F442685

General Info

Members Datasets Scaffolds Average Seq Length
432 354 272 253

Family's Representative Sequence

Representative Sequence 3300047470|Ga0495681_0052883|Ga0495681_0052883_1051_1863
Length 270
Sequence MTAQLNATRQQWLAARLDLLEEEKELTRQSDALAMKRQQLPRVRIDKEYRFDTEAGNVSLKDLFGGRSQLLVYHFMFGPDYTAGCPSCSSIADGFNGFFVHLENHDVAFTAISRAPLAKLLAFRQRMDWSFPWASSSGSDFNSDFSVWFTPEQQRQGGIEYNYRREPPAPEQSASEPLAGRTVQEWQLRGTEGPVAQIAAMTETDVATYTRDRPGVSAFELADGAVYHSYSSYARGLDGLWGMYQWLDRAPKGRNEQGVWWRHHDRYGKE

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
5 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
6 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
7 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
8 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
9 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
10 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
11 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
12 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
13 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
14 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
15 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
16 2516143018 Ensifer sp. BR816 Isolate Nodule
17 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
18 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
19 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
20 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
21 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
22 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
23 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
24 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
25 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
26 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
27 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
28 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
29 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
30 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
31 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
32 2718217927 Rhizobium sp. N324 Isolate Nodule
33 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
34 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
35 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
36 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
37 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
38 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
39 2718218423 Rhizobium sp. N941 Isolate Nodule
40 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
41 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
42 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
43 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
44 2721755809 Rhizobium sp. N541 Isolate Nodule
45 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
46 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
47 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
48 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
49 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
50 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
51 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
52 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
53 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
54 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
55 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
56 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
57 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
58 2791355256 Rhizobium sp. M10 Isolate Nodule
59 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
60 2791355262 Rhizobium sp. M1 Isolate Nodule
61 2791355265 Rhizobium sp. H4 Isolate Nodule
62 2791355266 Rhizobium sp. L43 Isolate Nodule
63 2802429633 Rhizobium anhuiense J3 Isolate Nodule
64 2802429634 Rhizobium anhuiense S10 Isolate Nodule
65 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
66 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
67 2802429637 Rhizobium anhuiense C15 Isolate Nodule
68 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
69 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
70 2838048938 Rhizobium pisi 27/80 Isolate Nodule
71 2838061910 Rhizobium phaseoli L15 Isolate Nodule
72 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
73 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
74 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
75 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
76 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
77 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
78 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
79 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
80 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
81 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
82 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
83 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
84 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
85 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
86 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
87 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
88 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
89 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
90 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
91 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
92 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
93 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
94 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
95 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
96 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
97 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
98 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
99 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
100 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
101 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
102 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
103 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
104 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
105 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
106 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
107 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
108 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
109 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
110 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
111 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
112 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
113 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
114 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
115 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
116 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
117 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
118 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
119 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
120 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
121 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
122 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
123 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
124 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
125 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
126 2928163908 Burkholderia sp. 567 Isolate Unclassified
127 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
128 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
129 2933599457 Rhizobium phaseoli M3 Isolate Nodule
130 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
