113_0071440 3300048916 Bacteria 2640
399 Ga0496114_0150215 3300048917 Bacteria 2021
400 Ga0496115_0016728 3300048918 Bacteria 5588
401 Ga0496115_0223872 3300048918 Bacteria 1552
402 Ga0496115_0910105 3300048918 Bacteria 678
403 Ga0496126_0004952 3300048929 Bacteria 15533
404 Ga0501032_0599377 3300049569 Bacteria 701
405 Ga0501037_0170361 3300049573 Bacteria 1548
406 Ga0501037_0310493 3300049573 Bacteria 1093
407 Ga0501037_0628510 3300049573 Bacteria 719
408 Ga0501043_0464777 3300049579 Bacteria 949
409 Ga0501047_0173482 3300049581 Bacteria 2025
410 Ga0501069_0001167 3300049585 Bacteria 12735
411 Ga0501070_0007439 3300049586 Bacteria 9302
412 Ga0501070_0030253 3300049586 Bacteria 4537
413 Ga0501070_0058215 3300049586 Bacteria 3203
414 Ga0501070_0205849 3300049586 Bacteria 1615
415 Ga0501074_0011018 3300049590 Bacteria 6562
416 Ga0501077_0028969 3300049593 Bacteria 3520
417 Ga0501079_0023292 3300049741 Bacteria 4753
418 Ga0501080_0019443 3300049742 Bacteria 6291
419 Ga0501081_0173528 3300049743 Bacteria 1557
420 Ga0501044_0027805 3300049823 Bacteria 5971
421 nmdc:mga0n895_21840_c1 3300050512 Bacteria 5992
422 nmdc:mga0rr50_221757_c1 3300050513 Bacteria 1562
423 nmdc:mga0rr50_643004_c1 3300050513 Bacteria 905
424 nmdc:mga08x19_12213_c1 3300050514 Bacteria 5170
425 nmdc:mga08x19_26250_c1 3300050514 Bacteria 3633
426 nmdc:mga08x19_82824_c1 3300050514 Bacteria 2108
427 nmdc:mga0a205_12233_c1 3300050515 Bacteria 7935
428 nmdc:mga0a205_23375_c1 3300050515 Bacteria 5863
429 Ga0495601_0089411 3300053077 Bacteria 1980
430 Ga0495595_0014977 3300053084 Bacteria 3300
431 Ga0495619_0033286 3300053085 Bacteria 3347
432 Ga0495619_0150326 3300053085 Bacteria 1606
433 Ga0500643_000483 3300053087 Bacteria 29043
434 Ga0070697_100388462
435 Ga0070658_10066458
436 Ga0070683_100128117
437 Ga0070683_100933683
438 Ga0070680_100336112
439 Ga0070682_100072736
440 Ga0070682_100169757
441 Ga0070691_10015562
442 Ga0070709_10035195
443 Ga0070709_10096198
444 Ga0070714_100003996
445 Ga0070714_100045502
446 Ga0070714_100106669
447 Ga0070714_100164393
448 Ga0070714_100816551
449 Ga0070713_100100927
450 Ga0070713_100223899
451 Ga0070713_100230317
452 Ga0070713_100318673
453 Ga0070710_10064932
454 Ga0070710_10084033
455 Ga0070711_100057132
456 Ga0070711_100150857
457 Ga0070711_100182945
458 Ga0070711_100238324
459 Ga0070705_100050864
460 Ga0070694_100081999
461 Ga0070708_100017175
462 Ga0070708_100043635
463 Ga0070708_100048340
464 Ga0070708_100246021
465 Ga0070708_100577587
466 Ga0070663_100080748
467 Ga0070663_100101925
468 Ga0070678_100117986
469 Ga0070681_10998454
470 Ga0070681_11093656
471 Ga0070706_100005122
472 Ga0070706_100009991
473 Ga0070706_100010628
474 Ga0070706_100118946
475 Ga0070706_100148534
476 Ga0070706_100748175
477 Ga0070707_100000293
478 Ga0070707_100003142
479 Ga0070707_100067249
480 Ga0070707_100083994
481 Ga0070707_100135382
482 Ga0070707_100215841
483 Ga0070707_101259784
484 Ga0070698_100000106
485 Ga0070698_100004555
486 Ga0070698_100007047
487 Ga0070698_100014280
488 Ga0070698_100050660
489 Ga0070698_100054340
490 Ga0070698_100173135
491 Ga0070698_101180126
492 Ga0070699_100000577
493 Ga0070699_100197443
494 Ga0070699_100663658
495 Ga0070679_100216185
496 Ga0070684_100247358
497 Ga0070697_100022446
498 Ga0070697_100934769
499 Ga0068855_100094076
500 Ga0068855_100340106
501 Ga0068855_100352078
502 Ga0068857_100114263
503 Ga0068856_100088984
504 Ga0068856_100247387
505 Ga0068856_100888649
506 Ga0068856_100949455
507 Ga0070702_100284836
508 Ga0068859_100298977
509 Ga0068864_100359244
510 Ga0068858_100047225
511 Ga0081540_1001613
512 Ga0070717_10017376
513 Ga0070717_10039619
514 Ga0070717_10064876
515 Ga0070717_10067448
516 Ga0070717_10113363
517 Ga0070717_10264146
518 Ga0070717_10384136
519 Ga0070717_11105205
520 Ga0070715_10001293
521 Ga0070715_10030271
522 Ga0070715_10056484
523 Ga0070716_100009940
