F442734

General Info

Members Datasets Scaffolds Average Seq Length
432 300 313 263

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2802429268|2804754127
Length 293
Sequence WTAGGEPVAHSTGKLGLVDDGICYSYGPMSYRKQLLSAPKPDAVSGEDFVFAALSSDRGSWALFLDIDGTLLDLAATPGAVSVPSSLPANLEALSRKLGGALALVTGRSLDYADQLFSPSHFPIAGLHGAERRDPDGRVHKATATAEFERLKIDLIADTANWAGVLIEDKGAAVAAHYRLAPDRKQALEPLMERALIRAGPNWTIQHGKMVIEIRPASADKGEAVTAFLAQPVFAGRRPIAIGDDVTDEAMFRTVNRLGGFSIRVGPPLPASEALGSITSAKVLRDVIAMLVS

Samples

Sample ID Description Type Environment
1 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
2 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
3 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
4 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
5 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
6 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
7 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
8 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
9 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
10 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
11 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
12 2516143018 Ensifer sp. BR816 Isolate Nodule
13 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
14 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
15 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
16 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
17 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
18 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
19 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
20 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
21 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
22 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
23 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
24 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
25 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
26 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
27 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
28 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
29 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
30 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
31 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
32 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
33 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
34 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
35 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
36 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
37 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
38 2643221599 Rhizobium sp. Root708 Isolate Unclassified
39 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
40 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
41 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
42 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
43 2738541293 Rhizobium sp. GV031 Isolate Unclassified
44 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
45 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
46 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
47 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
48 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
49 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
50 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
51 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
52 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
53 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
54 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
55 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
56 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
57 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
58 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
59 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
60 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
61 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
62 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
63 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
64 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
65 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
66 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
67 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
68 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
69 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
70 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
71 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
72 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
73 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
74 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
75 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
76 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
77 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
78 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
79 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
80 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
81 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
82 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
83 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
84 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
85 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
86 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
87 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
88 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
89 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
90 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
91 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
92 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
93 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
94 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
95 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
96 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
97 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
98 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
99 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
100 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
101 2996887358 Rhizobium sp. R711 Isolate Nodule
102 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
103 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
104 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
105 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
106 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
107 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
108 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
109 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
110 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