131 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
132 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
133 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
134 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
135 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
136 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
137 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
138 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
139 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
140 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
141 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
142 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
143 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
144 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
145 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
146 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
147 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
148 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
149 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
150 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
151 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
152 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
153 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
154 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
155 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
156 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
157 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
158 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
159 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
160 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
161 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
162 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
163 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
164 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
165 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
166 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
167 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
168 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
169 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
170 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
171 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
172 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
173 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
174 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
175 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
176 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
177 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
178 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
179 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
180 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
181 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
182 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
183 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
184 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
185 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
186 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
187 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
188 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
190 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
207 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
208 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
209 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
210 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
211 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
212 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
213 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
214 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
220 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
221 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
222 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
223 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
224 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
225 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
226 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
227 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
228 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
229 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
230 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
231 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
232 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
233 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
234 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
235 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
240 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
241 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
242 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
243 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
244 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
245 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
246 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
247 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
251 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
252 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
253 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
254 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
261 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
262 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
263 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
271 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
274 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
275 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
276 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
277 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
278 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
279 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
280 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
281 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
282 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
285 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
299 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
300 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
301 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
302 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
306 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
320 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
321 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
322 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
323 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
324 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
325 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
326 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
327 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
328 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
329 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
330 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
331 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
332 8005275841 Rhizobium sp. N4311 Isolate Nodule
333 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
334 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
335 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
336 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
337 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
338 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