524 Ga0070716_100262407
525 Ga0070712_100014767
526 Ga0070712_100019388
527 Ga0070712_100099762
528 Ga0070712_100130005
529 Ga0070712_100183225
530 Ga0070712_101106958
531 Ga0097621_100079931
532 Ga0075434_100276368
533 Ga0075434_101068624
534 Ga0075436_100100933
535 Ga0075436_100108186
536 Ga0097620_100298957
537 Ga0105240_10019614
538 Ga0105247_10131478
539 Ga0105247_10171059
540 Ga0105241_10101413
541 Ga0105248_10178096
542 Ga0105237_10110962
543 Ga0105237_10245136
544 Ga0105237_10333791
545 Ga0105238_10187066
546 Ga0105238_10553932
547 Ga0157370_10001509
548 Ga0157370_10263365
549 Ga0157369_10062079
550 Ga0157369_10077576
551 Ga0157369_10082414
552 Ga0157369_10316824
553 Ga0157369_10480590
554 Ga0157378_10453130
555 Ga0163162_10548676
556 Ga0157372_10075210
557 Ga0157372_10405183
558 Ga0157375_10226546
559 Ga0163163_10040000
560 Ga0157379_10608761
561 Ga0157376_10017783
562 Ga0157376_10409753
563 Ga0206355_1203151
564 Ga0206352_10709319
565 Ga0206350_10472719
566 Ga0206350_11261755
567 Ga0154015_1139064
568 Ga0154015_1631463
569 Ga0213875_10040473
570 Ga0224712_10014901
571 Ga0224712_10022008
572 Ga0224712_10173358
573 Ga0228598_1014120
574 Ga0207692_10002006
575 Ga0207692_10010962
576 Ga0207692_10033020
577 Ga0207692_10044916
578 Ga0207685_10051135
579 Ga0207685_10071009
580 Ga0207699_10002656
581 Ga0207699_10005686
582 Ga0207699_10006520
583 Ga0207699_10075181
584 Ga0207699_10170823
585 Ga0207705_10219068
586 Ga0207705_10610334
587 Ga0207684_10000571
588 Ga0207684_10009196
589 Ga0207684_10068314
590 Ga0207684_10190828
591 Ga0207684_10772602
592 Ga0207695_10048250
593 Ga0207671_10111200
594 Ga0207693_10010872
595 Ga0207693_10029366
596 Ga0207693_10091383
597 Ga0207693_10121202
598 Ga0207693_10553964
599 Ga0207663_10003417
600 Ga0207663_10014867
601 Ga0207663_10064339
602 Ga0207663_10138123
603 Ga0207657_10695867
604 Ga0207649_10475939
605 Ga0207652_10223557
606 Ga0207652_10702074
607 Ga0207646_10000050
608 Ga0207646_10009108
609 Ga0207646_10131538
610 Ga0207646_10218306
611 Ga0207646_10239954
612 Ga0207700_10011993
613 Ga0207700_10105875
614 Ga0207700_10207307
615 Ga0207700_11069715
616 Ga0207664_10004567
617 Ga0207664_10006510
618 Ga0207664_10030306
619 Ga0207664_10031184
620 Ga0207664_10613538
621 Ga0207665_10007145
622 Ga0207661_10280100
623 Ga0207667_10031708
624 Ga0207667_10095389
625 Ga0207667_10343033
626 Ga0207712_10435266
627 Ga0207658_10025153
628 Ga0207677_10406417
629 Ga0207678_10022668
630 Ga0207702_10070270
631 Ga0207702_10685926
632 Ga0207674_10053896
633 Ga0207683_10097426
634 Ga0268266_10103469
635 Ga0265763_1000557
636 Ga0265760_10046083
637 Ga0265313_10066730
638 Ga0373928_0073831
639 Ga0373934_0000058
640 Ga0373934_0068804
641 Ga0373940_0013608
642 Ga0373949_0065932
643 Ga0373923_0022727
644 Ga0373923_0027813
645 Ga0373923_0084798
646 Ga0373932_0030564
647 Ga0373936_0078264
648 Ga0373939_0010759
649 Ga0373941_0152412
650 Ga0373945_0044306
651 Ga0373953_0000217
652 Ga0373953_0013246
653 Ga0373954_0004267
654 Ga0373954_0046058
655 Ga0373954_0085283
656 Ga0373956_0004916
657 Ga0373956_0037282
658 Ga0373956_0056696
659 Ga0373957_0001103
660 Ga0373957_0038069
661 Ga0373957_0108289
662 Ga0373943_0107278
663 Ga0373946_0383237
664 Ga0373955_0000156
665 Ga0373955_0037793
666 Ga0373955_0051356
667 Ga0373955_0053234
668 Ga0373961_0022338
669 Ga0373924_0002626
670 Ga0373924_0042700
671 Ga0373931_0056169
672 Ga0373935_0102392
673 Ga0373935_0117673
674 Ga0373935_0482207
675 Ga0373927_0192680
676 Ga0373927_0211309
677 Ga0373933_0000009
678 Ga0373933_0004934
679 Ga0373933_0008160
680 Ga0373933_0066772
681 Ga0373947_0262584
682 Ga0373947_0340412
683 Ga0373937_0000012
684 Ga0373937_0034218
685 Ga0373937_0044547
686 Ga0373937_0083426
687 Ga0373937_0168820
688 Ga0373925_0070304
689 Ga0373925_0080134
690 Ga0373925_0557556
691 Ga0436364_0291916
692 Ga0436364_0540530
693 Ga0436364_0630047
