F442679

General Info

Members Datasets Scaffolds Average Seq Length
432 306 428 248

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0017382|Ga0495610_0017382_454_1335
Length 293
Sequence MSSKGGDNGEFDFSAGAPARQPRKTPPVGVAPAAADPADPALALANARRAVGAAAGIAVHVAGLDWQAIADELNAHGYAIVPGMLSADESAAMAAQYAQAPLFRSRVVMARHGFGSGEYQYFRYPLPSMIAALRQALYGPLAAIANRWHEALDIDTRFPADHADFLARCHAAGQNRPTPLLLQYGAGDYNCLHQDLYGEHVFPLQAAILLSEPGTDFDGGEFVLTEQRPRMQSRVEVVPLRRGDMVIFPVNHRPVQGARGVYRVAMRHGVSRLRAASGKALRHTLGLIFHDAE

Samples

Sample ID Description Type Environment
1 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2818991436 Collimonas arenae 515 Isolate Unclassified
4 2904424332 Duganella sp. 1411 Isolate Rhizosphere
5 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
9 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
14 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
15 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
18 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
19 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
20 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
21 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
22 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
23 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
26 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
32 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
36 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
37 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
38 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
39 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
40 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
47 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
48 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
51 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
101 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
112 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
130 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
138 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
140 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
141 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
144 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
145 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
151 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
153 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
205 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
206 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
210 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
213 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
218 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
227 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
252 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
253 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
258 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
259 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
263 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
264 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
271 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
272 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
273 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
274 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
275 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
276 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
277 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
278 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
299 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
300 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
301 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
302 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
303 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
304 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0.23
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.27
Nodule 0.23
Rhizoplane 4.17
Rhizosphere 80.79
Stem 0
Stem Tuber 0
Unclassified 2.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24749J21850_1002332 3300002076 Bacteria 2672
2 JGI25162J39368_1000027 3300002737 Bacteria 223163
3 JGI25162J39368_1001922 3300002737 Bacteria 9484
4 JGI25157J39369_1000283 3300002741 Bacteria 36962
5 JGI25157J39369_1001173 3300002741 Bacteria 11207
6 JGI25163J39215_1000164 3300002771 Bacteria 26248
7 JGI25164J39214_1000040 3300002772 Bacteria 127780
8 JGI25406J46586_10000861 3300003203 Bacteria 14319
9 JGI25406J46586_10009247 3300003203 Bacteria 4418
10 JGI25165J46597_1000009 3300003214 Bacteria 467965
11 JGI25165J46597_1000031 3300003214 Bacteria 296858
12 rootL2_10035437 3300003322 Bacteria 2696
13 Ga0055538_1000018 3300003751 Bacteria 296858
14 Ga0055538_1001135 3300003751 Bacteria 5735
15 Ga0055539_1000023 3300003752 Bacteria 296858
16 Ga0055533_1000031 3300003756 Bacteria 296858
17 Ga0055525_1000039 3300003759 Bacteria 296858
18 Ga0055535_1000048 3300003761 Bacteria 139301
19 Ga0055542_1001441 3300003762 Bacteria 11861
20 Ga0055529_1000188 3300003763 Bacteria 85016
21 Ga0055529_1000271 3300003763 Bacteria 61698
22 Ga0055526_1003040 3300003771 Bacteria 10907
23 Ga0055537_1000081 3300003773 Bacteria 69775
24 Ga0055534_1000072 3300003784 Bacteria 78212
25 Ga0055528_1000094 3300003790 Bacteria 71337
26 Ga0055530_10002331 3300003791 Bacteria 12406