111 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
112 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
113 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
114 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
115 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
116 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
117 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
118 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
119 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
120 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
121 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
122 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
123 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
124 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
125 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
126 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
127 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
128 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
129 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
130 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
131 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
132 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
133 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
134 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
135 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
136 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
137 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
138 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
139 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
140 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
141 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
142 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
143 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
144 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
145 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
146 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
147 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
151 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
152 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
153 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
158 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
159 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
160 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
161 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
162 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
163 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
164 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
165 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
166 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
167 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
168 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
170 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
171 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
172 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
173 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
174 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
176 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
180 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
192 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
193 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
197 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
198 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
205 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
206 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
207 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
208 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
209 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
217 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
226 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
227 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
228 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
237 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
262 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
263 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
267 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
276 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
279 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
280 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
281 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
284 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
285 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
286 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
289 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
290 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
291 8005258706 Rhizobium sp. R693 Isolate Nodule
292 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
293 8005321885 Rhizobium sp. R72 Isolate Nodule
294 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
295 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
296 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
297 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
298 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
299 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
300 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 71.76
Metatranscriptomes 0.69
Isolates 27.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.77
Nodule 17.59
Rhizoplane 4.63
Rhizosphere 30.32
Stem 0
Stem Tuber 0
Unclassified 22.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10004259 3300001979 Bacteria 6166
2 JGI25155J39150_1000054 3300002704 Bacteria 74407
3 JGI25156J39149_1000238 3300002705 Bacteria 37951
4 JGI25162J39368_1000244 3300002737 Bacteria 54424
5 JGI25162J39368_1001901 3300002737 Bacteria 9578
6 JGI25154J39366_1000104 3300002738 Bacteria 74407
7 JGI25157J39369_1000270 3300002741 Bacteria 37955
8 JGI25152J39213_1000599 3300002773 Bacteria 19380
9 JGI25152J39213_1000743 3300002773 Bacteria 16653
10 JGI25152J39213_1001826 3300002773 Bacteria 8591
11 JGI25152J39213_1002555 3300002773 Bacteria 6850
12 JGI25152J39213_1003276 3300002773 Bacteria 5600
13 JGI25152J39213_1006774 3300002773 Bacteria 3048
14 JGI25150J39212_1000133 3300002774 Bacteria 41648
15 JGI25150J39212_1004716 3300002774 Bacteria 2994
16 JGI25151J46595_10000407 3300003187 Bacteria 44348
17 JGI25151J46595_10009343 3300003187 Bacteria 4650
18 JGI25151J46595_10041819 3300003187 Bacteria 1659
19 JGI25165J46597_1000485 3300003214 Bacteria 38628
20 JGI25165J46597_1000607 3300003214 Bacteria 30530
21 JGI25153J46596_10001632 3300003215 Bacteria 13301