339 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
340 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
341 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
342 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
343 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
344 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
345 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
346 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
347 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
348 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
349 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
350 8018176218 Rhizobium sp. N122 Isolate Nodule
351 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
352 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
353 8056382006 Rhizobium croatiense 13T Isolate Nodule
354 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.96
Metatranscriptomes 0
Isolates 37.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.51
Nodule 29.17
Rhizoplane 0
Rhizosphere 42.82
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10099887 3300001989 Bacteria 877
2 JGI25162J39368_1001298 3300002737 Bacteria 14107
3 JGI25152J39213_1018376 3300002773 Bacteria 1294
4 JGI25150J39212_1014014 3300002774 Bacteria 1372
5 JGI25406J46586_10001306 3300003203 Bacteria 11732
6 JGI25165J46597_1001370 3300003214 Bacteria 13439
7 JGI25153J46596_10015919 3300003215 Bacteria 3039
8 JGI25153J46596_10016468 3300003215 Bacteria 2958
9 JGI25153J46596_10046262 3300003215 Bacteria 1291
10 Ga0055526_1000334 3300003771 Bacteria 38992
11 Ga0055524_1000368 3300003775 Bacteria 39894
12 Ga0055524_1012355 3300003775 Bacteria 3279
13 Ga0055524_1017327 3300003775 Bacteria 2545
14 Ga0055528_1000168 3300003790 Bacteria 55151
15 Ga0055528_1000276 3300003790 Bacteria 43646
16 Ga0055528_1002128 3300003790 Bacteria 10928
17 Ga0055528_1013944 3300003790 Bacteria 3011
18 Ga0055543_1002252 3300004625 Bacteria 6530
19 Ga0070658_10042049 3300005327 Bacteria 3689
20 Ga0070670_100042478 3300005331 Bacteria 3908
21 Ga0070677_10042409 3300005333 Bacteria 1802
22 Ga0070660_100002350 3300005339 Bacteria 12991
23 Ga0070661_100004637 3300005344 Bacteria 9463
24 Ga0070669_100162394 3300005353 Bacteria 1737
25 Ga0070675_100051155 3300005354 Bacteria 3394
26 Ga0070688_100207829 3300005365 Bacteria 1373
27 Ga0070659_100632313 3300005366 Bacteria 922
28 Ga0070667_100486056 3300005367 Bacteria 1131
29 Ga0070714_100059433 3300005435 Bacteria 3278
30 Ga0070714_100364106 3300005435 Bacteria 1360
31 Ga0070710_10006706 3300005437 Bacteria 5548
32 Ga0070681_10026043 3300005458 Bacteria 5880
33 Ga0070679_100113665 3300005530 Bacteria 2692
34 Ga0075365_10002070 3300006038 Bacteria 9572
35 Ga0075363_100005089 3300006048 Bacteria 5815
36 Ga0075364_10172520 3300006051 Bacteria 1462
37 Ga0070716_100009846 3300006173 Bacteria 4777
38 Ga0070712_100041358 3300006175 Bacteria 3165
39 Ga0075362_10051477 3300006177 Bacteria 1843
40 Ga0075367_10059851 3300006178 Bacteria 2269
41 Ga0075369_10005663 3300006186 Bacteria 4681
42 Ga0075369_10008574 3300006186 Bacteria 3938
43 Ga0075366_10099537 3300006195 Bacteria 1744
44 Ga0075429_100090502 3300006880 Bacteria 2668
45 Ga0068865_100206515 3300006881 Bacteria 1528
46 Ga0105240_10018071 3300009093 Bacteria 9481
47 Ga0114129_10090781 3300009147 Bacteria 4234
48 Ga0105248_10034099 3300009177 Bacteria 5690
49 Ga0123342_1012455 3300009766 Bacteria 8866
50 Ga0157372_10189955 3300013307 Bacteria 2379
51 Ga0157375_10081217 3300013308 Bacteria 3282
52 Ga0182007_10004893 3300015262 Bacteria 5984
53 Ga0182007_10017510 3300015262 Bacteria 2615
54 Ga0213876_10021600 3300021384 Bacteria 3404
55 Ga0209437_100064 3300025233 Bacteria 334360
56 Ga0207425_1009790 3300025245 Bacteria 2365
57 Ga0209129_1000235 3300025258 Bacteria 60351
58 Ga0209129_1008677 3300025258 Bacteria 2793
59 Ga0209233_1000081 3300025261 Bacteria 336832
60 Ga0209673_1000030 3300025273 Bacteria 351933
61 Ga0209673_1000444 3300025273 Bacteria 71044
62 Ga0209673_1004937 3300025273 Bacteria 6935
63 Ga0209025_1000058 3300025294 Bacteria 311398
64 Ga0209025_1007139 3300025294 Bacteria 8438
65 Ga0209564_1000167 3300025295 Bacteria 159653
66 Ga0209564_1000458 3300025295 Bacteria 68749
67 Ga0209564_1015226 3300025295 Bacteria 3144
68 Ga0209758_1000398 3300025297 Bacteria 75220
69 Ga0209758_1000501 3300025297 Bacteria 63430
70 Ga0209758_1008108 3300025297 Bacteria 6915
71 Ga0209758_1044197 3300025297 Bacteria 1631
72 Ga0209758_1058176 3300025297 Bacteria 1294
73 Ga0209256_1000511 3300025299 Bacteria 57006
74 Ga0209256_1000705 3300025299 Bacteria 44446
75 Ga0209256_1004102 3300025299 Bacteria 9437
76 Ga0207426_1000147 3300025302 Bacteria 190586
77 Ga0209051_1000687 3300025303 Bacteria 37475
78 Ga0209051_1029556 3300025303 Bacteria 2142
79 Ga0207707_10128876 3300025912 Bacteria 2212
80 Ga0207695_10013244 3300025913 Bacteria 9840
81 Ga0207695_10063071 3300025913 Bacteria 3821
82 Ga0207693_10011342 3300025915 Bacteria 7216
83 Ga0207681_10064929 3300025923 Bacteria 2522
84 Ga0207659_10266619 3300025926 Bacteria 1395
85 Ga0207690_10280340 3300025932 Bacteria 1298
86 Ga0207704_10197472 3300025938 Bacteria 1469
87 Ga0207665_10005260 3300025939 Bacteria 8644
88 Ga0207691_10077492 3300025940 Bacteria 2995
89 Ga0207661_10631086 3300025944 Bacteria 984
90 Ga0207641_10274283 3300026088 Bacteria 1584
91 Ga0207648_10063663 3300026089 Bacteria 3214
92 Ga0207676_10185623 3300026095 Bacteria 1825
93 Ga0207698_10214974 3300026142 Bacteria 1733
94 Ga0209371_1000079 3300027312 Bacteria 187621
95 Ga0209813_10017747 3300027866 Bacteria 1957
96 Ga0265318_10209025 3300028577 Bacteria 713
97 Ga0265338_10189905 3300028800 Bacteria 1558
98 Ga0268256_1000090 3300030500 Bacteria 153976
99 Ga0307511_10001472 3300030521 Bacteria 24899
100 Ga0265332_10110932 3300031238 Bacteria 1156
101 Ga0265325_10002687 3300031241 Bacteria 11897
102 Ga0265339_10000313 3300031249 Bacteria 39589
103 Ga0265316_10007569 3300031344 Bacteria 10219
104 Ga0307513_10037299 3300031456 Bacteria 5411
105 Ga0307416_100340297 3300032002 Bacteria 1513
106 Ga0373937_0269696 3300036401 Bacteria 1606
107 Ga0395905_0004095 3300037471 Bacteria 15277
108 Ga0395905_0015929 3300037471 Bacteria 7144
109 Ga0436364_0921012 3300037853 Bacteria 1962
110 Ga0436365_0482283 3300039437 Bacteria 3737
111 Ga0436365_1733929 3300039437 Bacteria 3067
112 Ga0436365_1735717 3300039437 Bacteria 2264
113 Ga0436362_0298699 3300039453 Bacteria 3038
114 Ga0436362_0564045 3300039453 Bacteria 12936
115 Ga0451833_0909628 3300041491 Bacteria 1221
116 Ga0451835_0170427 3300041492 Bacteria 3287
117 Ga0451837_0005373 3300041494 Bacteria 2072
118 Ga0451837_0546836 3300041494 Bacteria 1042
119 Ga0451839_1319259 3300041496 Bacteria 3711
120 Ga0451839_1617054 3300041496 Bacteria 1681
121 Ga0451841_0071413 3300041498 Bacteria 3495
122 Ga0451841_0312373 3300041498 Bacteria 1535
123 Ga0451845_0011758 3300041501 Bacteria 3333
124 Ga0451847_0050046 3300041503 Bacteria 3702
125 Ga0451847_0528845 3300041503 Bacteria 6040
126 Ga0451849_0719332 3300041505 Bacteria 3513
127 Ga0451849_1018907 3300041505 Bacteria 1571
128 Ga0451851_0008097 3300041507 Bacteria 3136
129 Ga0451851_0662176 3300041507 Bacteria 1469
130 Ga0451843_1380786 3300041509 Bacteria 2704
131 Ga0451855_0095402 3300041511 Bacteria 2493
132 Ga0451853_2800341 3300041512 Bacteria 1413
133 Ga0439452_052033 3300042010 Bacteria 935
134 Ga0451576_0042285 3300045051 Bacteria 4811
135 Ga0466967_0047494 3300045976 Bacteria 3743
136 Ga0495638_0042022 3300046460 Bacteria 2889
137 Ga0495653_0027663 3300046463 Bacteria 4539
138 Ga0495653_0188125 3300046463 Bacteria 1411
139 Ga0495650_0094328 3300046471 Bacteria 1133