27 Ga0055530_10013672 3300003791 Bacteria 2755
28 Ga0055541_1000016 3300003841 Bacteria 296861
29 Ga0065715_10371465 3300005293 Bacteria 920
30 Ga0070676_10086873 3300005328 Bacteria 1908
31 Ga0070683_100013050 3300005329 Bacteria 7235
32 Ga0070683_100055909 3300005329 Bacteria 3663
33 Ga0070690_100027081 3300005330 Bacteria 3541
34 Ga0070690_100046953 3300005330 Bacteria 2746
35 Ga0070670_100132685 3300005331 Bacteria 2151
36 Ga0070670_100141224 3300005331 Bacteria 2083
37 Ga0070677_10001445 3300005333 Bacteria 7527
38 Ga0070677_10006882 3300005333 Bacteria 3779
39 Ga0070677_10039397 3300005333 Bacteria 1854
40 Ga0068869_100005151 3300005334 Bacteria 8201
41 Ga0068869_100408206 3300005334 Bacteria 1118
42 Ga0070666_10123776 3300005335 Bacteria 1794
43 Ga0070680_100012621 3300005336 Bacteria 6567
44 Ga0070682_100195806 3300005337 Bacteria 1422
45 Ga0068868_100204369 3300005338 Bacteria 1648
46 Ga0068868_100847919 3300005338 Bacteria 827
47 Ga0070660_100003001 3300005339 Bacteria 11625
48 Ga0070660_100058223 3300005339 Bacteria 2995
49 Ga0070687_100114012 3300005343 Bacteria 1535
50 Ga0070661_100128855 3300005344 Bacteria 1899
51 Ga0070692_10017873 3300005345 Bacteria 3399
52 Ga0070669_100097943 3300005353 Bacteria 2208
53 Ga0070669_100250623 3300005353 Bacteria 1410
54 Ga0070675_100036483 3300005354 Bacteria 4001
55 Ga0070675_100230235 3300005354 Bacteria 1616
56 Ga0070671_100313940 3300005355 Bacteria 1335
57 Ga0070674_100003486 3300005356 Bacteria 8837
58 Ga0070674_100064662 3300005356 Bacteria 2564
59 Ga0070674_100096590 3300005356 Bacteria 2144
60 Ga0070673_100059566 3300005364 Bacteria 3023
61 Ga0070673_100181443 3300005364 Bacteria 1802
62 Ga0070688_100168786 3300005365 Bacteria 1508
63 Ga0070659_100118415 3300005366 Bacteria 2142
64 Ga0070667_100013535 3300005367 Bacteria 6741
65 Ga0070713_100303208 3300005436 Bacteria 1471
66 Ga0070701_10010032 3300005438 Bacteria 4173
67 Ga0070700_100040096 3300005441 Bacteria 2865
68 Ga0070663_100110315 3300005455 Bacteria 2066
69 Ga0070663_100482288 3300005455 Bacteria 1027
70 Ga0070678_100014221 3300005456 Bacteria 5013
71 Ga0070678_100020815 3300005456 Bacteria 4310
72 Ga0070678_100686272 3300005456 Bacteria 921
73 Ga0070662_100039837 3300005457 Bacteria 3343
74 Ga0070662_100133133 3300005457 Bacteria 1919
75 Ga0070681_10057282 3300005458 Bacteria 3877
76 Ga0068867_100002156 3300005459 Bacteria 13800
77 Ga0070685_10026154 3300005466 Bacteria 3215
78 Ga0070685_10059841 3300005466 Bacteria 2225
79 Ga0070707_100049862 3300005468 Bacteria 4013
80 Ga0070698_100095454 3300005471 Bacteria 2951
81 Ga0070699_100059277 3300005518 Bacteria 3316
82 Ga0070679_100070354 3300005530 Bacteria 3491
83 Ga0070684_100005044 3300005535 Bacteria 10086
84 Ga0068853_100004408 3300005539 Bacteria 10900
85 Ga0068853_100037059 3300005539 Bacteria 4148
86 Ga0070672_100004006 3300005543 Bacteria 9604
87 Ga0070672_100009884 3300005543 Bacteria 6595
88 Ga0070686_100055276 3300005544 Bacteria 2542
89 Ga0070693_100336039 3300005547 Bacteria 1030
90 Ga0070665_100091930 3300005548 Bacteria 3039
91 Ga0070665_100140863 3300005548 Bacteria 2415
92 Ga0070704_100165446 3300005549 Bacteria 1753
93 Ga0068855_100050152 3300005563 Bacteria 4920
94 Ga0070664_100252533 3300005564 Bacteria 1585
95 Ga0068857_100166406 3300005577 Bacteria 2002
96 Ga0068857_100734720 3300005577 Bacteria 939
97 Ga0068854_100254863 3300005578 Bacteria 1403
98 Ga0070702_100013504 3300005615 Bacteria 4123
99 Ga0070702_100115420 3300005615 Bacteria 1672
100 Ga0068852_100090992 3300005616 Bacteria 2730
101 Ga0068852_100153382 3300005616 Bacteria 2144
102 Ga0068859_100071958 3300005617 Bacteria 3493
103 Ga0068859_100073027 3300005617 Bacteria 3468
104 Ga0068859_101020764 3300005617 Bacteria 909
105 Ga0068864_100059583 3300005618 Bacteria 3303
106 Ga0068864_100081191 3300005618 Bacteria 2842
107 Ga0068866_10000859 3300005718 Bacteria 13455
108 Ga0068866_10003204 3300005718 Bacteria 6744
109 Ga0068866_10066520 3300005718 Bacteria 1889
110 Ga0068861_100342618 3300005719 Bacteria 1308
111 Ga0068851_10002001 3300005834 Bacteria 8977
112 Ga0068851_10022062 3300005834 Bacteria 3098
113 Ga0068870_10001807 3300005840 Bacteria 8779
114 Ga0068863_100030447 3300005841 Bacteria 5153
115 Ga0068858_100004552 3300005842 Bacteria 13578
116 Ga0068858_100032370 3300005842 Bacteria 4856
117 Ga0068860_100029197 3300005843 Bacteria 5304
118 Ga0068862_100341665 3300005844 Bacteria 1387
119 Ga0081540_1000310 3300005983 Bacteria 50366
120 Ga0081539_10000029 3300005985 Bacteria 322399
121 Ga0075365_10157293 3300006038 Bacteria 1582
122 Ga0070716_100285692 3300006173 Bacteria 1141
123 Ga0097621_100154441 3300006237 Bacteria 1969
124 Ga0075428_100001968 3300006844 Bacteria 22114
125 Ga0075428_100178815 3300006844 Bacteria 2297
126 Ga0075430_100208650 3300006846 Bacteria 1621
127 Ga0075431_100000110 3300006847 Bacteria 52121
128 Ga0075433_10211467 3300006852 Bacteria 1723
129 Ga0075434_100806876 3300006871 Bacteria 955
130 Ga0075429_100005774 3300006880 Bacteria 10684
131 Ga0075429_100503994 3300006880 Bacteria 1061
132 Ga0068865_100229197 3300006881 Bacteria 1456
133 Ga0075436_100028457 3300006914 Bacteria 3845
134 Ga0097620_100071958 3300006931 Bacteria 3493
135 Ga0097620_100073026 3300006931 Bacteria 3468
136 Ga0097620_101020784 3300006931 Bacteria 909
137 Ga0075435_100008604 3300007076 Bacteria 7333
138 Ga0075435_100696240 3300007076 Bacteria 883