22 JGI25153J46596_10005199 3300003215 Bacteria 6850
23 JGI25153J46596_10007022 3300003215 Bacteria 5608
24 JGI25153J46596_10027986 3300003215 Bacteria 1963
25 rootH1_10073909 3300003316 Bacteria 1607
26 rootL2_10030130 3300003322 Bacteria 7935
27 rootL2_10212533 3300003322 Bacteria 1758
28 rootH1_10041554 3300003323 Bacteria 1496
29 rootH1_10137828 3300003323 Bacteria 2245
30 JGI25161J50226_1000229 3300003374 Bacteria 34236
31 Ga0006562J51391_1051520 3300003578 Bacteria 1348
32 Ga0055526_1002109 3300003771 Bacteria 13649
33 Ga0055526_1015899 3300003771 Bacteria 2988
34 Ga0055526_1016348 3300003771 Bacteria 2911
35 Ga0055524_1002176 3300003775 Bacteria 10308
36 Ga0055524_1005987 3300003775 Bacteria 5347
37 Ga0055524_1007326 3300003775 Bacteria 4701
38 Ga0055524_1010336 3300003775 Bacteria 3725
39 Ga0055524_1022090 3300003775 Bacteria 2088
40 Ga0055536_1013167 3300003781 Bacteria 3008
41 Ga0055528_1000621 3300003790 Bacteria 26381
42 Ga0055528_1001023 3300003790 Bacteria 18517
43 Ga0055528_1002560 3300003790 Bacteria 9638
44 Ga0055528_1021679 3300003790 Bacteria 2027
45 Ga0055540_1009003 3300003792 Bacteria 3514
46 Ga0055531_10001575 3300003794 Bacteria 16679
47 Ga0055543_1000073 3300004625 Bacteria 88583
48 Ga0065165_1001919 3300005262 Bacteria 19855
49 Ga0065165_1007245 3300005262 Bacteria 5517
50 Ga0070658_10445572 3300005327 Bacteria 1115
51 Ga0070668_100040568 3300005347 Bacteria 3562
52 Ga0070669_100198349 3300005353 Bacteria 1578
53 Ga0070669_100276584 3300005353 Bacteria 1344
54 Ga0070671_100362668 3300005355 Bacteria 1237
55 Ga0070667_100050183 3300005367 Bacteria 3516
56 Ga0070663_100094127 3300005455 Bacteria 2224
57 Ga0070665_100020849 3300005548 Bacteria 6587
58 Ga0070665_100576494 3300005548 Bacteria 1138
59 Ga0068855_100244411 3300005563 Bacteria 2004
60 Ga0068856_100032904 3300005614 Bacteria 5078
61 Ga0075365_10000703 3300006038 Bacteria 13456
62 Ga0075365_10011185 3300006038 Bacteria 5268
63 Ga0075367_10026205 3300006178 Bacteria 3304
64 Ga0075369_10009496 3300006186 Bacteria 3781
65 Ga0075370_10002972 3300006353 Bacteria 7967
66 Ga0105251_10003772 3300009011 Bacteria 10831
67 Ga0105250_10021992 3300009092 Bacteria 2573
68 Ga0105240_10000024 3300009093 Bacteria 375919
69 Ga0105247_10308305 3300009101 Bacteria 1100
70 Ga0105248_10357155 3300009177 Bacteria 1645
71 Ga0105237_10000538 3300009545 Bacteria 53474
72 Ga0105238_10141085 3300009551 Bacteria 2386
73 Ga0105249_10294441 3300009553 Bacteria 1625
74 Ga0123342_1010346 3300009766 Bacteria 10744
75 Ga0105239_10006401 3300010375 Bacteria 13673
76 Ga0105246_10056424 3300011119 Bacteria 2715
77 Ga0157373_10051503 3300013100 Bacteria 2932
78 Ga0157370_10000236 3300013104 Bacteria 70330
79 Ga0157370_10478936 3300013104 Bacteria 1144
80 Ga0157369_10501458 3300013105 Bacteria 1256
81 Ga0182007_10001391 3300015262 Bacteria 13008
82 Ga0182005_1003971 3300015265 Bacteria 4879
83 Ga0228711_1005132 3300022739 Bacteria 19986
84 Ga0228710_1000707 3300022740 Bacteria 45192
85 Ga0209435_100065 3300025206 Bacteria 74485
86 Ga0209436_100113 3300025208 Bacteria 39873
87 Ga0209437_100050 3300025233 Bacteria 394010
88 Ga0209437_100056 3300025233 Bacteria 363071
89 Ga0207425_1000667 3300025245 Bacteria 18861
90 Ga0207425_1001952 3300025245 Bacteria 7748
91 Ga0209646_1000195 3300025246 Bacteria 74485
92 Ga0209026_1000235 3300025250 Bacteria 74485
93 Ga0209677_100283 3300025253 Bacteria 33726
94 Ga0209148_1005844 3300025254 Bacteria 2747
95 Ga0209759_1000268 3300025256 Bacteria 74485
96 Ga0209129_1000066 3300025258 Bacteria 226820
97 Ga0209129_1000308 3300025258 Bacteria 44371
98 Ga0209129_1001258 3300025258 Bacteria 14534
99 Ga0209129_1001686 3300025258 Bacteria 11960
100 Ga0209129_1002211 3300025258 Bacteria 9762
101 Ga0209129_1003581 3300025258 Bacteria 6648
102 Ga0209233_1000037 3300025261 Bacteria 554620
103 Ga0209233_1000071 3300025261 Bacteria 363290
104 Ga0209233_1000236 3300025261 Bacteria 92446
105 Ga0209673_1000024 3300025273 Bacteria 409632
106 Ga0209673_1000988 3300025273 Bacteria 34774
107 Ga0209673_1012006 3300025273 Bacteria 3524
108 Ga0209673_1022767 3300025273 Bacteria 2151
109 Ga0209130_1000002 3300025284 Bacteria 722648
110 Ga0209676_1003075 3300025292 Bacteria 10755
111 Ga0209025_1000557 3300025294 Bacteria 69226
112 Ga0209025_1000919 3300025294 Bacteria 45324
113 Ga0209025_1005917 3300025294 Bacteria 9753
114 Ga0209025_1011699 3300025294 Bacteria 5736
115 Ga0209025_1047454 3300025294 Bacteria 1753
116 Ga0209025_1071418 3300025294 Bacteria 1230
117 Ga0209564_1001614 3300025295 Bacteria 21891
118 Ga0209564_1013176 3300025295 Bacteria 3535
119 Ga0209564_1021801 3300025295 Bacteria 2289
120 Ga0209564_1022131 3300025295 Bacteria 2257
121 Ga0209758_1000170 3300025297 Bacteria 149476
122 Ga0209758_1000788 3300025297 Bacteria 45324
123 Ga0209758_1001309 3300025297 Bacteria 30362
124 Ga0209758_1001640 3300025297 Bacteria 25413
125 Ga0209758_1001755 3300025297 Bacteria 24062
126 Ga0209758_1050105 3300025297 Bacteria 1467
127 Ga0209256_1000667 3300025299 Bacteria 46381
128 Ga0209256_1002512 3300025299 Bacteria 14748
129 Ga0209256_1003658 3300025299 Bacteria 10515
130 Ga0209256_1040436 3300025299 Bacteria 1191
131 Ga0209256_1040456 3300025299 Bacteria 1190
132 Ga0207426_1000013 3300025302 Bacteria 721897
133 Ga0207426_1004269 3300025302 Bacteria 7081
134 Ga0209051_1001851 3300025303 Bacteria 16666
135 Ga0209051_1003586 3300025303 Bacteria 10096
136 Ga0209051_1032507 3300025303 Bacteria 1989
137 Ga0209051_1046830 3300025303 Bacteria 1483
138 Ga0209257_1000940 3300025304 Bacteria 40225
139 Ga0209257_1017921 3300025304 Bacteria 2757
140 Ga0207695_10000036 3300025913 Bacteria 477897
141 Ga0207671_10000191 3300025914 Bacteria 95004
142 Ga0207681_10060086 3300025923 Bacteria 2608
143 Ga0207650_10010837 3300025925 Bacteria 6264
144 Ga0207644_10013131 3300025931 Bacteria 5514
145 Ga0207711_10101638 3300025941 Bacteria 2544
146 Ga0207712_10269552 3300025961 Bacteria 1384
147 Ga0207668_10103374 3300025972 Bacteria 2121
148 Ga0207658_10033957 3300025986 Bacteria 3642
149 Ga0209281_1000272 3300027111 Bacteria 99700
150 Ga0209281_1020807 3300027111 Bacteria 1277
151 Ga0209282_1000055 3300027666 Bacteria 101018
152 Ga0268256_1000924 3300030500 Bacteria 20279
153 Ga0307405_10001811 3300031731 Bacteria 9152
154 Ga0307412_10000589 3300031911 Bacteria 21521
155 Ga0315914_1000695 3300031967 Bacteria 45194
156 Ga0315913_1000019 3300033430 Bacteria 100387
157 Ga0315915_1000023 3300033464 Bacteria 119157
158 Ga0315915_1057582 3300033464 Bacteria 1277
159 Ga0395899_0000222 3300037312 Bacteria 78186
160 Ga0395900_0042160 3300037418 Bacteria 4701
161 Ga0395898_0039045 3300037466 Bacteria 4701
162 Ga0395905_0000252 3300037471 Bacteria 80112
163 Ga0395901_0042699 3300038443 Bacteria 4701
164 Ga0439466_0070638 3300041411 Bacteria 1112