694 Ga0436364_0650829
695 Ga0395901_0071868
696 Ga0436365_0522855
697 Ga0436361_0577065
698 Ga0436363_0253117
699 Ga0436363_1267825
700 Ga0436362_1185537
701 Ga0451793_0746767
702 Ga0466965_0031986
703 Ga0466961_0108306
704 Ga0466961_0341760
705 Ga0466963_0079463
706 Ga0466963_0139988
707 Ga0466963_0165400
708 Ga0466957_0031041
709 Ga0466957_0050168
710 Ga0466957_0142716
711 Ga0466958_0168768
712 Ga0466958_0183406
713 Ga0466967_0018777
714 Ga0466967_0128017
715 Ga0466967_0250718
716 Ga0466967_0794860
717 Ga0495592_0000049
718 Ga0495592_0023567
719 Ga0495592_0027923
720 Ga0495603_0041550
721 Ga0495629_0011887
722 Ga0495629_0185611
723 Ga0495641_0015482
724 Ga0495641_0077279
725 Ga0495651_0000007
726 Ga0495651_0032850
727 Ga0495651_0113952
728 Ga0495651_0320054
729 Ga0495653_0009356
730 Ga0495653_0011729
731 Ga0495653_0029134
732 Ga0495653_0177166
733 Ga0495653_0195849
734 Ga0495580_0017580
735 Ga0495582_0060001
736 Ga0495664_0082127
737 Ga0495594_0335636
738 Ga0495608_0000015
739 Ga0495608_0041961
740 Ga0495618_0058342
741 Ga0495618_0273366
742 Ga0495628_0001681
743 Ga0495628_0242800
744 Ga0495628_0248219
745 Ga0495630_0194972
746 Ga0495630_0425178
747 Ga0495666_0283465
748 Ga0495652_0001969
749 Ga0495652_0061687
750 Ga0495652_0065804
751 Ga0495652_0178098
752 Ga0495652_0435785
753 Ga0495665_0094571
754 Ga0495665_0586767
755 Ga0495640_0057845
756 Ga0495640_0085252
757 Ga0495587_0000032
758 Ga0495587_0050276
759 Ga0495587_0053336
760 Ga0495587_0110718
761 Ga0495645_0170480
762 Ga0495645_0197638
763 Ga0495645_0288630
764 Ga0495667_0000138
765 Ga0495667_0025556
766 Ga0495667_0346166
767 Ga0495634_0214732
768 Ga0495634_0215953
769 Ga0495635_0020420
770 Ga0495635_0067826
771 Ga0495635_0155701
772 Ga0495588_0020093
773 Ga0495657_0000106
774 Ga0495657_0062978
775 Ga0495657_0080985
776 Ga0495657_0477207
777 Ga0495599_0000414
778 Ga0495599_0042611
779 Ga0495599_0103749
780 Ga0495623_0000436
781 Ga0495646_0031738
782 Ga0495647_0125505
783 Ga0495658_0089806
784 Ga0495613_0143261
785 Ga0495613_0596569
786 Ga0495613_0625365
787 Ga0495624_0151852
788 Ga0495600_0010671
789 Ga0495600_0037518
790 Ga0495600_0176732
791 Ga0495581_0038528
792 Ga0495604_0000062
793 Ga0495604_0045402
794 Ga0495604_0055772
795 Ga0495674_0111102
796 Ga0495674_0144640
797 Ga0495676_0265085
798 Ga0495680_0001896
799 Ga0495680_0077044
800 Ga0495680_0100692
801 Ga0495680_0280848
802 Ga0495675_0005976
803 Ga0495675_0111745
804 Ga0495675_0248385
805 Ga0495684_0016230
806 Ga0495684_0030324
807 Ga0495684_0125380
808 Ga0495684_0477427
809 Ga0495593_0037909
810 Ga0495602_0002545
811 Ga0495602_0092702
812 Ga0495602_0148412
813 Ga0495602_0267367
814 Ga0495614_0029472
815 Ga0496100_0184026
816 Ga0496101_0047346
817 Ga0496103_0146696
818 Ga0496104_0006175
819 Ga0496105_0000770
820 Ga0496106_0388466
821 Ga0496106_0782631
822 Ga0496107_0019294
823 Ga0496108_0026501
824 Ga0496108_0053244
825 Ga0496108_0056776
826 Ga0496109_0196650
827 Ga0496109_0228967
828 Ga0496109_0254594
829 Ga0496110_0117832
830 Ga0496112_0000586
831 Ga0496113_0071440
832 Ga0496114_0150215
833 Ga0496115_0016728
834 Ga0496115_0223872
835 Ga0496115_0910105
836 Ga0496126_0004952
837 Ga0501032_0599377
838 Ga0501037_0170361
839 Ga0501037_0310493
840 Ga0501037_0628510
841 Ga0501043_0464777
842 Ga0501047_0173482
843 Ga0501069_0001167
844 Ga0501070_0007439
845 Ga0501070_0030253
846 Ga0501070_0058215
847 Ga0501070_0205849
848 Ga0501074_0011018
849 Ga0501077_0028969
850 Ga0501079_0023292
851 Ga0501080_0019443
852 Ga0501081_0173528
853 Ga0501044_0027805
854 nmdc:mga0n895_21840_c1
855 nmdc:mga0rr50_221757_c1
856 nmdc:mga0rr50_643004_c1
857 nmdc:mga08x19_12213_c1
858 nmdc:mga08x19_26250_c1
859 nmdc:mga08x19_82824_c1
860 nmdc:mga0a205_12233_c1
861 nmdc:mga0a205_23375_c1
862 Ga0495601_0089411
863 Ga0495595_0014977
864 Ga0495619_0033286
865 Ga0495619_0150326
866 Ga0500643_000483