139 Ga0099795_10000196 3300007788 Bacteria 10202
140 Ga0105244_10004820 3300009036 Bacteria 9158
141 Ga0105240_10026622 3300009093 Bacteria 7589
142 Ga0111539_10000570 3300009094 Bacteria 47255
143 Ga0111539_10022111 3300009094 Bacteria 7816
144 Ga0105245_10029288 3300009098 Bacteria 4863
145 Ga0105245_10184175 3300009098 Bacteria 1997
146 Ga0105245_10834669 3300009098 Bacteria 961
147 Ga0105247_10466937 3300009101 Bacteria 913
148 Ga0114129_10000766 3300009147 Bacteria 41029
149 Ga0114129_10035365 3300009147 Bacteria 7057
150 Ga0114129_10355511 3300009147 Bacteria 1939
151 Ga0105243_10002310 3300009148 Bacteria 15968
152 Ga0105242_10044092 3300009176 Bacteria 3610
153 Ga0105248_10041386 3300009177 Bacteria 5165
154 Ga0105248_10144997 3300009177 Bacteria 2679
155 Ga0105248_11072141 3300009177 Bacteria 910
156 Ga0105237_10012336 3300009545 Bacteria 9004
157 Ga0105238_10015861 3300009551 Bacteria 7625
158 Ga0105249_10052498 3300009553 Bacteria 3723
159 Ga0105249_10118490 3300009553 Bacteria 2513
160 Ga0105239_10017391 3300010375 Bacteria 7952
161 Ga0105239_10100473 3300010375 Bacteria 3200
162 Ga0105246_10033754 3300011119 Bacteria 3404
163 Ga0157370_10027113 3300013104 Bacteria 5649
164 Ga0157369_10015050 3300013105 Bacteria 8730
165 Ga0157378_10106390 3300013297 Bacteria 2566
166 Ga0163162_10003048 3300013306 Bacteria 16006
167 Ga0163162_10400587 3300013306 Bacteria 1505
168 Ga0157372_10750448 3300013307 Bacteria 1135
169 Ga0157375_10004413 3300013308 Bacteria 12214
170 Ga0163163_10014985 3300014325 Bacteria 7146
171 Ga0163163_10075672 3300014325 Bacteria 3360
172 Ga0163163_10185546 3300014325 Bacteria 2128
173 Ga0157380_10031517 3300014326 Bacteria 4070
174 Ga0157380_10046086 3300014326 Bacteria 3423
175 Ga0157377_10030847 3300014745 Bacteria 2908
176 Ga0157379_10034883 3300014968 Bacteria 4486
177 Ga0157376_10026374 3300014969 Bacteria 4591
178 Ga0157376_10117664 3300014969 Bacteria 2350
179 Ga0182006_1006518 3300015261 Bacteria 5416
180 Ga0182005_1000726 3300015265 Bacteria 15119
181 Ga0163161_10003943 3300017792 Bacteria 10412
182 Ga0163161_10159521 3300017792 Bacteria 1719
183 Ga0209435_100847 3300025206 Bacteria 4769
184 Ga0209760_100647 3300025207 Bacteria 5752
185 Ga0209784_100013 3300025224 Bacteria 518664
186 Ga0209784_100027 3300025224 Bacteria 363933
187 Ga0209566_100027 3300025225 Bacteria 363933
188 Ga0209674_100044 3300025226 Bacteria 363933
189 Ga0209672_102241 3300025228 Bacteria 4991
190 Ga0209563_100048 3300025230 Bacteria 363933
191 Ga0207427_100030 3300025231 Bacteria 358045
192 Ga0207427_100369 3300025231 Bacteria 27439
193 Ga0209437_100012 3300025233 Bacteria 792625
194 Ga0209437_100055 3300025233 Bacteria 363933
195 Ga0209258_100019 3300025242 Bacteria 566728
196 Ga0209646_1000642 3300025246 Bacteria 13101
197 Ga0209026_1000015 3300025250 Bacteria 395555
198 Ga0209677_100028 3300025253 Bacteria 363933
199 Ga0209148_1000001 3300025254 Bacteria 2545271
200 Ga0209759_1000144 3300025256 Bacteria 121828
201 Ga0209233_1000002 3300025261 Bacteria 2501366
202 Ga0209233_1000070 3300025261 Bacteria 363933
203 Ga0209565_1000006 3300025263 Bacteria 897294
204 Ga0209565_1015156 3300025263 Bacteria 1745
205 Ga0207666_1002957 3300025271 Bacteria 2066
206 Ga0209455_1000027 3300025272 Bacteria 566710
207 Ga0209455_1000051 3300025272 Bacteria 369818
208 Ga0209673_1000004 3300025273 Bacteria 896155
209 Ga0209675_1000006 3300025291 Bacteria 732267
210 Ga0209564_1000085 3300025295 Bacteria 251509
211 Ga0209050_1000171 3300025298 Bacteria 150524
212 Ga0209256_1000037 3300025299 Bacteria 377661
213 Ga0207697_10001936 3300025315 Bacteria 10998
214 Ga0207697_10213363 3300025315 Bacteria 851
215 Ga0207656_10017390 3300025321 Bacteria 2816
216 Ga0207682_10000740 3300025893 Bacteria 15117
217 Ga0207682_10001317 3300025893 Bacteria 11413
218 Ga0207682_10022923 3300025893 Bacteria 2463
219 Ga0207642_10114812 3300025899 Bacteria 1378
220 Ga0207710_10014391 3300025900 Bacteria 3336
221 Ga0207688_10000602 3300025901 Bacteria 17683
222 Ga0207645_10000682 3300025907 Bacteria 28134
223 Ga0207645_10023348 3300025907 Bacteria 4020
224 Ga0207643_10000480 3300025908 Bacteria 25852
225 Ga0207707_10002705 3300025912 Bacteria 15850
226 Ga0207695_10189728 3300025913 Bacteria 1973
227 Ga0207671_10009638 3300025914 Bacteria 8050
228 Ga0207693_10085626 3300025915 Bacteria 2469
229 Ga0207660_10006961 3300025917 Bacteria 7324
230 Ga0207662_10006414 3300025918 Bacteria 6349
231 Ga0207662_10071630 3300025918 Bacteria 2099
232 Ga0207657_10006890 3300025919 Bacteria 11724
233 Ga0207657_10008136 3300025919 Bacteria 10690
234 Ga0207649_10038150 3300025920 Bacteria 2907
235 Ga0207649_10542743 3300025920 Bacteria 889
236 Ga0207652_10001690 3300025921 Bacteria 19300
237 Ga0207646_10216864 3300025922 Bacteria 1728
238 Ga0207646_10224917 3300025922 Bacteria 1695
239 Ga0207694_10005031 3300025924 Bacteria 10225
240 Ga0207650_10031721 3300025925 Bacteria 3817
241 Ga0207650_10135709 3300025925 Bacteria 1930
242 Ga0207659_10061888 3300025926 Bacteria 2699
243 Ga0207659_10153098 3300025926 Bacteria 1802
244 Ga0207687_10072440 3300025927 Bacteria 2465
245 Ga0207687_10430076 3300025927 Bacteria 1091
246 Ga0207700_10329043 3300025928 Bacteria 1326
247 Ga0207644_10040337 3300025931 Bacteria 3299
248 Ga0207644_10115855 3300025931 Bacteria 2033
249 Ga0207706_10002666 3300025933 Bacteria 17381