165 Ga0439465_0045503 3300041413 Bacteria 1427
166 Ga0439449_0079491 3300042007 Bacteria 1209
167 Ga0466965_0102170 3300044683 Bacteria 1467
168 Ga0466964_0023666 3300044706 Bacteria 2389
169 Ga0466970_0000899 3300044765 Bacteria 14376
170 Ga0466957_0020242 3300044842 Bacteria 3915
171 Ga0466959_0031263 3300045049 Bacteria 3940
172 Ga0466958_0008016 3300045836 Bacteria 5840
173 Ga0466967_0870746 3300045976 Bacteria 895
174 Ga0495590_0077481 3300046457 Bacteria 1170
175 Ga0495638_0000715 3300046460 Bacteria 35779
176 Ga0495605_0002031 3300046474 Bacteria 12766
177 Ga0495585_0004813 3300046492 Bacteria 8675
178 Ga0495585_0107143 3300046492 Bacteria 1489
179 Ga0495583_0004726 3300046506 Bacteria 9579
180 Ga0495583_0050583 3300046506 Bacteria 1898
181 Ga0495606_0037774 3300046507 Bacteria 3276
182 Ga0495606_0043123 3300046507 Bacteria 3012
183 Ga0495610_0000420 3300046512 Bacteria 43578
184 Ga0495610_0012259 3300046512 Bacteria 5174
185 Ga0495616_0008218 3300046513 Bacteria 6196
186 Ga0495620_0002917 3300046515 Bacteria 9822
187 Ga0495620_0016346 3300046515 Bacteria 3726
188 Ga0495620_0107786 3300046515 Bacteria 1106
189 Ga0495631_0016776 3300046518 Bacteria 3480
190 Ga0495632_0008173 3300046519 Bacteria 6463
191 Ga0495643_0007675 3300046522 Bacteria 6919
192 Ga0495643_0031899 3300046522 Bacteria 2929
193 Ga0495648_0102372 3300046524 Bacteria 1578
194 Ga0495654_0037179 3300046530 Bacteria 2444
195 Ga0495633_0023900 3300046558 Bacteria 3024
196 Ga0495633_0037464 3300046558 Bacteria 2320
197 Ga0495611_0003914 3300046648 Bacteria 6486
198 Ga0495625_0007104 3300046660 Bacteria 9836
199 Ga0495625_0142791 3300046660 Bacteria 1614
200 Ga0495661_0059816 3300046665 Bacteria 2266
201 Ga0495661_0203895 3300046665 Bacteria 1034
202 Ga0495670_0036287 3300046691 Bacteria 2456
203 Ga0495670_0110045 3300046691 Bacteria 1425
204 Ga0495671_0152150 3300046692 Bacteria 1126
205 Ga0495649_0130953 3300046694 Bacteria 1323
206 Ga0495589_0046924 3300046794 Bacteria 2142
207 Ga0495660_0028638 3300046810 Bacteria 3145
208 Ga0495672_0020272 3300047320 Bacteria 4363
209 Ga0495687_003847 3300047443 Bacteria 10566
210 Ga0495673_0025110 3300047469 Bacteria 2867
211 Ga0495686_0011547 3300047472 Bacteria 6220
212 Ga0495626_0153870 3300048091 Bacteria 968
213 Ga0496100_0017321 3300048903 Bacteria 4250
214 Ga0496101_0032483 3300048904 Bacteria 3675
215 Ga0496101_0221616 3300048904 Bacteria 1468
216 Ga0496102_0003747 3300048905 Bacteria 12848
217 Ga0496102_0085089 3300048905 Bacteria 2919
218 Ga0496103_0006157 3300048906 Bacteria 7169
219 Ga0496103_0068416 3300048906 Bacteria 2219
220 Ga0496104_0121098 3300048907 Bacteria 2512
221 Ga0496104_0497432 3300048907 Bacteria 1130
222 Ga0496105_0110736 3300048908 Bacteria 2266
223 Ga0496106_0303293 3300048909 Bacteria 1281
224 Ga0496108_0140327 3300048911 Bacteria 2082
225 Ga0496109_0236262 3300048912 Bacteria 1720
226 Ga0496110_0050452 3300048913 Bacteria 3653
227 Ga0496111_0104061 3300048914 Bacteria 2088
228 Ga0496113_0332405 3300048916 Bacteria 1218
229 Ga0496114_0188833 3300048917 Bacteria 1802
230 Ga0496116_0005337 3300048919 Bacteria 11976
231 Ga0496116_0011026 3300048919 Bacteria 7519
232 Ga0496116_0041539 3300048919 Bacteria 3154
233 Ga0496116_0045498 3300048919 Bacteria 2970
234 Ga0496117_0004333 3300048920 Bacteria 15776
235 Ga0496117_0016642 3300048920 Bacteria 6190
236 Ga0496118_0002241 3300048921 Bacteria 26613
237 Ga0496118_0008765 3300048921 Bacteria 10372
238 Ga0496118_0014043 3300048921 Bacteria 7520
239 Ga0496118_0099600 3300048921 Bacteria 1969
240 Ga0496119_0004802 3300048922 Bacteria 13265
241 Ga0496119_0064535 3300048922 Bacteria 2174
242 Ga0496120_0104017 3300048923 Bacteria 1495
243 Ga0496121_0002565 3300048924 Bacteria 27503
244 Ga0496121_0003993 3300048924 Bacteria 20349
245 Ga0496121_0012014 3300048924 Bacteria 9517
246 Ga0496121_0029874 3300048924 Bacteria 5021
247 Ga0496121_0132392 3300048924 Bacteria 1863
248 Ga0496121_0159967 3300048924 Bacteria 1648
249 Ga0496121_0217492 3300048924 Bacteria 1348
250 Ga0496122_0000018 3300048925 Bacteria 426350
251 Ga0496122_0003928 3300048925 Bacteria 19013
252 Ga0496122_0005948 3300048925 Bacteria 14284
253 Ga0496122_0012997 3300048925 Bacteria 8207
254 Ga0496122_0026877 3300048925 Bacteria 4942
255 Ga0496122_0036564 3300048925 Bacteria 3967
256 Ga0496122_0069508 3300048925 Bacteria 2521
257 Ga0496122_0084940 3300048925 Bacteria 2186
258 Ga0496122_0140787 3300048925 Bacteria 1509
259 Ga0496122_0179588 3300048925 Bacteria 1264
260 Ga0496123_0000015 3300048926 Bacteria 426088
261 Ga0496123_0004431 3300048926 Bacteria 14767
262 Ga0496123_0024302 3300048926 Bacteria 4609
263 Ga0496123_0031405 3300048926 Bacteria 3865
264 Ga0496123_0043798 3300048926 Bacteria 3069
265 Ga0496123_0107757 3300048926 Bacteria 1602
266 Ga0496124_0001760 3300048927 Bacteria 30205
267 Ga0496124_0012934 3300048927 Bacteria 8185
268 Ga0496124_0013038 3300048927 Bacteria 8145
269 Ga0496124_0024409 3300048927 Bacteria 5497
270 Ga0496124_0031786 3300048927 Bacteria 4668
271 Ga0496124_0045444 3300048927 Bacteria 3764
272 Ga0496124_0047296 3300048927 Bacteria 3681
273 Ga0496124_0047498 3300048927 Bacteria 3672
274 Ga0496124_0067330 3300048927 Bacteria 2980
275 Ga0496124_0095592 3300048927 Bacteria 2415
276 Ga0496124_0207182 3300048927 Bacteria 1486
277 Ga0496124_0208032 3300048927 Bacteria 1483
278 Ga0496125_0005315 3300048928 Bacteria 14395
279 Ga0496125_0007832 3300048928 Bacteria 11292
280 Ga0496125_0040047 3300048928 Bacteria 4024
281 Ga0496125_0183301 3300048928 Bacteria 1392
282 Ga0496126_0038878 3300048929 Bacteria 4422
283 Ga0496126_0077481 3300048929 Bacteria 2947
284 Ga0496126_0085766 3300048929 Bacteria 2775
285 Ga0496126_0292189 3300048929 Bacteria 1347
286 Ga0496126_0395893 3300048929 Bacteria 1121
287 Ga0495678_009305 3300049459 Bacteria 4874
288 Ga0495678_032581 3300049459 Bacteria 2158
289 Ga0501031_0177415 3300049568 Bacteria 1392
290 Ga0501032_0047656 3300049569 Bacteria 2894
291 Ga0501037_0053119 3300049573 Bacteria 2963
292 Ga0501038_0008267 3300049574 Bacteria 9576
293 Ga0501039_0030264 3300049575 Bacteria 4174
294 Ga0501047_0179626 3300049581 Bacteria 1983
295 Ga0501080_0107760 3300049742 Bacteria 2582
296 Ga0501035_0063419 3300049822 Bacteria 3287
297 Ga0501044_0111209 3300049823 Bacteria 2747
298 nmdc:mga03n38_258562_c1 3300050490 Bacteria 922
299 nmdc:mga0yw44_2967_c1 3300050492 Bacteria 7394
300 nmdc:mga06z11_230783_c1 3300050494 Bacteria 1084
301 Ga0500557_007412 3300053105 Bacteria 2559
302 Ga0500569_000477 3300053109 Bacteria 6620
303 Ga0500618_000890 3300053125 Bacteria 15788
304 Ga0500618_002061 3300053125 Bacteria 8096
305 Ga0500568_0004234 3300053139 Bacteria 7720
306 Ga0500568_0031699 3300053139 Bacteria 2179
307 Ga0500616_0000652 3300053153 Bacteria 41596