140 Ga0495582_0118764 3300046473 Unclassified 1489
141 Ga0495585_0010435 3300046492 Bacteria 5528
142 Ga0495596_0047504 3300046500 Bacteria 1684
143 Ga0495607_0031105 3300046501 Bacteria 3270
144 Ga0495607_0054826 3300046501 Bacteria 2296
145 Ga0495606_0050480 3300046507 Bacteria 2721
146 Ga0495610_0023997 3300046512 Bacteria 3300
147 Ga0495610_0061045 3300046512 Bacteria 1792
148 Ga0495610_0106122 3300046512 Bacteria 1251
149 Ga0495618_0014172 3300046514 Bacteria 4854
150 Ga0495618_0072356 3300046514 Bacteria 2194
151 Ga0495620_0031168 3300046515 Bacteria 2446
152 Ga0495628_0005642 3300046516 Bacteria 10954
153 Ga0495628_0043651 3300046516 Bacteria 3569
154 Ga0495630_0107633 3300046517 Bacteria 2111
155 Ga0495630_0123651 3300046517 Bacteria 1963
156 Ga0495631_0009641 3300046518 Bacteria 4814
157 Ga0495631_0036718 3300046518 Bacteria 2187
158 Ga0495632_0094990 3300046519 Bacteria 1409
159 Ga0495643_0041819 3300046522 Bacteria 2498
160 Ga0495648_0057343 3300046524 Bacteria 2337
161 Ga0495648_0084991 3300046524 Bacteria 1789
162 Ga0495666_0075903 3300046526 Unclassified 1593
163 Ga0495666_0116192 3300046526 Bacteria 1255
164 Ga0495640_0023851 3300046533 Bacteria 4451
165 Ga0495640_0085625 3300046533 Bacteria 2088
166 Ga0495609_0014000 3300046538 Bacteria 3778
167 Ga0495597_0000622 3300046542 Bacteria 28970
168 Ga0495645_0128836 3300046543 Bacteria 1776
169 Ga0495667_0113961 3300046559 Bacteria 1747
170 Ga0495667_0196940 3300046559 Unclassified 1290
171 Ga0495656_0070705 3300046615 Bacteria 1549
172 Ga0495668_0053866 3300046616 Bacteria 2224
173 Ga0495668_0068409 3300046616 Bacteria 1953
174 Ga0495634_0036750 3300046642 Bacteria 3348
175 Ga0495634_0108378 3300046642 Bacteria 1788
176 Ga0495625_0020733 3300046660 Bacteria 5067
177 Ga0495625_0064991 3300046660 Bacteria 2572
178 Ga0495635_0203849 3300046663 Bacteria 1341
179 Ga0495661_0142269 3300046665 Bacteria 1304
180 Ga0495646_0283345 3300046680 Bacteria 880
181 Ga0495613_0000311 3300046689 Bacteria 44152
182 Ga0495613_0110332 3300046689 Bacteria 1983
183 Ga0495670_0017427 3300046691 Bacteria 3534
184 Ga0495671_0036495 3300046692 Bacteria 2489
185 Ga0495660_0019557 3300046810 Bacteria 3887
186 Ga0495604_0111059 3300047317 Bacteria 1999
187 Ga0495674_0037976 3300047319 Bacteria 4326
188 Ga0495674_0287836 3300047319 Unclassified 1344
189 Ga0495680_0017144 3300047322 Bacteria 6197
190 Ga0495680_0035256 3300047322 Bacteria 4031
191 Ga0495687_045718 3300047443 Bacteria 1894
192 Ga0495675_0060824 3300047444 Bacteria 2393
193 Ga0495681_0052883 3300047470 Bacteria 1903
194 Ga0495684_0145074 3300047471 Unclassified 1778
195 Ga0495686_0037550 3300047472 Bacteria 3102
196 Ga0495686_0141598 3300047472 Bacteria 1419
197 Ga0495614_0095614 3300048089 Bacteria 1295
198 Ga0496116_0081550 3300048919 Bacteria 2005
199 Ga0496118_0004383 3300048921 Bacteria 16784
200 Ga0496118_0012902 3300048921 Bacteria 7961
201 Ga0496118_0103897 3300048921 Bacteria 1909
202 Ga0496120_0131109 3300048923 Bacteria 1284
203 Ga0496121_0107320 3300048924 Bacteria 2139
204 Ga0496122_0020518 3300048925 Bacteria 5964
205 Ga0496124_0092175 3300048927 Bacteria 2468
206 Ga0501031_0000002 3300049568 Bacteria 217588
207 Ga0501032_0000004 3300049569 Bacteria 310855
208 Ga0501032_0054695 3300049569 Bacteria 2687
209 Ga0501032_0137719 3300049569 Bacteria 1608
210 Ga0501033_0000016 3300049570 Bacteria 217458
211 Ga0501033_0034506 3300049570 Bacteria 3794
212 Ga0501033_0048150 3300049570 Bacteria 3167
213 Ga0501033_0087342 3300049570 Bacteria 2282
214 Ga0501034_0000011 3300049571 Bacteria 310855
215 Ga0501034_0029938 3300049571 Bacteria 5534
216 Ga0501034_0145506 3300049571 Bacteria 2347
217 Ga0501036_0000001 3300049572 Bacteria 310855
218 Ga0501036_0048688 3300049572 Bacteria 3588
219 Ga0501036_0134885 3300049572 Bacteria 2083
220 Ga0501037_0000006 3300049573 Bacteria 217461
221 Ga0501037_0158630 3300049573 Bacteria 1613
222 Ga0501038_0000003 3300049574 Bacteria 310855
223 Ga0501039_0000004 3300049575 Bacteria 310855
224 Ga0501040_0000812 3300049576 Bacteria 19463
225 Ga0501043_0000155 3300049579 Bacteria 62570
226 Ga0501043_0023666 3300049579 Bacteria 4816
227 Ga0501046_0111017 3300049580 Bacteria 2094
228 Ga0501047_0001325 3300049581 Bacteria 24266
229 Ga0501047_0091596 3300049581 Bacteria 2918
230 Ga0501069_0130311 3300049585 Bacteria 1440
231 Ga0501070_0072579 3300049586 Bacteria 2849
232 Ga0501070_0101440 3300049586 Bacteria 2380
233 Ga0501070_0544331 3300049586 Bacteria 930
234 Ga0501071_0011591 3300049587 Bacteria 5950
235 Ga0501073_0124614 3300049589 Bacteria 1786
236 Ga0501074_0049240 3300049590 Bacteria 3042
237 Ga0501079_0522999 3300049741 Bacteria 933
238 Ga0501080_0067410 3300049742 Bacteria 3328
239 Ga0501083_0198415 3300049744 Bacteria 1309
240 Ga0501035_0000009 3300049822 Bacteria 310827
241 Ga0501035_0035300 3300049822 Bacteria 4538
242 Ga0501035_0051827 3300049822 Bacteria 3672
243 Ga0501044_0000005 3300049823 Bacteria 310855
244 Ga0501044_0011813 3300049823 Bacteria 9461
245 Ga0501044_0044487 3300049823 Bacteria 4606
246 Ga0501044_0128683 3300049823 Bacteria 2527
247 Ga0501045_0016795 3300049824 Bacteria 5198
248 nmdc:mga0yw44_315610_c1 3300050492 Bacteria 1049
249 nmdc:mga0k408_19385_c1 3300050493 Bacteria 3801
250 nmdc:mga06z11_112712_c1 3300050494 Bacteria 1508
251 nmdc:mga06z11_8588_c1 3300050494 Bacteria 1278
252 nmdc:mga09592_12317_c1 3300050508 Bacteria 6964
253 nmdc:mga0qj67_11648_c1 3300050509 Bacteria 6597
254 nmdc:mga0a205_228612_c1 3300050515 Bacteria 1744
255 nmdc:mga0sz30_102453_c1 3300050516 Bacteria 1251
256 nmdc:mga0sz30_6264_c1 3300050516 Bacteria 4412
257 Ga0495601_0052203 3300053077 Bacteria 2581
258 Ga0495595_0007238 3300053084 Bacteria 4537
259 Ga0495619_0038576 3300053085 Bacteria 3116
260 Ga0500643_012055 3300053087 Bacteria 3115
261 Ga0500646_0002028 3300053090 Bacteria 5286
262 Ga0500566_0043962 3300053094 Bacteria 2573
263 Ga0500569_002496 3300053109 Bacteria 3636
264 Ga0500597_000078 3300053120 Bacteria 19903
265 Ga0500655_021951 3300053133 Bacteria 1199
266 Ga0500658_0001055 3300053134 Bacteria 11278
267 Ga0500658_0126771 3300053134 Bacteria 1135
268 Ga0500604_0003982 3300053151 Bacteria 3943
269 Ga0500622_0000443 3300053156 Bacteria 39403
270 Ga0500622_0180589 3300053156 Bacteria 975
271 Ga0500633_0015126 3300053160 Bacteria 2206
272 Ga0530510_0485069 3300061734 Bacteria 936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039437 Ga0436365_0482283 Ga0436365_0482283_165_884 180
2 3300032002 Ga0307416_100340297 Ga0307416_1003402972 181
3 3300015262 Ga0182007_10017510 Ga0182007_100175103 182
4 3300003203 JGI25406J46586_10001306 JGI25406J46586_100013067 184
5 3300028577 Ga0265318_10209025 Ga0265318_102090251 184
6 3300006178 Ga0075367_10059851 Ga0075367_100598512 186
7 3300021384 Ga0213876_10021600 Ga0213876_100216002 186
8 3300039453 Ga0436362_0298699 Ga0436362_0298699_2036_2839 186
9 3300046514 Ga0495618_0014172 Ga0495618_0014172_3392_4111 186
10 3300046526 Ga0495666_0116192 Ga0495666_0116192_358_1077 186
11 3300046533 Ga0495640_0023851 Ga0495640_0023851_2587_3306 186
12 3300046642 Ga0495634_0036750 Ga0495634_0036750_2233_2952 186
13 3300046689 Ga0495613_0000311 Ga0495613_0000311_7335_8054 186
14 3300048089 Ga0495614_0095614 Ga0495614_0095614_297_1016 186
15 3300050494 nmdc:mga06z11_112712_c1 nmdc:mga06z11_112712_c1_520_1323 186
16 3300053094 Ga0500566_0043962 Ga0500566_0043962_428_1147 186
17 3300005435 Ga0070714_100059433 Ga0070714_1000594334 187
18 3300005437 Ga0070710_10006706 Ga0070710_100067063 187
19 3300006173 Ga0070716_100009846 Ga0070716_1000098467 187
20 3300006175 Ga0070712_100041358 Ga0070712_1000413583 187
21 3300025915 Ga0207693_10011342 Ga0207693_100113423 187