250 Ga0207706_10006029 3300025933 Bacteria 11274
251 Ga0207709_10057576 3300025935 Bacteria 2411
252 Ga0207709_10150295 3300025935 Bacteria 1612
253 Ga0207670_10257050 3300025936 Bacteria 1352
254 Ga0207669_10000687 3300025937 Bacteria 14602
255 Ga0207669_10008749 3300025937 Bacteria 4774
256 Ga0207669_10181743 3300025937 Bacteria 1508
257 Ga0207691_10003047 3300025940 Bacteria 16343
258 Ga0207691_10003937 3300025940 Bacteria 14428
259 Ga0207691_10013226 3300025940 Bacteria 7904
260 Ga0207691_10067244 3300025940 Bacteria 3240
261 Ga0207711_10123890 3300025941 Bacteria 2310
262 Ga0207711_10135864 3300025941 Bacteria 2208
263 Ga0207689_10005887 3300025942 Bacteria 10861
264 Ga0207689_10011404 3300025942 Bacteria 7617
265 Ga0207661_10008424 3300025944 Bacteria 7371
266 Ga0207679_10140460 3300025945 Bacteria 1952
267 Ga0207667_10002017 3300025949 Bacteria 25487
268 Ga0207651_10047228 3300025960 Bacteria 2901
269 Ga0207712_10034681 3300025961 Bacteria 3421
270 Ga0207668_10080392 3300025972 Bacteria 2361
271 Ga0207640_10092244 3300025981 Bacteria 2100
272 Ga0207640_10145035 3300025981 Bacteria 1736
273 Ga0207658_10014146 3300025986 Bacteria 5465
274 Ga0207658_10120419 3300025986 Bacteria 2091
275 Ga0207677_10135659 3300026023 Bacteria 1876
276 Ga0207703_10011456 3300026035 Bacteria 6896
277 Ga0207639_10014358 3300026041 Bacteria 5569
278 Ga0207678_10096219 3300026067 Bacteria 2530
279 Ga0207708_10051399 3300026075 Bacteria 3137
280 Ga0207641_10024549 3300026088 Bacteria 4968
281 Ga0207641_10111511 3300026088 Bacteria 2426
282 Ga0207641_10554636 3300026088 Bacteria 1121
283 Ga0207648_10003810 3300026089 Bacteria 15766
284 Ga0207648_10084202 3300026089 Bacteria 2773
285 Ga0207676_10035090 3300026095 Bacteria 3803
286 Ga0207676_10038841 3300026095 Bacteria 3636
287 Ga0207676_10043823 3300026095 Bacteria 3447
288 Ga0207674_10010464 3300026116 Bacteria 10503
289 Ga0207674_10193915 3300026116 Bacteria 1981
290 Ga0207675_100007771 3300026118 Bacteria 10117
291 Ga0207675_100022204 3300026118 Bacteria 5909
292 Ga0207683_10001539 3300026121 Bacteria 20788
293 Ga0207683_10013421 3300026121 Bacteria 6987
294 Ga0207683_10077383 3300026121 Bacteria 2946
295 Ga0207698_10039949 3300026142 Bacteria 3480
296 Ga0207428_10044203 3300027907 Bacteria 3594
297 Ga0207428_10105674 3300027907 Bacteria 2171
298 Ga0265357_1001015 3300028023 Bacteria 1925
299 Ga0268266_10114965 3300028379 Bacteria 2388
300 Ga0268266_10140155 3300028379 Bacteria 2169
301 Ga0268264_10144795 3300028381 Bacteria 2123
302 Ga0265763_1003194 3300030763 Bacteria 1293
303 Ga0307416_100039042 3300032002 Bacteria 3670
304 Ga0307510_10023885 3300033180 Bacteria 7075
305 Ga0373954_0005323 3300035118 Bacteria 5561
306 Ga0373957_0025351 3300035120 Bacteria 2136
307 Ga0373943_0025928 3300035170 Bacteria 2742
308 Ga0373955_0000981 3300035172 Bacteria 12130
309 Ga0373961_0004151 3300035241 Bacteria 3520
310 Ga0373931_0086352 3300035691 Bacteria 1741
311 Ga0373931_0200787 3300035691 Bacteria 1191
312 Ga0373927_0056159 3300035695 Bacteria 2545
313 Ga0373933_0004700 3300035724 Bacteria 7477
314 Ga0373947_0000714 3300035725 Bacteria 19784
315 Ga0373937_0000018 3300036401 Bacteria 144056
316 Ga0373925_0000055 3300037068 Bacteria 123638
317 Ga0373925_0051676 3300037068 Bacteria 3069
318 Ga0373925_0642689 3300037068 Bacteria 874
319 Ga0439459_0024335 3300042438 Bacteria 1187
320 Ga0495627_000066 3300046453 Bacteria 130363
321 Ga0495592_0000430 3300046454 Bacteria 31720
322 Ga0495592_0130238 3300046454 Bacteria 1760
323 Ga0495629_0001782 3300046459 Bacteria 16887
324 Ga0495641_0180721 3300046461 Bacteria 944
325 Ga0495651_0109504 3300046462 Bacteria 2044
326 Ga0495653_0000003 3300046463 Bacteria 377892
327 Ga0495653_0032133 3300046463 Bacteria 4170
328 Ga0495662_0004077 3300046476 Bacteria 7356
329 Ga0495664_0000001 3300046477 Bacteria 757730
330 Ga0495608_0000033 3300046511 Bacteria 141349
331 Ga0495608_0091701 3300046511 Bacteria 1964
332 Ga0495610_0017382 3300046512 Bacteria 4103
333 Ga0495618_0000012 3300046514 Bacteria 170881
334 Ga0495618_0076388 3300046514 Bacteria 2134
335 Ga0495628_0000003 3300046516 Bacteria 470339
336 Ga0495630_0000443 3300046517 Bacteria 31450
337 Ga0495643_0015407 3300046522 Bacteria 4518
338 Ga0495652_0000001 3300046529 Bacteria 1045081
339 Ga0495652_0030594 3300046529 Bacteria 4719
340 Ga0495665_0026791 3300046531 Bacteria 3096
341 Ga0495640_0000022 3300046533 Bacteria 101825
342 Ga0495587_0000003 3300046536 Bacteria 424188
343 Ga0495598_0003584 3300046537 Bacteria 3311
344 Ga0495609_0000895 3300046538 Bacteria 21726
345 Ga0495645_0000004 3300046543 Bacteria 532661
346 Ga0495622_0000032 3300046557 Bacteria 125538
347 Ga0495633_0000321 3300046558 Bacteria 54191
348 Ga0495667_0000001 3300046559 Bacteria 834831
349 Ga0495634_0000163 3300046642 Bacteria 60720
350 Ga0495625_0054255 3300046660 Bacteria 2863
351 Ga0495635_0000011 3300046663 Bacteria 240094
352 Ga0495635_0336102 3300046663 Bacteria 1009
353 Ga0495657_0000061 3300046675 Bacteria 96199
354 Ga0495657_0100284 3300046675 Bacteria 1846
355 Ga0495599_0000004 3300046678 Bacteria 316231
356 Ga0495599_0008678 3300046678 Bacteria 6185
357 Ga0495623_0000020 3300046679 Bacteria 100523
358 Ga0495646_0000006 3300046680 Bacteria 258496
359 Ga0495646_0059991 3300046680 Bacteria 2270
360 Ga0495658_0086310 3300046683 Bacteria 1851
361 Ga0495613_0027238 3300046689 Bacteria 4253
362 Ga0495624_0019398 3300046690 Bacteria 4540