308 Ga0500616_0020749 3300053153 Bacteria 3689
309 Ga0500622_0003044 3300053156 Bacteria 11581
310 Ga0500627_0037675 3300053158 Bacteria 2064
311 Ga0587088_002325 3300059508 Bacteria 2145
312 Ga0587114_001383 3300059655 Bacteria 2021
313 Ga0466962_0176472 3300061719 Bacteria 1041

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2585427634 2586003149 235
2 3300003316 rootH1_10073909 rootH1_100739091 238
3 3300059655 Ga0587114_001383 Ga0587114_001383_1165_1881 238
4 3300003215 JGI25153J46596_10027986 JGI25153J46596_100279862 239
5 3300003781 Ga0055536_1013167 Ga0055536_10131673 239
6 3300003794 Ga0055531_10001575 Ga0055531_100015754 239
7 3300025297 Ga0209758_1000170 Ga0209758_1000170131 239
8 3300025304 Ga0209257_1000940 Ga0209257_10009409 239
9 3300053153 Ga0500616_0000652 Ga0500616_0000652_36378_37118 239
10 iso_pu_bacteria 8055431914 8055433679 239
11 3300006186 Ga0075369_10009496 Ga0075369_100094962 242
12 3300009766 Ga0123342_1010346 Ga0123342_10103462 242
13 iso_pu_bacteria 2510917026 2511172124 246
14 iso_pu_bacteria 2582581294 2585201135 247
15 3300046457 Ga0495590_0077481 Ga0495590_0077481_273_1028 248
16 3300046474 Ga0495605_0002031 Ga0495605_0002031_6751_7506 248
17 3300046492 Ga0495585_0004813 Ga0495585_0004813_5059_5814 248
18 3300046506 Ga0495583_0050583 Ga0495583_0050583_56_811 248
19 3300046513 Ga0495616_0008218 Ga0495616_0008218_3905_4660 248
20 3300046530 Ga0495654_0037179 Ga0495654_0037179_1463_2218 248
21 3300046648 Ga0495611_0003914 Ga0495611_0003914_1096_1851 248
22 3300046691 Ga0495670_0036287 Ga0495670_0036287_1460_2215 248
23 3300046810 Ga0495660_0028638 Ga0495660_0028638_768_1523 248
24 3300005455 Ga0070663_100094127 Ga0070663_1000941272 250
25 3300009011 Ga0105251_10003772 Ga0105251_100037727 250
26 3300009092 Ga0105250_10021992 Ga0105250_100219922 250
27 3300009177 Ga0105248_10357155 Ga0105248_103571552 250
28 3300009553 Ga0105249_10294441 Ga0105249_102944412 250
29 3300011119 Ga0105246_10056424 Ga0105246_100564242 250
30 3300025294 Ga0209025_1047454 Ga0209025_10474542 250
31 3300048904 Ga0496101_0221616 Ga0496101_0221616_161_922 250
32 3300048905 Ga0496102_0085089 Ga0496102_0085089_472_1233 250
33 3300048906 Ga0496103_0068416 Ga0496103_0068416_980_1741 250
34 3300048907 Ga0496104_0121098 Ga0496104_0121098_524_1285 250
35 3300048908 Ga0496105_0110736 Ga0496105_0110736_1069_1830 250
36 3300048911 Ga0496108_0140327 Ga0496108_0140327_937_1698 250
37 3300048912 Ga0496109_0236262 Ga0496109_0236262_618_1379 250
38 3300048913 Ga0496110_0050452 Ga0496110_0050452_520_1281 250
39 3300048914 Ga0496111_0104061 Ga0496111_0104061_1039_1800 250
40 3300048917 Ga0496114_0188833 Ga0496114_0188833_528_1289 250
41 3300048919 Ga0496116_0041539 Ga0496116_0041539_1816_2577 250
42 3300048922 Ga0496119_0064535 Ga0496119_0064535_799_1560 250
43 3300048923 Ga0496120_0104017 Ga0496120_0104017_293_1054 250
44 3300048924 Ga0496121_0159967 Ga0496121_0159967_781_1542 250
45 3300048925 Ga0496122_0140787 Ga0496122_0140787_503_1264 250
46 3300048926 Ga0496123_0107757 Ga0496123_0107757_140_901 250
47 3300048927 Ga0496124_0207182 Ga0496124_0207182_167_928 250
48 3300048928 Ga0496125_0040047 Ga0496125_0040047_2384_3145 250
49 3300048929 Ga0496126_0395893 Ga0496126_0395893_116_877 250
50 3300050494 nmdc:mga06z11_230783_c1 nmdc:mga06z11_230783_c1_41_802 250
51 3300006038 Ga0075365_10000703 Ga0075365_1000070311 252
52 iso_pu_bacteria 2657244999 2657684165 252
53 iso_pu_bacteria 2791355082 2792581060 252
54 iso_pu_bacteria 8049293176 8049298448 252
55 3300048929 Ga0496126_0077481 Ga0496126_0077481_813_1613 253
56 3300050490 nmdc:mga03n38_258562_c1 nmdc:mga03n38_258562_c1_37_837 253
57 iso_pu_bacteria 2854681122 2854685046 253
58 iso_pu_bacteria 2599185156 2599332467 254
59 iso_pu_bacteria 2842922631 2842922737 254
60 iso_pu_bacteria 2791355091 2792621375 255
61 iso_pu_bacteria 2791355092 2792627938 255
62 iso_pu_bacteria 643692032 643692254 255
63 iso_pu_bacteria 2516143018 2516206326 256
64 3300025297 Ga0209758_1050105 Ga0209758_10501051 257
65 iso_pu_bacteria 2510917028 2511185763 257
66 iso_pu_bacteria 2513237088 2513595378 257
67 iso_pu_bacteria 2513237138 2513866518 257
68 iso_pu_bacteria 2534681796 2535514718 257
69 iso_pu_bacteria 2582581867 2585398944 257
70 iso_pu_bacteria 2585427590 2585818935 257
71 iso_pu_bacteria 2600254933 2600376643 257
72 iso_pu_bacteria 2854896431 2854900679 257
73 iso_pu_bacteria 2854916844 2854919625 257
74 iso_pu_bacteria 2915980308 2915983545 257
75 iso_pu_bacteria 2916061851 2916063186 257
76 iso_pu_bacteria 2921250672 2921252309 257
77 iso_pu_bacteria 2923556063 2923556328 257
78 iso_pu_bacteria 2996887358 2996888132 257
79 iso_pu_bacteria 8005258706 8005261316 257
80 iso_pu_bacteria 8005321885 8005322659 257
81 iso_pu_bacteria 8005542996 8005543388 257
82 iso_pu_bacteria 2512875026 2512975533 258
83 iso_pu_bacteria 2513237089 2513605816 258
84 iso_pu_bacteria 2513237144 2513911370 258
85 iso_pu_bacteria 2513237146 2513924434 258
86 iso_pu_bacteria 2513237156 2513986344 258
87 iso_pu_bacteria 2513237160 2514006884 258
88 iso_pu_bacteria 2517487022 2517567124 258
89 iso_pu_bacteria 2582581299 2585232420 258
90 iso_pu_bacteria 2582581304 2585256266 258
91 iso_pu_bacteria 2585427594 2585843861 258
92 iso_pu_bacteria 2585427633 2585998611 258
93 iso_pu_bacteria 2599185170 2599419604 258
94 iso_pu_bacteria 2643221634 2644196928 258
95 iso_pu_bacteria 2690316117 2692314931 258
96 iso_pu_bacteria 2738541293 2738800933 258
97 iso_pu_bacteria 2791355094 2792639569 258
98 iso_pu_bacteria 2802428858 2802720926 258
99 iso_pu_bacteria 2802428859 2802727417 258
100 iso_pu_bacteria 2802428860 2802733384 258
101 iso_pu_bacteria 2802428861 2802740221 258
102 iso_pu_bacteria 2802428862 2802746438 258
103 iso_pu_bacteria 2802428863 2802753297 258
104 iso_pu_bacteria 2838035591 2838039861 258
105 iso_pu_bacteria 2838074704 2838075576 258
106 iso_pu_bacteria 2838074704 2838081038 258
107 iso_pu_bacteria 2838661181 2838664145 258
108 iso_pu_bacteria 2847417321 2847420013 258
109 iso_pu_bacteria 2848992105 2848994957 258
110 iso_pu_bacteria 2848992105 2848997169 258
111 iso_pu_bacteria 2855872281 2855872282 258
112 iso_pu_bacteria 2896384573 2896388860 258
113 iso_pu_bacteria 2919171160 2919172350 258
114 iso_pu_bacteria 2920760137 2920764260 258
115 iso_pu_bacteria 2933016740 2933018768 258
116 iso_pu_bacteria 2937029754 2937032076 258
117 iso_pu_bacteria 2937036028 2937042729 258
118 iso_pu_bacteria 2937078374 2937081448 258
119 iso_pu_bacteria 2937084907 2937086970 258
120 iso_pu_bacteria 2957375807 2957375911 258
121 iso_pu_bacteria 2957437181 2957442345 258
122 iso_pu_bacteria 2960591022 2960593934 258
123 iso_pu_bacteria 2960631154 2960635692 258
124 iso_pu_bacteria 2960680706 2960683071 258
125 iso_pu_bacteria 2960693952 2960700848 258