22 3300025939 Ga0207665_10005260 Ga0207665_100052606 187
23 3300039437 Ga0436365_1733929 Ga0436365_1733929_868_1671 188
24 3300053134 Ga0500658_0126771 Ga0500658_0126771_406_1116 188
25 3300005333 Ga0070677_10042409 Ga0070677_100424092 189
26 3300005354 Ga0070675_100051155 Ga0070675_1000511553 189
27 3300005365 Ga0070688_100207829 Ga0070688_1002078292 189
28 3300005367 Ga0070667_100486056 Ga0070667_1004860561 189
29 3300025926 Ga0207659_10266619 Ga0207659_102666192 189
30 3300026088 Ga0207641_10274283 Ga0207641_102742832 189
31 3300005331 Ga0070670_100042478 Ga0070670_1000424782 190
32 3300005353 Ga0070669_100162394 Ga0070669_1001623941 190
33 3300005366 Ga0070659_100632313 Ga0070659_1006323131 190
34 3300006880 Ga0075429_100090502 Ga0075429_1000905022 190
35 3300006881 Ga0068865_100206515 Ga0068865_1002065152 190
36 3300009177 Ga0105248_10034099 Ga0105248_100340992 190
37 3300013308 Ga0157375_10081217 Ga0157375_100812172 190
38 3300025923 Ga0207681_10064929 Ga0207681_100649292 190
39 3300025932 Ga0207690_10280340 Ga0207690_102803402 190
40 3300025938 Ga0207704_10197472 Ga0207704_101974722 190
41 3300025940 Ga0207691_10077492 Ga0207691_100774923 190
42 3300026089 Ga0207648_10063663 Ga0207648_100636632 190
43 3300026095 Ga0207676_10185623 Ga0207676_101856232 190
44 3300026142 Ga0207698_10214974 Ga0207698_102149742 190
45 3300050508 nmdc:mga09592_12317_c1 nmdc:mga09592_12317_c1_4421_5194 190
46 3300050509 nmdc:mga0qj67_11648_c1 nmdc:mga0qj67_11648_c1_2728_3501 190
47 3300045051 Ga0451576_0042285 Ga0451576_0042285_3207_3959 195
48 3300047472 Ga0495686_0141598 Ga0495686_0141598_228_986 195
49 3300053087 Ga0500643_012055 Ga0500643_012055_2287_3084 195
50 3300053120 Ga0500597_000078 Ga0500597_000078_18727_19524 195
51 iso_pu_bacteria 2739367756 2739791124 195
52 3300005458 Ga0070681_10026043 Ga0070681_100260435 196
53 3300025912 Ga0207707_10128876 Ga0207707_101288762 196
54 3300025944 Ga0207661_10631086 Ga0207661_106310861 196
55 3300036401 Ga0373937_0269696 Ga0373937_0269696_222_1007 198
56 3300037471 Ga0395905_0015929 Ga0395905_0015929_5880_6782 200
57 3300005435 Ga0070714_100364106 Ga0070714_1003641062 201
58 3300028800 Ga0265338_10189905 Ga0265338_101899052 201
59 3300031238 Ga0265332_10110932 Ga0265332_101109322 201
60 3300031241 Ga0265325_10002687 Ga0265325_100026874 201
61 3300031249 Ga0265339_10000313 Ga0265339_1000031318 201
62 3300031344 Ga0265316_10007569 Ga0265316_100075696 201
63 3300047322 Ga0495680_0017144 Ga0495680_0017144_4937_5722 201
64 3300045976 Ga0466967_0047494 Ga0466967_0047494_813_1589 208
65 3300046463 Ga0495653_0027663 Ga0495653_0027663_1156_1875 209
66 3300046463 Ga0495653_0188125 Ga0495653_0188125_176_904 209
67 3300046473 Ga0495582_0118764 Ga0495582_0118764_273_992 209
68 3300046514 Ga0495618_0072356 Ga0495618_0072356_96_824 209
69 3300046516 Ga0495628_0005642 Ga0495628_0005642_4191_4919 209
70 3300046516 Ga0495628_0043651 Ga0495628_0043651_1680_2399 209
71 3300046517 Ga0495630_0107633 Ga0495630_0107633_721_1440 209
72 3300046517 Ga0495630_0123651 Ga0495630_0123651_195_923 209
73 3300046526 Ga0495666_0075903 Ga0495666_0075903_853_1572 209
74 3300046533 Ga0495640_0085625 Ga0495640_0085625_1142_1870 209
75 3300046543 Ga0495645_0128836 Ga0495645_0128836_900_1628 209
76 3300046559 Ga0495667_0113961 Ga0495667_0113961_41_769 209
77 3300046559 Ga0495667_0196940 Ga0495667_0196940_48_767 209
78 3300046642 Ga0495634_0108378 Ga0495634_0108378_214_942 209
79 3300046663 Ga0495635_0203849 Ga0495635_0203849_581_1309 209
80 3300046680 Ga0495646_0283345 Ga0495646_0283345_128_856 209
81 3300046689 Ga0495613_0110332 Ga0495613_0110332_400_1128 209
82 3300047317 Ga0495604_0111059 Ga0495604_0111059_1256_1984 209
83 3300047319 Ga0495674_0037976 Ga0495674_0037976_1033_1761 209
84 3300047319 Ga0495674_0287836 Ga0495674_0287836_450_1169 209
85 3300047322 Ga0495680_0035256 Ga0495680_0035256_1696_2424 209
86 3300047444 Ga0495675_0060824 Ga0495675_0060824_702_1430 209
87 3300047471 Ga0495684_0145074 Ga0495684_0145074_678_1397 209
88 3300049741 Ga0501079_0522999 Ga0501079_0522999_84_812 209
89 3300053077 Ga0495601_0052203 Ga0495601_0052203_900_1628 209
90 3300053084 Ga0495595_0007238 Ga0495595_0007238_906_1634 209
91 3300053085 Ga0495619_0038576 Ga0495619_0038576_242_970 209
92 3300061734 Ga0530510_0485069 Ga0530510_0485069_185_913 209
93 3300009147 Ga0114129_10090781 Ga0114129_100907813 210
94 3300039453 Ga0436362_0564045 Ga0436362_0564045_2979_3698 210
95 3300049586 Ga0501070_0544331 Ga0501070_0544331_127_909 210
96 3300050515 nmdc:mga0a205_228612_c1 nmdc:mga0a205_228612_c1_754_1527 210
97 3300005344 Ga0070661_100004637 Ga0070661_1000046377 211
98 3300005530 Ga0070679_100113665 Ga0070679_1001136653 211
99 3300013307 Ga0157372_10189955 Ga0157372_101899552 211
100 3300003771 Ga0055526_1000334 Ga0055526_10003347 213
101 3300003775 Ga0055524_1000368 Ga0055524_100036838 213
102 3300003790 Ga0055528_1000276 Ga0055528_10002764 213
103 3300004625 Ga0055543_1002252 Ga0055543_10022524 213
104 3300006038 Ga0075365_10002070 Ga0075365_100020708 213
105 3300006048 Ga0075363_100005089 Ga0075363_1000050896 213
106 3300006051 Ga0075364_10172520 Ga0075364_101725202 213
107 3300006177 Ga0075362_10051477 Ga0075362_100514772 213
108 3300006186 Ga0075369_10005663 Ga0075369_100056631 213
109 3300006195 Ga0075366_10099537 Ga0075366_100995372 213
110 3300025295 Ga0209564_1000458 Ga0209564_100045852 213
111 3300025297 Ga0209758_1044197 Ga0209758_10441972 213
112 3300025299 Ga0209256_1000705 Ga0209256_100070547 213
113 3300025302 Ga0207426_1000147 Ga0207426_100014742 213
114 3300025303 Ga0209051_1000687 Ga0209051_100068721 213
115 3300027866 Ga0209813_10017747 Ga0209813_100177473 213
116 3300031456 Ga0307513_10037299 Ga0307513_100372994 213
117 3300041496 Ga0451839_1617054 Ga0451839_1617054_290_1072 213
118 3300041498 Ga0451841_0312373 Ga0451841_0312373_144_926 213
119 3300041503 Ga0451847_0528845 Ga0451847_0528845_163_945 213
120 3300041507 Ga0451851_0662176 Ga0451851_0662176_78_860 213
121 3300046538 Ga0495609_0014000 Ga0495609_0014000_2362_3168 213
122 3300046542 Ga0495597_0000622 Ga0495597_0000622_24981_25787 213
123 3300046665 Ga0495661_0142269 Ga0495661_0142269_423_1205 213
124 3300050492 nmdc:mga0yw44_315610_c1 nmdc:mga0yw44_315610_c1_64_861 213
125 3300050493 nmdc:mga0k408_19385_c1 nmdc:mga0k408_19385_c1_2032_2829 213
126 3300050494 nmdc:mga06z11_8588_c1 nmdc:mga06z11_8588_c1_187_984 213
127 3300050516 nmdc:mga0sz30_6264_c1 nmdc:mga0sz30_6264_c1_3239_4036 213
128 iso_pu_bacteria 8018163183 8018166294 213
129 3300003215 JGI25153J46596_10016468 JGI25153J46596_100164683 214
130 3300003775 Ga0055524_1017327 Ga0055524_10173274 214
131 3300003790 Ga0055528_1002128 Ga0055528_10021283 214
132 3300025273 Ga0209673_1004937 Ga0209673_10049377 214
133 3300025297 Ga0209758_1008108 Ga0209758_10081086 214
134 3300025299 Ga0209256_1004102 Ga0209256_10041027 214
135 3300025303 Ga0209051_1029556 Ga0209051_10295562 214
136 3300041494 Ga0451837_0546836 Ga0451837_0546836_87_884 214
137 3300041505 Ga0451849_0719332 Ga0451849_0719332_2376_3173 214
138 3300046460 Ga0495638_0042022 Ga0495638_0042022_1948_2745 214
139 3300046471 Ga0495650_0094328 Ga0495650_0094328_228_1025 214
140 3300046501 Ga0495607_0031105 Ga0495607_0031105_970_1767 214
141 3300046512 Ga0495610_0061045 Ga0495610_0061045_704_1501 214
142 3300046515 Ga0495620_0031168 Ga0495620_0031168_835_1632 214
143 3300046518 Ga0495631_0036718 Ga0495631_0036718_623_1420 214
144 3300046522 Ga0495643_0041819 Ga0495643_0041819_952_1746 214
145 3300046616 Ga0495668_0068409 Ga0495668_0068409_700_1494 214
146 3300046660 Ga0495625_0020733 Ga0495625_0020733_1154_1951 214
147 3300046810 Ga0495660_0019557 Ga0495660_0019557_322_1119 214