363 Ga0495600_0000029 3300046809 Bacteria 89914
364 Ga0495600_0000669 3300046809 Bacteria 17848
365 Ga0495660_0001356 3300046810 Bacteria 16839
366 Ga0495581_0001742 3300047315 Bacteria 12134
367 Ga0495604_0000018 3300047317 Bacteria 181417
368 Ga0495604_0024081 3300047317 Bacteria 4859
369 Ga0495674_0000001 3300047319 Bacteria 778665
370 Ga0495680_0000147 3300047322 Bacteria 70915
371 Ga0495675_0000034 3300047444 Bacteria 97963
372 Ga0495681_0134618 3300047470 Bacteria 1049
373 Ga0495684_0000005 3300047471 Bacteria 291932
374 Ga0495593_0001779 3300047673 Bacteria 12762
375 Ga0495602_0000002 3300048088 Bacteria 422216
376 Ga0495602_0018872 3300048088 Bacteria 6868
377 Ga0495615_0058911 3300048090 Bacteria 1008
378 Ga0496103_0009845 3300048906 Bacteria 5659
379 Ga0496104_0007245 3300048907 Bacteria 9787
380 Ga0496104_0307463 3300048907 Bacteria 1498
381 Ga0496104_0559314 3300048907 Bacteria 1054
382 Ga0496105_0069232 3300048908 Bacteria 2916
383 Ga0496106_0041858 3300048909 Bacteria 3434
384 Ga0496106_0057143 3300048909 Bacteria 2950
385 Ga0496107_0075702 3300048910 Bacteria 2450
386 Ga0496108_0090929 3300048911 Bacteria 2594
387 Ga0496108_0411991 3300048911 Bacteria 1180
388 Ga0496109_0063967 3300048912 Bacteria 3365
389 Ga0496110_0013548 3300048913 Bacteria 6747
390 Ga0496110_0130928 3300048913 Bacteria 2265
391 Ga0496111_0239211 3300048914 Bacteria 1348
392 Ga0496112_0149821 3300048915 Bacteria 2300
393 Ga0496114_0035986 3300048917 Bacteria 4091
394 Ga0496114_0204545 3300048917 Bacteria 1730
395 Ga0496115_0049993 3300048918 Bacteria 3348
396 Ga0496126_0002382 3300048929 Bacteria 25580
397 Ga0501039_0063638 3300049575 Bacteria 2858
398 Ga0501042_0134119 3300049578 Bacteria 1785
399 Ga0501046_0034886 3300049580 Bacteria 4057
400 Ga0501068_0309237 3300049584 Bacteria 1012
401 Ga0501074_0087465 3300049590 Bacteria 2232
402 Ga0501077_0026450 3300049593 Bacteria 3683
403 Ga0501081_0021748 3300049743 Bacteria 4283
404 Ga0501269_000139 3300049766 Bacteria 22715
405 nmdc:mga06z11_139158_c1 3300050494 Bacteria 1370
406 nmdc:mga05p37_160_c1 3300050507 Bacteria 64997
407 nmdc:mga05p37_245068_c1 3300050507 Bacteria 2152
408 nmdc:mga09592_6352_c1 3300050508 Bacteria 9630
409 nmdc:mga09592_692638_c1 3300050508 Bacteria 868
410 nmdc:mga0qj67_79059_c1 3300050509 Bacteria 2633
411 nmdc:mga06r32_164372_c1 3300050510 Bacteria 2202
412 nmdc:mga06r32_3114_c1 3300050510 Bacteria 14854
413 nmdc:mga06r32_837405_c1 3300050510 Bacteria 879
414 nmdc:mga08y16_44897_c1 3300050511 Bacteria 4631
415 nmdc:mga0n895_226220_c1 3300050512 Bacteria 1899
416 nmdc:mga0n895_847681_c1 3300050512 Bacteria 902
417 Ga0495601_0000003 3300053077 Bacteria 493642
418 Ga0495601_0072229 3300053077 Bacteria 2204
419 Ga0495601_0165500 3300053077 Bacteria 1445
420 Ga0495612_0000007 3300053078 Bacteria 253300
421 Ga0495595_0000197 3300053084 Bacteria 24481
422 Ga0495619_0000009 3300053085 Bacteria 305595
423 Ga0500595_003574 3300053119 Bacteria 7223
424 Ga0500574_000199 3300053141 Bacteria 7107
425 Ga0500616_0043577 3300053153 Bacteria 2398
426 Ga0500619_026192 3300053154 Bacteria 1734
427 Ga0501082_0188399 3300060353 Bacteria 1795
428 Ga0530510_0022292 3300061734 Bacteria 4510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046660 Ga0495625_0054255 Ga0495625_0054255_1111_2052 229
2 3300046453 Ga0495627_000066 Ga0495627_000066_112441_113253 232
3 3300046522 Ga0495643_0015407 Ga0495643_0015407_796_1608 232
4 3300046538 Ga0495609_0000895 Ga0495609_0000895_12910_13722 232
5 3300046810 Ga0495660_0001356 Ga0495660_0001356_6828_7658 232
6 3300032002 Ga0307416_100039042 Ga0307416_1000390422 233
7 3300048906 Ga0496103_0009845 Ga0496103_0009845_99_1055 235
8 3300005548 Ga0070665_100140863 Ga0070665_1001408633 236
9 3300028379 Ga0268266_10114965 Ga0268266_101149652 236
10 3300046461 Ga0495641_0180721 Ga0495641_0180721_109_867 236
11 3300053077 Ga0495601_0165500 Ga0495601_0165500_553_1266 237
12 3300007788 Ga0099795_10000196 Ga0099795_100001961 238
13 3300035241 Ga0373961_0004151 Ga0373961_0004151_1322_2038 238
14 3300003771 Ga0055526_1003040 Ga0055526_10030406 239
15 3300003773 Ga0055537_1000081 Ga0055537_10000816 239
16 3300003784 Ga0055534_1000072 Ga0055534_10000724 239
17 3300003790 Ga0055528_1000094 Ga0055528_100009438 239
18 3300025263 Ga0209565_1000006 Ga0209565_1000006457 239
19 3300025273 Ga0209673_1000004 Ga0209673_1000004372 239
20 3300025291 Ga0209675_1000006 Ga0209675_1000006456 239
21 3300025295 Ga0209564_1000085 Ga0209564_1000085181 239
22 3300025299 Ga0209256_1000037 Ga0209256_1000037216 239
23 3300048907 Ga0496104_0559314 Ga0496104_0559314_41_760 239
24 3300048911 Ga0496108_0411991 Ga0496108_0411991_425_1144 239
25 3300060353 Ga0501082_0188399 Ga0501082_0188399_12_743 239
26 iso_pu_bacteria 2643221554 2643788854 239
27 3300003791 Ga0055530_10002331 Ga0055530_100023313 240
28 3300003791 Ga0055530_10013672 Ga0055530_100136722 240
29 3300025263 Ga0209565_1015156 Ga0209565_10151562 240
30 3300025298 Ga0209050_1000171 Ga0209050_10001714 240
31 3300006173 Ga0070716_100285692 Ga0070716_1002856921 241
32 3300025945 Ga0207679_10140460 Ga0207679_101404602 242
33 3300035691 Ga0373931_0086352 Ga0373931_0086352_459_1199 242
34 3300048909 Ga0496106_0041858 Ga0496106_0041858_499_1239 242
35 3300005293 Ga0065715_10371465 Ga0065715_103714651 243
36 3300005330 Ga0070690_100027081 Ga0070690_1000270811 243