126 iso_pu_bacteria 2967686174 2967692606 258
127 iso_pu_bacteria 2967728569 2967730125 258
128 iso_pu_bacteria 2970026789 2970027709 258
129 iso_pu_bacteria 2970122695 2970127815 258
130 iso_pu_bacteria 2970143518 2970147449 258
131 iso_pu_bacteria 2977530762 2977533651 258
132 iso_pu_bacteria 2977544691 2977545713 258
133 iso_pu_bacteria 3005409236 3005410780 258
134 iso_pu_bacteria 3005445848 3005450227 258
135 iso_pu_bacteria 8003999396 8004005714 258
136 3300053125 Ga0500618_000890 Ga0500618_000890_10271_11086 259
137 iso_pu_bacteria 2643221599 2644004561 259
138 iso_pu_bacteria 8056875544 8056878786 259
139 3300006038 Ga0075365_10011185 Ga0075365_100111853 260
140 3300025292 Ga0209676_1003075 Ga0209676_10030755 260
141 3300025303 Ga0209051_1001851 Ga0209051_100185110 260
142 3300046524 Ga0495648_0102372 Ga0495648_0102372_449_1297 260
143 3300050492 nmdc:mga0yw44_2967_c1 nmdc:mga0yw44_2967_c1_1302_2129 260
144 iso_pu_bacteria 2510917022 2511137110 260
145 iso_pu_bacteria 2524023209 2524458057 260
146 iso_pu_bacteria 2582581307 2585273637 260
147 iso_pu_bacteria 2582581308 2585279942 260
148 iso_pu_bacteria 2582581315 2585326281 260
149 iso_pu_bacteria 2585427527 2585533804 260
150 iso_pu_bacteria 2585427530 2585553397 260
151 iso_pu_bacteria 2585427531 2585559811 260
152 iso_pu_bacteria 2585427609 2585906011 260
153 iso_pu_bacteria 2585428125 2587978874 260
154 iso_pu_bacteria 2615840626 2616309420 260
155 iso_pu_bacteria 2615840698 2616556250 260
156 iso_pu_bacteria 2617270742 2617380551 260
157 iso_pu_bacteria 2667528174 2671113969 260
158 iso_pu_bacteria 2775507266 2778173866 260
159 iso_pu_bacteria 2818991448 2819608709 260
160 iso_pu_bacteria 2818991453 2819640817 260
161 iso_pu_bacteria 2838029111 2838029597 260
162 iso_pu_bacteria 2842298080 2842299760 260
163 iso_pu_bacteria 2842357229 2842359718 260
164 iso_pu_bacteria 2842475841 2842475973 260
165 iso_pu_bacteria 2842502639 2842503125 260
166 iso_pu_bacteria 2842509118 2842512989 260
167 iso_pu_bacteria 2919408235 2919408490 260
168 iso_pu_bacteria 3005416602 3005423119 260
169 iso_pu_bacteria 8005314921 8005315446 260
170 iso_pu_bacteria 8005484373 8005484645 260
171 iso_pu_bacteria 8005645114 8005649335 260
172 iso_pu_bacteria 8005682033 8005685425 260
173 3300002773 JGI25152J39213_1001826 JGI25152J39213_10018264 261
174 3300003771 Ga0055526_1015899 Ga0055526_10158992 261
175 3300003775 Ga0055524_1007326 Ga0055524_10073262 261
176 3300003775 Ga0055524_1022090 Ga0055524_10220902 261
177 3300003790 Ga0055528_1021679 Ga0055528_10216792 261
178 3300005262 Ga0065165_1001919 Ga0065165_10019193 261
179 3300005347 Ga0070668_100040568 Ga0070668_1000405681 261
180 3300005355 Ga0070671_100362668 Ga0070671_1003626682 261
181 3300005548 Ga0070665_100020849 Ga0070665_1000208497 261
182 3300006178 Ga0075367_10026205 Ga0075367_100262052 261
183 3300013100 Ga0157373_10051503 Ga0157373_100515034 261
184 3300013105 Ga0157369_10501458 Ga0157369_105014582 261
185 3300025258 Ga0209129_1003581 Ga0209129_10035815 261
186 3300025273 Ga0209673_1022767 Ga0209673_10227672 261
187 3300025294 Ga0209025_1071418 Ga0209025_10714182 261
188 3300025295 Ga0209564_1021801 Ga0209564_10218012 261
189 3300025295 Ga0209564_1022131 Ga0209564_10221312 261
190 3300025299 Ga0209256_1040436 Ga0209256_10404362 261
191 3300025299 Ga0209256_1040456 Ga0209256_10404562 261
192 3300025302 Ga0207426_1004269 Ga0207426_10042696 261
193 3300025303 Ga0209051_1032507 Ga0209051_10325072 261
194 3300025931 Ga0207644_10013131 Ga0207644_100131314 261
195 3300025941 Ga0207711_10101638 Ga0207711_101016382 261
196 3300025961 Ga0207712_10269552 Ga0207712_102695522 261
197 3300025972 Ga0207668_10103374 Ga0207668_101033742 261
198 3300037312 Ga0395899_0000222 Ga0395899_0000222_40675_41514 261
199 3300037418 Ga0395900_0042160 Ga0395900_0042160_3210_4049 261
200 3300037466 Ga0395898_0039045 Ga0395898_0039045_3210_4049 261
201 3300037471 Ga0395905_0000252 Ga0395905_0000252_42556_43395 261
202 3300038443 Ga0395901_0042699 Ga0395901_0042699_3210_4049 261
203 3300044683 Ga0466965_0102170 Ga0466965_0102170_33_857 261
204 3300048925 Ga0496122_0000018 Ga0496122_0000018_178792_179625 261
205 3300048926 Ga0496123_0000015 Ga0496123_0000015_178792_179625 261
206 3300048927 Ga0496124_0024409 Ga0496124_0024409_3079_3912 261
207 3300048927 Ga0496124_0208032 Ga0496124_0208032_481_1278 261
208 3300002773 JGI25152J39213_1000599 JGI25152J39213_10005996 262
209 3300002773 JGI25152J39213_1000743 JGI25152J39213_10007432 262
210 3300002773 JGI25152J39213_1002555 JGI25152J39213_10025554 262
211 3300002773 JGI25152J39213_1003276 JGI25152J39213_10032764 262
212 3300002773 JGI25152J39213_1006774 JGI25152J39213_10067741 262
213 3300002774 JGI25150J39212_1000133 JGI25150J39212_100013316 262
214 3300002774 JGI25150J39212_1004716 JGI25150J39212_10047162 262
215 3300003187 JGI25151J46595_10000407 JGI25151J46595_1000040726 262
216 3300003187 JGI25151J46595_10009343 JGI25151J46595_100093432 262
217 3300003187 JGI25151J46595_10041819 JGI25151J46595_100418191 262
218 3300003215 JGI25153J46596_10001632 JGI25153J46596_1000163212 262
219 3300003215 JGI25153J46596_10005199 JGI25153J46596_100051995 262
220 3300003215 JGI25153J46596_10007022 JGI25153J46596_100070224 262
221 3300003322 rootL2_10212533 rootL2_102125332 262
222 3300003323 rootH1_10041554 rootH1_100415542 262
223 3300003374 JGI25161J50226_1000229 JGI25161J50226_100022938 262
224 3300003578 Ga0006562J51391_1051520 Ga0006562J51391_10515201 262
225 3300003771 Ga0055526_1002109 Ga0055526_10021098 262
226 3300003771 Ga0055526_1016348 Ga0055526_10163482 262
227 3300003775 Ga0055524_1002176 Ga0055524_10021765 262
228 3300003775 Ga0055524_1005987 Ga0055524_10059875 262
229 3300003775 Ga0055524_1010336 Ga0055524_10103362 262
230 3300003790 Ga0055528_1000621 Ga0055528_10006212 262
231 3300003790 Ga0055528_1001023 Ga0055528_100102314 262
232 3300003790 Ga0055528_1002560 Ga0055528_10025604 262
233 3300003792 Ga0055540_1009003 Ga0055540_10090032 262
234 3300004625 Ga0055543_1000073 Ga0055543_100007338 262
235 3300005262 Ga0065165_1007245 Ga0065165_10072452 262
236 3300005353 Ga0070669_100198349 Ga0070669_1001983492 262
237 3300005353 Ga0070669_100276584 Ga0070669_1002765841 262
238 3300005548 Ga0070665_100576494 Ga0070665_1005764942 262
239 3300013104 Ga0157370_10478936 Ga0157370_104789361 262
240 3300022739 Ga0228711_1005132 Ga0228711_100513210 262
241 3300022740 Ga0228710_1000707 Ga0228710_100070723 262
242 3300025208 Ga0209436_100113 Ga0209436_1001136 262
243 3300025245 Ga0207425_1000667 Ga0207425_100066717 262
244 3300025245 Ga0207425_1001952 Ga0207425_10019525 262
245 3300025258 Ga0209129_1000066 Ga0209129_100006625 262
246 3300025258 Ga0209129_1000308 Ga0209129_100030826 262
247 3300025258 Ga0209129_1001258 Ga0209129_100125812 262