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10722

YbjN

Putative bacterial sensory transduction regulator

38

160

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h5b-assembly1.cif.gz_A crystal structure of dr_1245 from deinococcus radiodurans 0.7496 8 131
3epu-assembly1.cif.gz_A crystal structure of stm2138, a novel virulence chaperone in salmonella 0.7495 7 132
2plg-assembly1.cif.gz_A crystal structure of t110839 protein from synechococcus elongatus 0.7427 1 128
1jya-assembly1.cif.gz_A crystal structure of syce 0.7395 6 121
1jyo-assembly1.cif.gz_D structure of the salmonella virulence effector sptp in complex with its secretion chaperone sicp 0.7347 7 132
ID Description Score Start End Superfamily
af_P9WKU9_42_143_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9693 36 136 3.30.1460.10
af_P9WKU9_42_143_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.9509 36 136 3.30.1460.10
af_O05838_1_142_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.7653 4 129 3.30.1460.10
af_P0AF76_2_132_3.30.1460.10 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.76 4 131 3.30.1460.10
2plgA01 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.7599 6 128 3.30.1460.10
ID Description Score Start End GO Terms
AF-A0A286EIC6-F1-model_v4 Putative sensory transduction regulator 0.9924 7 165
AF-A0A7Y9EGB6-F1-model_v4 YbjN domain-containing protein 0.9918 5 162
AF-A0A543J2V1-F1-model_v4 Putative sensory transduction regulator 0.99 7 162
AF-A0A2W2E3V6-F1-model_v4 YbjN domain-containing protein 0.9897 8 162
AF-A0A6J7JM04-F1-model_v4 Unannotated protein 0.9883 34 160

Map