37 3300005331 Ga0070670_100141224 Ga0070670_1001412241 243
38 3300005333 Ga0070677_10001445 Ga0070677_100014453 243
39 3300005333 Ga0070677_10006882 Ga0070677_100068824 243
40 3300005333 Ga0070677_10039397 Ga0070677_100393972 243
41 3300005334 Ga0068869_100005151 Ga0068869_1000051512 243
42 3300005335 Ga0070666_10123776 Ga0070666_101237762 243
43 3300005338 Ga0068868_100204369 Ga0068868_1002043692 243
44 3300005338 Ga0068868_100847919 Ga0068868_1008479191 243
45 3300005343 Ga0070687_100114012 Ga0070687_1001140122 243
46 3300005353 Ga0070669_100097943 Ga0070669_1000979432 243
47 3300005353 Ga0070669_100250623 Ga0070669_1002506231 243
48 3300005354 Ga0070675_100036483 Ga0070675_1000364832 243
49 3300005356 Ga0070674_100003486 Ga0070674_1000034863 243
50 3300005356 Ga0070674_100096590 Ga0070674_1000965902 243
51 3300005364 Ga0070673_100059566 Ga0070673_1000595663 243
52 3300005365 Ga0070688_100168786 Ga0070688_1001687862 243
53 3300005367 Ga0070667_100013535 Ga0070667_1000135352 243
54 3300005441 Ga0070700_100040096 Ga0070700_1000400963 243
55 3300005455 Ga0070663_100482288 Ga0070663_1004822882 243
56 3300005456 Ga0070678_100014221 Ga0070678_1000142214 243
57 3300005456 Ga0070678_100020815 Ga0070678_1000208152 243
58 3300005457 Ga0070662_100039837 Ga0070662_1000398374 243
59 3300005459 Ga0068867_100002156 Ga0068867_10000215611 243
60 3300005466 Ga0070685_10059841 Ga0070685_100598412 243
61 3300005468 Ga0070707_100049862 Ga0070707_1000498623 243
62 3300005471 Ga0070698_100095454 Ga0070698_1000954541 243
63 3300005518 Ga0070699_100059277 Ga0070699_1000592772 243
64 3300005543 Ga0070672_100004006 Ga0070672_1000040064 243
65 3300005543 Ga0070672_100009884 Ga0070672_1000098842 243
66 3300005547 Ga0070693_100336039 Ga0070693_1003360392 243
67 3300005616 Ga0068852_100090992 Ga0068852_1000909922 243
68 3300005617 Ga0068859_100073027 Ga0068859_1000730272 243
69 3300005617 Ga0068859_101020764 Ga0068859_1010207641 243
70 3300005618 Ga0068864_100059583 Ga0068864_1000595832 243
71 3300005718 Ga0068866_10000859 Ga0068866_100008595 243
72 3300005718 Ga0068866_10066520 Ga0068866_100665202 243
73 3300005841 Ga0068863_100030447 Ga0068863_1000304474 243
74 3300005842 Ga0068858_100004552 Ga0068858_1000045529 243
75 3300005843 Ga0068860_100029197 Ga0068860_1000291974 243
76 3300005844 Ga0068862_100341665 Ga0068862_1003416652 243
77 3300006931 Ga0097620_100073026 Ga0097620_1000730262 243
78 3300006931 Ga0097620_101020784 Ga0097620_1010207841 243
79 3300009098 Ga0105245_10029288 Ga0105245_100292882 243
80 3300009098 Ga0105245_10834669 Ga0105245_108346692 243
81 3300009148 Ga0105243_10002310 Ga0105243_100023104 243
82 3300009177 Ga0105248_10041386 Ga0105248_100413862 243
83 3300009177 Ga0105248_10144997 Ga0105248_101449971 243
84 3300009553 Ga0105249_10052498 Ga0105249_100524983 243
85 3300013306 Ga0163162_10003048 Ga0163162_100030484 243
86 3300013308 Ga0157375_10004413 Ga0157375_100044134 243
87 3300014325 Ga0163163_10185546 Ga0163163_101855462 243
88 3300014326 Ga0157380_10031517 Ga0157380_100315173 243
89 3300014968 Ga0157379_10034883 Ga0157379_100348833 243
90 3300014969 Ga0157376_10026374 Ga0157376_100263742 243
91 3300014969 Ga0157376_10117664 Ga0157376_101176642 243
92 3300017792 Ga0163161_10003943 Ga0163161_100039438 243
93 3300025315 Ga0207697_10213363 Ga0207697_102133631 243
94 3300025893 Ga0207682_10001317 Ga0207682_100013178 243
95 3300025893 Ga0207682_10022923 Ga0207682_100229233 243
96 3300025899 Ga0207642_10114812 Ga0207642_101148122 243
97 3300025900 Ga0207710_10014391 Ga0207710_100143913 243
98 3300025907 Ga0207645_10000682 Ga0207645_1000068222 243
99 3300025918 Ga0207662_10006414 Ga0207662_100064147 243
100 3300025918 Ga0207662_10071630 Ga0207662_100716302 243
101 3300025922 Ga0207646_10224917 Ga0207646_102249172 243
102 3300025925 Ga0207650_10135709 Ga0207650_101357092 243
103 3300025926 Ga0207659_10153098 Ga0207659_101530983 243
104 3300025927 Ga0207687_10072440 Ga0207687_100724403 243
105 3300025927 Ga0207687_10430076 Ga0207687_104300761 243
106 3300025931 Ga0207644_10115855 Ga0207644_101158551 243
107 3300025933 Ga0207706_10002666 Ga0207706_1000266611 243
108 3300025935 Ga0207709_10057576 Ga0207709_100575764 243
109 3300025936 Ga0207670_10257050 Ga0207670_102570501 243
110 3300025937 Ga0207669_10000687 Ga0207669_100006878 243
111 3300025937 Ga0207669_10008749 Ga0207669_100087492 243
112 3300025940 Ga0207691_10003047 Ga0207691_100030477 243
113 3300025940 Ga0207691_10003937 Ga0207691_100039376 243
114 3300025940 Ga0207691_10013226 Ga0207691_100132262 243
115 3300025941 Ga0207711_10123890 Ga0207711_101238902 243
116 3300025942 Ga0207689_10005887 Ga0207689_100058877 243
117 3300025960 Ga0207651_10047228 Ga0207651_100472282 243
118 3300025961 Ga0207712_10034681 Ga0207712_100346813 243
119 3300025972 Ga0207668_10080392 Ga0207668_100803923 243
120 3300025986 Ga0207658_10014146 Ga0207658_100141462 243
121 3300026023 Ga0207677_10135659 Ga0207677_101356592 243
122 3300026035 Ga0207703_10011456 Ga0207703_100114564 243
123 3300026067 Ga0207678_10096219 Ga0207678_100962192 243
124 3300026075 Ga0207708_10051399 Ga0207708_100513992 243
125 3300026088 Ga0207641_10024549 Ga0207641_100245493 243
126 3300026088 Ga0207641_10111511 Ga0207641_101115112 243
127 3300026088 Ga0207641_10554636 Ga0207641_105546362 243
128 3300026089 Ga0207648_10003810 Ga0207648_100038106 243
129 3300026095 Ga0207676_10035090 Ga0207676_100350902 243