148 3300047443 Ga0495687_045718 Ga0495687_045718_120_917 214
149 3300047472 Ga0495686_0037550 Ga0495686_0037550_665_1462 214
150 3300049571 Ga0501034_0029938 Ga0501034_0029938_4021_4818 214
151 3300049823 Ga0501044_0011813 Ga0501044_0011813_8423_9220 214
152 3300053090 Ga0500646_0002028 Ga0500646_0002028_231_1085 214
153 3300053109 Ga0500569_002496 Ga0500569_002496_2828_3625 214
154 3300053133 Ga0500655_021951 Ga0500655_021951_84_938 214
155 3300053134 Ga0500658_0001055 Ga0500658_0001055_3618_4415 214
156 3300053151 Ga0500604_0003982 Ga0500604_0003982_150_1004 214
157 3300030521 Ga0307511_10001472 Ga0307511_1000147218 215
158 iso_pu_bacteria 2582581866 2585397286 216
159 iso_pu_bacteria 2585427526 2585527265 216
160 iso_pu_bacteria 2510461076 2510895181 217
161 iso_pu_bacteria 2510917030 2511195497 217
162 iso_pu_bacteria 2513237162 2514020198 217
163 iso_pu_bacteria 2515154113 2515634057 217
164 iso_pu_bacteria 2515154114 2515640762 217
165 iso_pu_bacteria 2515154116 2515655547 217
166 iso_pu_bacteria 2517287029 2517407203 217
167 iso_pu_bacteria 2582581298 2585224575 217
168 iso_pu_bacteria 2585427529 2585546696 217
169 iso_pu_bacteria 3005409236 3005415004 217
170 3300037471 Ga0395905_0004095 Ga0395905_0004095_5182_5967 218
171 iso_pu_bacteria 2509276033 2509446803 218
172 iso_pu_bacteria 2510065019 2510133750 218
173 iso_pu_bacteria 2513237084 2513573775 218
174 iso_pu_bacteria 2513237085 2513576767 218
175 iso_pu_bacteria 2513237093 2513629595 218
176 iso_pu_bacteria 2513237103 2513708242 218
177 iso_pu_bacteria 2513237159 2514001740 218
178 iso_pu_bacteria 2515075009 2515112788 218
179 iso_pu_bacteria 2515154134 2515744065 218
180 iso_pu_bacteria 2516143018 2516204302 218
181 iso_pu_bacteria 2516653077 2517036512 218
182 iso_pu_bacteria 2516653085 2517076889 218
183 iso_pu_bacteria 2517093000 2517095638 218
184 iso_pu_bacteria 2529292951 2530646192 218
185 iso_pu_bacteria 2582581299 2585232928 218
186 iso_pu_bacteria 2582581316 2585335382 218
187 iso_pu_bacteria 2585427528 2585537999 218
188 iso_pu_bacteria 2585427593 2585835947 218
189 iso_pu_bacteria 2690316117 2692317216 218
190 iso_pu_bacteria 2718217927 2719386150 218
191 iso_pu_bacteria 2718217997 2719665963 218
192 iso_pu_bacteria 2718218199 2720492383 218
193 iso_pu_bacteria 2718218232 2720613734 218
194 iso_pu_bacteria 2718218233 2720620525 218
195 iso_pu_bacteria 2718218235 2720631947 218
196 iso_pu_bacteria 2718218269 2720775675 218
197 iso_pu_bacteria 2718218423 2721399932 218
198 iso_pu_bacteria 2721755556 2723027282 218
199 iso_pu_bacteria 2721755684 2723560902 218
200 iso_pu_bacteria 2721755685 2723567494 218
201 iso_pu_bacteria 2721755809 2724038745 218
202 iso_pu_bacteria 2721755819 2724090282 218
203 iso_pu_bacteria 2721755822 2724104759 218
204 iso_pu_bacteria 2721755823 2724110563 218
205 iso_pu_bacteria 2724679232 2725950005 218
206 iso_pu_bacteria 2728369352 2730108218 218
207 iso_pu_bacteria 2738541333 2739032655 218
208 iso_pu_bacteria 2751185821 2753461383 218
209 iso_pu_bacteria 2765235942 2766065674 218
210 iso_pu_bacteria 2791355091 2792622420 218
211 iso_pu_bacteria 2791355092 2792628011 218
212 iso_pu_bacteria 2791355094 2792643875 218
213 iso_pu_bacteria 2791355256 2793298759 218
214 iso_pu_bacteria 2791355259 2793314727 218
215 iso_pu_bacteria 2791355262 2793337607 218
216 iso_pu_bacteria 2791355265 2793352028 218
217 iso_pu_bacteria 2791355266 2793363904 218
218 iso_pu_bacteria 2802429633 2806043634 218
219 iso_pu_bacteria 2802429634 2806050434 218
220 iso_pu_bacteria 2802429635 2806057251 218
221 iso_pu_bacteria 2802429636 2806064631 218
222 iso_pu_bacteria 2802429637 2806071898 218
223 iso_pu_bacteria 2838016132 2838017850 218
224 iso_pu_bacteria 2838022645 2838028559 218
225 iso_pu_bacteria 2838048938 2838051856 218
226 iso_pu_bacteria 2838061910 2838066277 218
227 iso_pu_bacteria 2838068647 2838070343 218
228 iso_pu_bacteria 2838074704 2838077054 218
229 iso_pu_bacteria 2838680041 2838681795 218
230 iso_pu_bacteria 2838686498 2838687232 218
231 iso_pu_bacteria 2838694306 2838696367 218
232 iso_pu_bacteria 2838707686 2838710394 218
233 iso_pu_bacteria 2838729681 2838729796 218
234 iso_pu_bacteria 2838742623 2838743189 218
235 iso_pu_bacteria 2841851746 2841852675 218
236 iso_pu_bacteria 2842077413 2842078568 218
237 iso_pu_bacteria 2842110456 2842114782 218
238 iso_pu_bacteria 2842118031 2842118923 218
239 iso_pu_bacteria 2842156927 2842156934 218
240 iso_pu_bacteria 2842163707 2842167590 218
241 iso_pu_bacteria 2842180545 2842181483 218
242 iso_pu_bacteria 2842198810 2842204587 218
243 iso_pu_bacteria 2842205361 2842205681 218
244 iso_pu_bacteria 2842217011 2842217734 218
245 iso_pu_bacteria 2842229732 2842230465 218
246 iso_pu_bacteria 2842237096 2842239806 218
247 iso_pu_bacteria 2842243621 2842244367 218
248 iso_pu_bacteria 2842257432 2842257547 218
249 iso_pu_bacteria 2842264693 2842265683 218
250 iso_pu_bacteria 2842271015 2842271230 218
251 iso_pu_bacteria 2842278818 2842279138 218
252 iso_pu_bacteria 2842285085 2842285793 218
253 iso_pu_bacteria 2842291075 2842292230 218
254 iso_pu_bacteria 2842304105 2842304855 218
255 iso_pu_bacteria 2842311132 2842316642 218
256 iso_pu_bacteria 2842370503 2842372362 218
257 iso_pu_bacteria 2842377471 2842378627 218
258 iso_pu_bacteria 2842384541 2842385433 218
259 iso_pu_bacteria 2842395702 2842401892 218
260 iso_pu_bacteria 2842402390 2842403153 218
261 iso_pu_bacteria 2842409023 2842409474 218
262 iso_pu_bacteria 2842415677 2842416127 218
263 iso_pu_bacteria 2842422224 2842423957 218
264 iso_pu_bacteria 2842428310 2842429680 218
265 iso_pu_bacteria 2842434925 2842436293 218
266 iso_pu_bacteria 2842441272 2842442640 218
267 iso_pu_bacteria 2842447887 2842452972 218
268 iso_pu_bacteria 2842462802 2842464101 218
269 iso_pu_bacteria 2842469257 2842470622 218
270 iso_pu_bacteria 2842521101 2842527248 218
271 iso_pu_bacteria 2844454524 2844458598 218
272 iso_pu_bacteria 2847417321 2847417716 218
273 iso_pu_bacteria 2848992105 2848992521 218
274 iso_pu_bacteria 2855872281 2855874498 218
275 iso_pu_bacteria 2857516855 2857517633 218
276 iso_pu_bacteria 2896384573 2896385860 218
277 iso_pu_bacteria 2919100787 2919106852 218
278 iso_pu_bacteria 2920760137 2920761792 218
279 iso_pu_bacteria 2933570622 2933570664 218
280 iso_pu_bacteria 2933586486 2933591155 218
281 iso_pu_bacteria 2933599457 2933601147 218
282 iso_pu_bacteria 2935894831 2935900629 218
283 iso_pu_bacteria 2935901341 2935902138 218
284 iso_pu_bacteria 2936367885 2936372246 218
285 iso_pu_bacteria 2936375103 2936380950 218
286 iso_pu_bacteria 639633055 639649000 218
287 iso_pu_bacteria 643692032 643824575 218
288 iso_pu_bacteria 8005275841 8005280936 218
289 iso_pu_bacteria 8005282627 8005285187 218
290 iso_pu_bacteria 8005289223 8005293438 218
291 iso_pu_bacteria 8005301065 8005302925 218
292 iso_pu_bacteria 8005307578 8005312649 218
293 iso_pu_bacteria 8005376324 8005379673 218
294 iso_pu_bacteria 8005430974 8005434956 218
295 iso_pu_bacteria 8005460587 8005463461 218
296 iso_pu_bacteria 8005497431 8005500696 218
297 iso_pu_bacteria 8005556819 8005557213 218
298 iso_pu_bacteria 8005563573 8005567790 218
299 iso_pu_bacteria 8005570704 8005570774 218
300 iso_pu_bacteria 8005619151 8005622071 218
301 iso_pu_bacteria 8005668836 8005672114 218
302 iso_pu_bacteria 8005688590 8005692307 218
303 iso_pu_bacteria 8005695170 8005696464 218
304 iso_pu_bacteria 8018127388 8018133890 218
305 iso_pu_bacteria 8018176218 8018181511 218
306 iso_pu_bacteria 8023680758 8023683353 218
307 iso_pu_bacteria 8024479707 8024483063 218
308 iso_pu_bacteria 8056382006 8056386522 218
309 iso_pu_bacteria 8057874678 8057878797 218