248 3300025258 Ga0209129_1001686 Ga0209129_10016866 262
249 3300025258 Ga0209129_1002211 Ga0209129_10022115 262
250 3300025273 Ga0209673_1000024 Ga0209673_1000024233 262
251 3300025273 Ga0209673_1000988 Ga0209673_10009882 262
252 3300025273 Ga0209673_1012006 Ga0209673_10120063 262
253 3300025284 Ga0209130_1000002 Ga0209130_1000002445 262
254 3300025294 Ga0209025_1000557 Ga0209025_100055769 262
255 3300025294 Ga0209025_1000919 Ga0209025_100091917 262
256 3300025294 Ga0209025_1005917 Ga0209025_10059177 262
257 3300025294 Ga0209025_1011699 Ga0209025_10116995 262
258 3300025295 Ga0209564_1001614 Ga0209564_10016142 262
259 3300025295 Ga0209564_1013176 Ga0209564_10131762 262
260 3300025297 Ga0209758_1000788 Ga0209758_100078817 262
261 3300025297 Ga0209758_1001309 Ga0209758_100130925 262
262 3300025297 Ga0209758_1001640 Ga0209758_100164019 262
263 3300025297 Ga0209758_1001755 Ga0209758_100175518 262
264 3300025299 Ga0209256_1000667 Ga0209256_10006678 262
265 3300025299 Ga0209256_1002512 Ga0209256_100251221 262
266 3300025299 Ga0209256_1003658 Ga0209256_10036582 262
267 3300025302 Ga0207426_1000013 Ga0207426_1000013445 262
268 3300025303 Ga0209051_1003586 Ga0209051_10035862 262
269 3300025303 Ga0209051_1046830 Ga0209051_10468302 262
270 3300025304 Ga0209257_1017921 Ga0209257_10179213 262
271 3300025923 Ga0207681_10060086 Ga0207681_100600863 262
272 3300027111 Ga0209281_1000272 Ga0209281_100027287 262
273 3300027111 Ga0209281_1020807 Ga0209281_10208072 262
274 3300027666 Ga0209282_1000055 Ga0209282_100005588 262
275 3300031731 Ga0307405_10001811 Ga0307405_100018112 262
276 3300031911 Ga0307412_10000589 Ga0307412_1000058915 262
277 3300031967 Ga0315914_1000695 Ga0315914_100069526 262
278 3300033430 Ga0315913_1000019 Ga0315913_100001986 262
279 3300033464 Ga0315915_1000023 Ga0315915_1000023110 262
280 3300033464 Ga0315915_1057582 Ga0315915_10575822 262
281 3300041411 Ga0439466_0070638 Ga0439466_0070638_202_1002 262
282 3300041413 Ga0439465_0045503 Ga0439465_0045503_189_986 262
283 3300042007 Ga0439449_0079491 Ga0439449_0079491_105_905 262
284 3300046460 Ga0495638_0000715 Ga0495638_0000715_17048_17845 262
285 3300046492 Ga0495585_0107143 Ga0495585_0107143_345_1142 262
286 3300046506 Ga0495583_0004726 Ga0495583_0004726_5699_6496 262
287 3300046507 Ga0495606_0037774 Ga0495606_0037774_340_1137 262
288 3300046507 Ga0495606_0043123 Ga0495606_0043123_793_1590 262
289 3300046512 Ga0495610_0000420 Ga0495610_0000420_5886_6683 262
290 3300046512 Ga0495610_0012259 Ga0495610_0012259_3046_3894 262
291 3300046515 Ga0495620_0002917 Ga0495620_0002917_5916_6713 262
292 3300046515 Ga0495620_0016346 Ga0495620_0016346_1202_1999 262
293 3300046515 Ga0495620_0107786 Ga0495620_0107786_279_1076 262
294 3300046518 Ga0495631_0016776 Ga0495631_0016776_1502_2299 262
295 3300046519 Ga0495632_0008173 Ga0495632_0008173_1473_2270 262
296 3300046522 Ga0495643_0007675 Ga0495643_0007675_2304_3152 262
297 3300046522 Ga0495643_0031899 Ga0495643_0031899_976_1773 262
298 3300046558 Ga0495633_0023900 Ga0495633_0023900_95_892 262
299 3300046558 Ga0495633_0037464 Ga0495633_0037464_320_1117 262
300 3300046660 Ga0495625_0007104 Ga0495625_0007104_1419_2216 262
301 3300046660 Ga0495625_0142791 Ga0495625_0142791_18_815 262
302 3300046665 Ga0495661_0059816 Ga0495661_0059816_990_1787 262
303 3300046665 Ga0495661_0203895 Ga0495661_0203895_196_993 262
304 3300046691 Ga0495670_0110045 Ga0495670_0110045_405_1202 262
305 3300046692 Ga0495671_0152150 Ga0495671_0152150_164_961 262
306 3300046694 Ga0495649_0130953 Ga0495649_0130953_137_985 262
307 3300046794 Ga0495589_0046924 Ga0495589_0046924_600_1397 262
308 3300047320 Ga0495672_0020272 Ga0495672_0020272_1587_2384 262
309 3300047443 Ga0495687_003847 Ga0495687_003847_4855_5652 262
310 3300047469 Ga0495673_0025110 Ga0495673_0025110_409_1206 262
311 3300047472 Ga0495686_0011547 Ga0495686_0011547_4755_5552 262
312 3300048091 Ga0495626_0153870 Ga0495626_0153870_158_955 262
313 3300048904 Ga0496101_0032483 Ga0496101_0032483_1132_1929 262
314 3300048919 Ga0496116_0005337 Ga0496116_0005337_4512_5309 262
315 3300048919 Ga0496116_0011026 Ga0496116_0011026_2454_3251 262
316 3300048919 Ga0496116_0045498 Ga0496116_0045498_45_893 262
317 3300048920 Ga0496117_0016642 Ga0496117_0016642_925_1722 262
318 3300048921 Ga0496118_0008765 Ga0496118_0008765_5955_6803 262
319 3300048921 Ga0496118_0014043 Ga0496118_0014043_5538_6335 262
320 3300048921 Ga0496118_0099600 Ga0496118_0099600_524_1321 262
321 3300048924 Ga0496121_0003993 Ga0496121_0003993_13034_13831 262
322 3300048924 Ga0496121_0012014 Ga0496121_0012014_1901_2698 262
323 3300048924 Ga0496121_0029874 Ga0496121_0029874_2279_3127 262
324 3300048924 Ga0496121_0132392 Ga0496121_0132392_466_1263 262
325 3300048924 Ga0496121_0217492 Ga0496121_0217492_320_1117 262
326 3300048925 Ga0496122_0005948 Ga0496122_0005948_12719_13516 262
327 3300048925 Ga0496122_0012997 Ga0496122_0012997_3868_4665 262
328 3300048925 Ga0496122_0026877 Ga0496122_0026877_278_1075 262
329 3300048925 Ga0496122_0036564 Ga0496122_0036564_57_905 262
330 3300048925 Ga0496122_0069508 Ga0496122_0069508_22_819 262
331 3300048925 Ga0496122_0179588 Ga0496122_0179588_203_1000 262
332 3300048926 Ga0496123_0024302 Ga0496123_0024302_1350_2147 262
333 3300048926 Ga0496123_0031405 Ga0496123_0031405_912_1760 262
334 3300048927 Ga0496124_0001760 Ga0496124_0001760_10384_11181 262
335 3300048927 Ga0496124_0013038 Ga0496124_0013038_3543_4340 262
336 3300048927 Ga0496124_0045444 Ga0496124_0045444_1344_2141 262
337 3300048927 Ga0496124_0047296 Ga0496124_0047296_2114_2962 262
338 3300048927 Ga0496124_0047498 Ga0496124_0047498_2709_3506 262
339 3300048927 Ga0496124_0067330 Ga0496124_0067330_1299_2096 262
340 3300048927 Ga0496124_0095592 Ga0496124_0095592_146_943 262
341 3300048928 Ga0496125_0007832 Ga0496125_0007832_6546_7343 262
342 3300048929 Ga0496126_0038878 Ga0496126_0038878_466_1263 262
343 3300048929 Ga0496126_0292189 Ga0496126_0292189_456_1253 262
344 3300049459 Ga0495678_009305 Ga0495678_009305_1483_2280 262
345 3300049459 Ga0495678_032581 Ga0495678_032581_530_1327 262
346 3300049568 Ga0501031_0177415 Ga0501031_0177415_179_976 262
347 3300049569 Ga0501032_0047656 Ga0501032_0047656_697_1494 262
348 3300049573 Ga0501037_0053119 Ga0501037_0053119_786_1583 262
349 3300049574 Ga0501038_0008267 Ga0501038_0008267_6512_7309 262
350 3300049575 Ga0501039_0030264 Ga0501039_0030264_2198_2995 262
351 3300049581 Ga0501047_0179626 Ga0501047_0179626_687_1484 262
352 3300049742 Ga0501080_0107760 Ga0501080_0107760_590_1387 262
353 3300049822 Ga0501035_0063419 Ga0501035_0063419_228_1025 262
354 3300049823 Ga0501044_0111209 Ga0501044_0111209_1149_1946 262
355 3300053105 Ga0500557_007412 Ga0500557_007412_1459_2256 262
356 3300053109 Ga0500569_000477 Ga0500569_000477_4396_5193 262