130 3300026095 Ga0207676_10038841 Ga0207676_100388412 243
131 3300026118 Ga0207675_100007771 Ga0207675_1000077712 243
132 3300026121 Ga0207683_10001539 Ga0207683_1000153916 243
133 3300026121 Ga0207683_10013421 Ga0207683_100134213 243
134 3300026142 Ga0207698_10039949 Ga0207698_100399493 243
135 3300042438 Ga0439459_0024335 Ga0439459_0024335_382_1125 243
136 3300046537 Ga0495598_0003584 Ga0495598_0003584_1683_2426 243
137 3300048090 Ga0495615_0058911 Ga0495615_0058911_148_891 243
138 3300048915 Ga0496112_0149821 Ga0496112_0149821_73_804 243
139 3300049575 Ga0501039_0063638 Ga0501039_0063638_562_1302 243
140 3300049578 Ga0501042_0134119 Ga0501042_0134119_621_1361 243
141 3300049584 Ga0501068_0309237 Ga0501068_0309237_140_880 243
142 3300049593 Ga0501077_0026450 Ga0501077_0026450_2579_3319 243
143 3300049743 Ga0501081_0021748 Ga0501081_0021748_3237_3977 243
144 3300061734 Ga0530510_0022292 Ga0530510_0022292_3310_4050 243
145 iso_pu_bacteria 2508501127 2509143857 243
146 iso_pu_bacteria 2818991436 2819543201 243
147 3300005615 Ga0070702_100115420 Ga0070702_1001154201 244
148 3300049766 Ga0501269_000139 Ga0501269_000139_935_1837 244
149 3300050494 nmdc:mga06z11_139158_c1 nmdc:mga06z11_139158_c1_607_1353 244
150 3300002737 JGI25162J39368_1000027 JGI25162J39368_1000027211 245
151 3300002737 JGI25162J39368_1001922 JGI25162J39368_10019226 245
152 3300002741 JGI25157J39369_1000283 JGI25157J39369_10002834 245
153 3300002741 JGI25157J39369_1001173 JGI25157J39369_10011736 245
154 3300002771 JGI25163J39215_1000164 JGI25163J39215_10001645 245
155 3300002772 JGI25164J39214_1000040 JGI25164J39214_1000040105 245
156 3300003203 JGI25406J46586_10000861 JGI25406J46586_100008613 245
157 3300003203 JGI25406J46586_10009247 JGI25406J46586_100092471 245
158 3300003214 JGI25165J46597_1000009 JGI25165J46597_1000009143 245
159 3300003214 JGI25165J46597_1000031 JGI25165J46597_100003175 245
160 3300003751 Ga0055538_1000018 Ga0055538_100001875 245
161 3300003751 Ga0055538_1001135 Ga0055538_10011357 245
162 3300003752 Ga0055539_1000023 Ga0055539_100002375 245
163 3300003756 Ga0055533_1000031 Ga0055533_1000031219 245
164 3300003759 Ga0055525_1000039 Ga0055525_100003975 245
165 3300003761 Ga0055535_1000048 Ga0055535_1000048131 245
166 3300003762 Ga0055542_1001441 Ga0055542_10014418 245
167 3300003763 Ga0055529_1000188 Ga0055529_100018838 245
168 3300003841 Ga0055541_1000016 Ga0055541_100001675 245
169 3300005985 Ga0081539_10000029 Ga0081539_10000029131 245
170 3300006038 Ga0075365_10157293 Ga0075365_101572932 245
171 3300015261 Ga0182006_1006518 Ga0182006_10065183 245
172 3300015265 Ga0182005_1000726 Ga0182005_100072614 245
173 3300025206 Ga0209435_100847 Ga0209435_1008474 245
174 3300025207 Ga0209760_100647 Ga0209760_1006475 245
175 3300025224 Ga0209784_100013 Ga0209784_100013355 245
176 3300025224 Ga0209784_100027 Ga0209784_10002776 245
177 3300025225 Ga0209566_100027 Ga0209566_10002776 245
178 3300025226 Ga0209674_100044 Ga0209674_10004476 245
179 3300025228 Ga0209672_102241 Ga0209672_1022416 245
180 3300025230 Ga0209563_100048 Ga0209563_10004876 245
181 3300025231 Ga0207427_100030 Ga0207427_100030156 245
182 3300025231 Ga0207427_100369 Ga0207427_10036912 245
183 3300025233 Ga0209437_100012 Ga0209437_100012606 245
184 3300025233 Ga0209437_100055 Ga0209437_10005576 245
185 3300025242 Ga0209258_100019 Ga0209258_100019183 245
186 3300025246 Ga0209646_1000642 Ga0209646_100064213 245
187 3300025250 Ga0209026_1000015 Ga0209026_1000015250 245
188 3300025253 Ga0209677_100028 Ga0209677_10002876 245
189 3300025254 Ga0209148_1000001 Ga0209148_10000012117 245
190 3300025256 Ga0209759_1000144 Ga0209759_100014416 245
191 3300025261 Ga0209233_1000002 Ga0209233_1000002183 245
192 3300025261 Ga0209233_1000070 Ga0209233_100007076 245
193 3300025272 Ga0209455_1000027 Ga0209455_1000027363 245
194 3300033180 Ga0307510_10023885 Ga0307510_100238853 245
195 3300046454 Ga0495592_0130238 Ga0495592_0130238_538_1281 245
196 3300046462 Ga0495651_0109504 Ga0495651_0109504_830_1573 245
197 3300046463 Ga0495653_0032133 Ga0495653_0032133_2769_3512 245
198 3300046511 Ga0495608_0091701 Ga0495608_0091701_1119_1862 245
199 3300046514 Ga0495618_0076388 Ga0495618_0076388_43_786 245
200 3300046529 Ga0495652_0030594 Ga0495652_0030594_240_983 245
201 3300046663 Ga0495635_0336102 Ga0495635_0336102_230_973 245
202 3300046675 Ga0495657_0100284 Ga0495657_0100284_634_1377 245
203 3300046678 Ga0495599_0008678 Ga0495599_0008678_2748_3491 245
204 3300046680 Ga0495646_0059991 Ga0495646_0059991_1067_1810 245
205 3300046683 Ga0495658_0086310 Ga0495658_0086310_90_833 245
206 3300046690 Ga0495624_0019398 Ga0495624_0019398_3169_3912 245
207 3300046809 Ga0495600_0000669 Ga0495600_0000669_10146_10889 245
208 3300047317 Ga0495604_0024081 Ga0495604_0024081_420_1163 245
209 3300048088 Ga0495602_0018872 Ga0495602_0018872_1205_1948 245
210 3300053077 Ga0495601_0072229 Ga0495601_0072229_840_1583 245
211 3300053119 Ga0500595_003574 Ga0500595_003574_685_1428 245
212 3300053141 Ga0500574_000199 Ga0500574_000199_267_1010 245
213 3300053154 Ga0500619_026192 Ga0500619_026192_136_879 245
214 3300003322 rootL2_10035437 rootL2_100354372 246
215 3300003763 Ga0055529_1000271 Ga0055529_100027141 246
216 3300005436 Ga0070713_100303208 Ga0070713_1003032082 246
217 3300009036 Ga0105244_10004820 Ga0105244_100048204 246
218 3300025272 Ga0209455_1000051 Ga0209455_100005116 246