310 3300003215 JGI25153J46596_10046262 JGI25153J46596_100462621 221
311 3300037853 Ga0436364_0921012 Ga0436364_0921012_747_1547 221
312 3300041491 Ga0451833_0909628 Ga0451833_0909628_116_925 221
313 3300041492 Ga0451835_0170427 Ga0451835_0170427_863_1672 221
314 3300041494 Ga0451837_0005373 Ga0451837_0005373_863_1672 221
315 3300041496 Ga0451839_1319259 Ga0451839_1319259_2606_3415 221
316 3300041498 Ga0451841_0071413 Ga0451841_0071413_297_1106 221
317 3300041501 Ga0451845_0011758 Ga0451845_0011758_910_1719 221
318 3300041503 Ga0451847_0050046 Ga0451847_0050046_2303_3112 221
319 3300041505 Ga0451849_1018907 Ga0451849_1018907_604_1413 221
320 3300041507 Ga0451851_0008097 Ga0451851_0008097_1386_2195 221
321 3300041509 Ga0451843_1380786 Ga0451843_1380786_1599_2408 221
322 3300041511 Ga0451855_0095402 Ga0451855_0095402_1202_2011 221
323 3300041512 Ga0451853_2800341 Ga0451853_2800341_120_929 221
324 3300046492 Ga0495585_0010435 Ga0495585_0010435_337_1146 221
325 3300046500 Ga0495596_0047504 Ga0495596_0047504_328_1137 221
326 3300046501 Ga0495607_0054826 Ga0495607_0054826_372_1181 221
327 3300046512 Ga0495610_0023997 Ga0495610_0023997_1826_2635 221
328 3300046518 Ga0495631_0009641 Ga0495631_0009641_1182_1991 221
329 3300046519 Ga0495632_0094990 Ga0495632_0094990_113_922 221
330 3300046524 Ga0495648_0057343 Ga0495648_0057343_575_1384 221
331 3300046615 Ga0495656_0070705 Ga0495656_0070705_291_1100 221
332 3300046616 Ga0495668_0053866 Ga0495668_0053866_1062_1871 221
333 3300046660 Ga0495625_0064991 Ga0495625_0064991_906_1715 221
334 3300046691 Ga0495670_0017427 Ga0495670_0017427_2078_2887 221
335 3300046692 Ga0495671_0036495 Ga0495671_0036495_1468_2271 221
336 3300048921 Ga0496118_0004383 Ga0496118_0004383_15216_16010 221
337 3300048923 Ga0496120_0131109 Ga0496120_0131109_63_845 221
338 3300049569 Ga0501032_0054695 Ga0501032_0054695_1635_2429 221
339 3300053160 Ga0500633_0015126 Ga0500633_0015126_1231_2013 221
340 3300002737 JGI25162J39368_1001298 JGI25162J39368_100129810 222
341 3300002773 JGI25152J39213_1018376 JGI25152J39213_10183762 222
342 3300002774 JGI25150J39212_1014014 JGI25150J39212_10140141 222
343 3300003214 JGI25165J46597_1001370 JGI25165J46597_100137010 222
344 3300003215 JGI25153J46596_10015919 JGI25153J46596_100159192 222
345 3300003775 Ga0055524_1012355 Ga0055524_10123552 222
346 3300003790 Ga0055528_1000168 Ga0055528_100016811 222
347 3300006186 Ga0075369_10008574 Ga0075369_100085744 222
348 3300009766 Ga0123342_1012455 Ga0123342_10124556 222
349 3300025233 Ga0209437_100064 Ga0209437_100064295 222
350 3300025245 Ga0207425_1009790 Ga0207425_10097902 222
351 3300025258 Ga0209129_1000235 Ga0209129_100023533 222
352 3300025258 Ga0209129_1008677 Ga0209129_10086773 222
353 3300025261 Ga0209233_1000081 Ga0209233_10000815 222
354 3300025273 Ga0209673_1000444 Ga0209673_100044423 222
355 3300025294 Ga0209025_1000058 Ga0209025_1000058153 222
356 3300025294 Ga0209025_1007139 Ga0209025_10071394 222
357 3300025295 Ga0209564_1000167 Ga0209564_100016711 222
358 3300025297 Ga0209758_1000398 Ga0209758_100039833 222
359 3300025297 Ga0209758_1000501 Ga0209758_100050170 222
360 3300025297 Ga0209758_1058176 Ga0209758_10581762 222
361 3300025299 Ga0209256_1000511 Ga0209256_100051111 222
362 3300042010 Ga0439452_052033 Ga0439452_052033_82_879 222
363 3300046507 Ga0495606_0050480 Ga0495606_0050480_1887_2684 222
364 3300046512 Ga0495610_0106122 Ga0495610_0106122_154_954 222
365 3300047470 Ga0495681_0052883 Ga0495681_0052883_1051_1863 222
366 3300048919 Ga0496116_0081550 Ga0496116_0081550_844_1644 222
367 3300048921 Ga0496118_0012902 Ga0496118_0012902_480_1280 222
368 3300048921 Ga0496118_0103897 Ga0496118_0103897_472_1305 222
369 3300048924 Ga0496121_0107320 Ga0496121_0107320_805_1602 222
370 3300048925 Ga0496122_0020518 Ga0496122_0020518_2298_3098 222
371 3300048927 Ga0496124_0092175 Ga0496124_0092175_1471_2271 222
372 3300049568 Ga0501031_0000002 Ga0501031_0000002_5908_6741 222
373 3300049569 Ga0501032_0000004 Ga0501032_0000004_210882_211715 222
374 3300049569 Ga0501032_0137719 Ga0501032_0137719_334_1155 222
375 3300049570 Ga0501033_0000016 Ga0501033_0000016_5780_6613 222
376 3300049570 Ga0501033_0034506 Ga0501033_0034506_1913_2734 222
377 3300049570 Ga0501033_0048150 Ga0501033_0048150_2272_3141 222
378 3300049570 Ga0501033_0087342 Ga0501033_0087342_1008_1829 222
379 3300049571 Ga0501034_0000011 Ga0501034_0000011_210882_211715 222
380 3300049571 Ga0501034_0145506 Ga0501034_0145506_339_1160 222
381 3300049572 Ga0501036_0000001 Ga0501036_0000001_210882_211715 222
382 3300049572 Ga0501036_0048688 Ga0501036_0048688_1009_1830 222
383 3300049572 Ga0501036_0134885 Ga0501036_0134885_1008_1829 222
384 3300049573 Ga0501037_0000006 Ga0501037_0000006_5747_6580 222
385 3300049573 Ga0501037_0158630 Ga0501037_0158630_454_1275 222
386 3300049574 Ga0501038_0000003 Ga0501038_0000003_210882_211715 222
387 3300049575 Ga0501039_0000004 Ga0501039_0000004_210882_211715 222
388 3300049576 Ga0501040_0000812 Ga0501040_0000812_5742_6575 222
389 3300049579 Ga0501043_0000155 Ga0501043_0000155_5900_6733 222
390 3300049579 Ga0501043_0023666 Ga0501043_0023666_454_1275 222
391 3300049580 Ga0501046_0111017 Ga0501046_0111017_1009_1830 222
392 3300049581 Ga0501047_0001325 Ga0501047_0001325_6752_7585 222
393 3300049581 Ga0501047_0091596 Ga0501047_0091596_1759_2580 222
394 3300049585 Ga0501069_0130311 Ga0501069_0130311_89_910 222
395 3300049586 Ga0501070_0072579 Ga0501070_0072579_704_1537 222
396 3300049586 Ga0501070_0101440 Ga0501070_0101440_687_1508 222
397 3300049587 Ga0501071_0011591 Ga0501071_0011591_1445_2266 222
398 3300049589 Ga0501073_0124614 Ga0501073_0124614_862_1683 222
399 3300049590 Ga0501074_0049240 Ga0501074_0049240_929_1750 222
400 3300049742 Ga0501080_0067410 Ga0501080_0067410_281_1102 222
401 3300049744 Ga0501083_0198415 Ga0501083_0198415_148_969 222
402 3300049822 Ga0501035_0000009 Ga0501035_0000009_99113_99946 222
403 3300049822 Ga0501035_0035300 Ga0501035_0035300_1413_2234 222
404 3300049822 Ga0501035_0051827 Ga0501035_0051827_1843_2664 222
405 3300049823 Ga0501044_0000005 Ga0501044_0000005_210882_211715 222
406 3300049823 Ga0501044_0044487 Ga0501044_0044487_2777_3598 222
407 3300049823 Ga0501044_0128683 Ga0501044_0128683_363_1184 222
408 3300049824 Ga0501045_0016795 Ga0501045_0016795_3652_4473 222
409 3300050516 nmdc:mga0sz30_102453_c1 nmdc:mga0sz30_102453_c1_198_998 222
410 3300053156 Ga0500622_0000443 Ga0500622_0000443_7578_8378 222
411 iso_pu_bacteria 2920107658 2920109302 223
412 iso_pu_bacteria 2643221562 2643828732 224
413 iso_pu_bacteria 2791355137 2792835421 224
414 iso_pu_bacteria 2904615490 2904620102 224
415 iso_pu_bacteria 2928163908 2928168514 224
416 iso_pu_bacteria 2981990288 2981994772 224
417 iso_pu_bacteria 2721755763 2723878002 225
418 3300046524 Ga0495648_0084991 Ga0495648_0084991_304_1065 227
419 3300053156 Ga0500622_0180589 Ga0500622_0180589_73_834 227
420 3300001989 JGI24739J22299_10099887 JGI24739J22299_100998871 228
421 3300003790 Ga0055528_1013944 Ga0055528_10139442 228
422 3300005327 Ga0070658_10042049 Ga0070658_100420494 228
423 3300005339 Ga0070660_100002350 Ga0070660_1000023508 228
424 3300009093 Ga0105240_10018071 Ga0105240_100180714 228
425 3300015262 Ga0182007_10004893 Ga0182007_100048934 228
426 3300025273 Ga0209673_1000030 Ga0209673_1000030109 228
427 3300025295 Ga0209564_1015226 Ga0209564_10152264 228
428 3300025913 Ga0207695_10013244 Ga0207695_1001324410 228
429 3300025913 Ga0207695_10063071 Ga0207695_100630713 228
430 3300027312 Ga0209371_1000079 Ga0209371_100007949 228
431 3300030500 Ga0268256_1000090 Ga0268256_100009052 228
432 3300039437 Ga0436365_1735717 Ga0436365_1735717_1135_1899 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