357 3300053139 Ga0500568_0004234 Ga0500568_0004234_5231_6028 262
358 3300053139 Ga0500568_0031699 Ga0500568_0031699_829_1677 262
359 3300053153 Ga0500616_0020749 Ga0500616_0020749_2404_3201 262
360 3300053156 Ga0500622_0003044 Ga0500622_0003044_9401_10249 262
361 3300053158 Ga0500627_0037675 Ga0500627_0037675_264_1061 262
362 3300059508 Ga0587088_002325 Ga0587088_002325_86_883 262
363 iso_pu_bacteria 2802429268 2804754127 262
364 iso_pu_bacteria 2919100787 2919101718 262
365 3300001979 JGI24740J21852_10004259 JGI24740J21852_100042596 264
366 3300002704 JGI25155J39150_1000054 JGI25155J39150_100005464 264
367 3300002705 JGI25156J39149_1000238 JGI25156J39149_100023822 264
368 3300002737 JGI25162J39368_1000244 JGI25162J39368_100024444 264
369 3300002737 JGI25162J39368_1001901 JGI25162J39368_10019018 264
370 3300002738 JGI25154J39366_1000104 JGI25154J39366_100010464 264
371 3300002741 JGI25157J39369_1000270 JGI25157J39369_100027022 264
372 3300003214 JGI25165J46597_1000485 JGI25165J46597_10004857 264
373 3300003214 JGI25165J46597_1000607 JGI25165J46597_10006075 264
374 3300003322 rootL2_10030130 rootL2_100301309 264
375 3300003323 rootH1_10137828 rootH1_101378282 264
376 3300005327 Ga0070658_10445572 Ga0070658_104455722 264
377 3300005367 Ga0070667_100050183 Ga0070667_1000501834 264
378 3300005563 Ga0068855_100244411 Ga0068855_1002444113 264
379 3300005614 Ga0068856_100032904 Ga0068856_1000329045 264
380 3300006353 Ga0075370_10002972 Ga0075370_100029727 264
381 3300009093 Ga0105240_10000024 Ga0105240_10000024186 264
382 3300009101 Ga0105247_10308305 Ga0105247_103083051 264
383 3300009545 Ga0105237_10000538 Ga0105237_1000053813 264
384 3300009551 Ga0105238_10141085 Ga0105238_101410853 264
385 3300010375 Ga0105239_10006401 Ga0105239_100064014 264
386 3300013104 Ga0157370_10000236 Ga0157370_1000023662 264
387 3300015262 Ga0182007_10001391 Ga0182007_100013919 264
388 3300015265 Ga0182005_1003971 Ga0182005_10039714 264
389 3300025206 Ga0209435_100065 Ga0209435_10006522 264
390 3300025233 Ga0209437_100050 Ga0209437_100050238 264
391 3300025233 Ga0209437_100056 Ga0209437_100056274 264
392 3300025246 Ga0209646_1000195 Ga0209646_100019562 264
393 3300025250 Ga0209026_1000235 Ga0209026_100023562 264
394 3300025253 Ga0209677_100283 Ga0209677_10028315 264
395 3300025254 Ga0209148_1005844 Ga0209148_10058442 264
396 3300025256 Ga0209759_1000268 Ga0209759_100026822 264
397 3300025261 Ga0209233_1000037 Ga0209233_1000037280 264
398 3300025261 Ga0209233_1000071 Ga0209233_1000071274 264
399 3300025261 Ga0209233_1000236 Ga0209233_100023686 264
400 3300025913 Ga0207695_10000036 Ga0207695_10000036255 264
401 3300025914 Ga0207671_10000191 Ga0207671_1000019116 264
402 3300025925 Ga0207650_10010837 Ga0207650_100108375 264
403 3300025986 Ga0207658_10033957 Ga0207658_100339573 264
404 3300030500 Ga0268256_1000924 Ga0268256_10009242 264
405 3300044706 Ga0466964_0023666 Ga0466964_0023666_165_959 264
406 3300044765 Ga0466970_0000899 Ga0466970_0000899_9881_10675 264
407 3300044842 Ga0466957_0020242 Ga0466957_0020242_688_1482 264
408 3300045049 Ga0466959_0031263 Ga0466959_0031263_190_984 264
409 3300045836 Ga0466958_0008016 Ga0466958_0008016_4985_5779 264
410 3300045976 Ga0466967_0870746 Ga0466967_0870746_80_874 264
411 3300048903 Ga0496100_0017321 Ga0496100_0017321_2787_3581 264
412 3300048905 Ga0496102_0003747 Ga0496102_0003747_1506_2300 264
413 3300048906 Ga0496103_0006157 Ga0496103_0006157_2930_3724 264
414 3300048907 Ga0496104_0497432 Ga0496104_0497432_232_1026 264
415 3300048909 Ga0496106_0303293 Ga0496106_0303293_409_1203 264
416 3300048916 Ga0496113_0332405 Ga0496113_0332405_374_1168 264
417 3300048920 Ga0496117_0004333 Ga0496117_0004333_12410_13204 264
418 3300048921 Ga0496118_0002241 Ga0496118_0002241_7490_8284 264
419 3300048922 Ga0496119_0004802 Ga0496119_0004802_9899_10693 264
420 3300048924 Ga0496121_0002565 Ga0496121_0002565_6632_7426 264
421 3300048925 Ga0496122_0003928 Ga0496122_0003928_6582_7376 264
422 3300048925 Ga0496122_0084940 Ga0496122_0084940_831_1625 264
423 3300048926 Ga0496123_0004431 Ga0496123_0004431_10516_11310 264
424 3300048926 Ga0496123_0043798 Ga0496123_0043798_2212_3006 264
425 3300048927 Ga0496124_0012934 Ga0496124_0012934_4827_5621 264
426 3300048927 Ga0496124_0031786 Ga0496124_0031786_669_1463 264
427 3300048928 Ga0496125_0005315 Ga0496125_0005315_2793_3587 264
428 3300048928 Ga0496125_0183301 Ga0496125_0183301_223_1017 264
429 3300048929 Ga0496126_0085766 Ga0496126_0085766_700_1494 264
430 3300053125 Ga0500618_002061 Ga0500618_002061_3487_4281 264
431 3300061719 Ga0466962_0176472 Ga0466962_0176472_203_997 264
432 iso_pu_bacteria 3005452660 3005456514 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02358

Trehalose_PPase

Trehalose-phosphatase

64

274

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rcz-assembly2.cif.gz_E the structure of burkholderia pseudomallei trehalose-6-phosphatase 0.9438 25 263
6upe-assembly2.cif.gz_B structure of trehalose-6-phosphate phosphatase from salmonella typhimurium inhibited by 4-n-octylphenyl alpha-d-glucopyranoside-6-sulfate 0.9277 31 262
6rcz-assembly2.cif.gz_E the structure of burkholderia pseudomallei trehalose-6-phosphatase 0.883 25 263
6upe-assembly2.cif.gz_B structure of trehalose-6-phosphate phosphatase from salmonella typhimurium inhibited by 4-n-octylphenyl alpha-d-glucopyranoside-6-sulfate 0.8669 31 262
5dxi-assembly2.cif.gz_B structure of c. albicans trehalose-6-phosphate phosphatase c-terminal domain 0.8357 17 263
ID Description Score Start End Superfamily
af_A0A0R4J4X4_114_199_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9248 33 103 3.40.50.1000
af_Q1W5S8_213_360_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.861 130 262 3.40.50.1000
af_A0A1D6IK98_202_368_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8589 124 249 3.40.50.1000
af_Q0DDI1_213_352_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8571 122 252 3.40.50.1000
af_I1L5Q2_219_387_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.853 117 263 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A549T7M7-F1-model_v4 Trehalose 6-phosphate phosphatase (EC 3.1.3.12) 0.9856 22 264 GO:0004805
GO:0005992
GO:0046872
AF-A0A1Q9B2Q3-F1-model_v4 Trehalose 6-phosphate phosphatase (EC 3.1.3.12) 0.9792 20 263 GO:0004805
GO:0005992
GO:0046872
AF-A0A6S6QSR4-F1-model_v4 Trehalose 6-phosphate phosphatase (EC 3.1.3.12) 0.9752 29 263 GO:0004805
GO:0005992
GO:0046872
AF-A0A549T7M7-F1-model_v4 Trehalose 6-phosphate phosphatase (EC 3.1.3.12) 0.9737 22 264 GO:0004805
GO:0005992
GO:0046872
AF-A0A2T4JTR0-F1-model_v4 Trehalose 6-phosphate phosphatase (EC 3.1.3.12) 0.9735 93 264 GO:0004805
GO:0005992
GO:0046872

Feature Viewer

pLDDT pTM Quality
88.79 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map