1

267

0.98

PF00578

AhpC-TSA

AhpC/TSA family

37

165

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gkn-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.7977 50 137
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.786 40 137
3ixr-assembly1.cif.gz_A crystal structure of xylella fastidiosa prxq c47s mutant 0.78 46 137
2lrn-assembly1.cif.gz_A solution structure of a thiol:disulfide interchange protein from bacteroides sp. 0.7792 38 136
5ykj-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.7625 40 135
ID Description Score Start End Superfamily
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7709 40 137 3.40.30.10
af_A0A1D6L317_60_192_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7677 50 135 3.40.30.10
af_I6YGW6_98_222_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7559 68 140 3.40.30.10
5epfA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7484 43 137 3.40.30.10
4eo3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7466 43 135 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7W6R958-F1-model_v4 Putative dithiol-disulfide oxidoreductase (DUF899 family) 0.9334 2 139
AF-A0A7Y3K0R7-F1-model_v4 DUF899 domain-containing protein 0.9078 1 139
AF-A0A0S4UB57-F1-model_v4 Uncharacterized protein 0.9072 1 139
AF-A0A4Q3JDN4-F1-model_v4 DUF899 domain-containing protein 0.8955 2 139
AF-A0A845HT60-F1-model_v4 DUF899 domain-containing protein 0.8949 30 199

Feature Viewer

pLDDT pTM Quality
77.63 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map