219 3300025915 Ga0207693_10085626 Ga0207693_100856263 246
220 3300025928 Ga0207700_10329043 Ga0207700_103290432 246
221 3300035118 Ga0373954_0005323 Ga0373954_0005323_1210_1953 246
222 3300035120 Ga0373957_0025351 Ga0373957_0025351_428_1171 246
223 3300035170 Ga0373943_0025928 Ga0373943_0025928_787_1530 246
224 3300035172 Ga0373955_0000981 Ga0373955_0000981_10022_10765 246
225 3300035695 Ga0373927_0056159 Ga0373927_0056159_1314_2057 246
226 3300035724 Ga0373933_0004700 Ga0373933_0004700_2969_3712 246
227 3300035725 Ga0373947_0000714 Ga0373947_0000714_1498_2241 246
228 3300036401 Ga0373937_0000018 Ga0373937_0000018_39402_40145 246
229 3300037068 Ga0373925_0000055 Ga0373925_0000055_79153_79896 246
230 3300046454 Ga0495592_0000430 Ga0495592_0000430_7977_8720 246
231 3300046459 Ga0495629_0001782 Ga0495629_0001782_12073_12816 246
232 3300046463 Ga0495653_0000003 Ga0495653_0000003_139248_139991 246
233 3300046476 Ga0495662_0004077 Ga0495662_0004077_1448_2191 246
234 3300046477 Ga0495664_0000001 Ga0495664_0000001_470538_471281 246
235 3300046511 Ga0495608_0000033 Ga0495608_0000033_3701_4444 246
236 3300046512 Ga0495610_0017382 Ga0495610_0017382_454_1335 246
237 3300046514 Ga0495618_0000012 Ga0495618_0000012_39790_40533 246
238 3300046516 Ga0495628_0000003 Ga0495628_0000003_301722_302465 246
239 3300046517 Ga0495630_0000443 Ga0495630_0000443_3572_4315 246
240 3300046529 Ga0495652_0000001 Ga0495652_0000001_355884_356627 246
241 3300046531 Ga0495665_0026791 Ga0495665_0026791_1181_1924 246
242 3300046533 Ga0495640_0000022 Ga0495640_0000022_99874_100617 246
243 3300046536 Ga0495587_0000003 Ga0495587_0000003_136872_137615 246
244 3300046543 Ga0495645_0000004 Ga0495645_0000004_364044_364787 246
245 3300046558 Ga0495633_0000321 Ga0495633_0000321_44804_45736 246
246 3300046559 Ga0495667_0000001 Ga0495667_0000001_195684_196427 246
247 3300046642 Ga0495634_0000163 Ga0495634_0000163_58694_59437 246
248 3300046663 Ga0495635_0000011 Ga0495635_0000011_238143_238886 246
249 3300046675 Ga0495657_0000061 Ga0495657_0000061_53015_53758 246
250 3300046678 Ga0495599_0000004 Ga0495599_0000004_100295_101038 246
251 3300046679 Ga0495623_0000020 Ga0495623_0000020_24326_25069 246
252 3300046680 Ga0495646_0000006 Ga0495646_0000006_43770_44513 246
253 3300046689 Ga0495613_0027238 Ga0495613_0027238_2111_2854 246
254 3300046809 Ga0495600_0000029 Ga0495600_0000029_45365_46108 246
255 3300047315 Ga0495581_0001742 Ga0495581_0001742_7817_8560 246
256 3300047317 Ga0495604_0000018 Ga0495604_0000018_136971_137714 246
257 3300047319 Ga0495674_0000001 Ga0495674_0000001_670475_671218 246
258 3300047322 Ga0495680_0000147 Ga0495680_0000147_14577_15320 246
259 3300047444 Ga0495675_0000034 Ga0495675_0000034_23560_24303 246
260 3300047470 Ga0495681_0134618 Ga0495681_0134618_33_914 246
261 3300047471 Ga0495684_0000005 Ga0495684_0000005_154425_155168 246
262 3300047673 Ga0495593_0001779 Ga0495593_0001779_7956_8699 246
263 3300048088 Ga0495602_0000002 Ga0495602_0000002_214018_214761 246
264 3300053077 Ga0495601_0000003 Ga0495601_0000003_356010_356753 246
265 3300053078 Ga0495612_0000007 Ga0495612_0000007_195936_196679 246
266 3300053084 Ga0495595_0000197 Ga0495595_0000197_13_756 246
267 3300053085 Ga0495619_0000009 Ga0495619_0000009_136978_137721 246
268 iso_pu_bacteria 2904424332 2904429738 246
269 3300005329 Ga0070683_100013050 Ga0070683_1000130508 247
270 3300005336 Ga0070680_100012621 Ga0070680_1000126215 247
271 3300005339 Ga0070660_100003001 Ga0070660_1000030015 247
272 3300005458 Ga0070681_10057282 Ga0070681_100572824 247
273 3300005530 Ga0070679_100070354 Ga0070679_1000703543 247
274 3300005535 Ga0070684_100005044 Ga0070684_1000050443 247
275 3300005539 Ga0068853_100004408 Ga0068853_1000044083 247
276 3300005563 Ga0068855_100050152 Ga0068855_1000501522 247
277 3300005577 Ga0068857_100166406 Ga0068857_1001664062 247
278 3300005834 Ga0068851_10022062 Ga0068851_100220623 247
279 3300009093 Ga0105240_10026622 Ga0105240_100266223 247
280 3300009098 Ga0105245_10184175 Ga0105245_101841751 247
281 3300009545 Ga0105237_10012336 Ga0105237_1001233610 247
282 3300009551 Ga0105238_10015861 Ga0105238_100158619 247
283 3300010375 Ga0105239_10017391 Ga0105239_100173913 247
284 3300013104 Ga0157370_10027113 Ga0157370_100271133 247
285 3300013105 Ga0157369_10015050 Ga0157369_100150502 247
286 3300013306 Ga0163162_10400587 Ga0163162_104005872 247
287 3300025321 Ga0207656_10017390 Ga0207656_100173903 247
288 3300025912 Ga0207707_10002705 Ga0207707_1000270510 247
289 3300025913 Ga0207695_10189728 Ga0207695_101897282 247
290 3300025914 Ga0207671_10009638 Ga0207671_100096382 247
291 3300025917 Ga0207660_10006961 Ga0207660_100069612 247
292 3300025919 Ga0207657_10006890 Ga0207657_100068905 247
293 3300025921 Ga0207652_10001690 Ga0207652_100016909 247
294 3300025924 Ga0207694_10005031 Ga0207694_100050319 247
295 3300025944 Ga0207661_10008424 Ga0207661_100084249 247
296 3300025949 Ga0207667_10002017 Ga0207667_1000201716 247
297 3300025981 Ga0207640_10145035 Ga0207640_101450352 247
298 3300026041 Ga0207639_10014358 Ga0207639_100143586 247
299 3300026116 Ga0207674_10193915 Ga0207674_101939152 247
300 3300037068 Ga0373925_0051676 Ga0373925_0051676_306_1061 247
301 3300046557 Ga0495622_0000032 Ga0495622_0000032_116727_117581 247
302 3300005983 Ga0081540_1000310 Ga0081540_100031017 248
303 3300006844 Ga0075428_100001968 Ga0075428_1000019685 248
304 3300006844 Ga0075428_100178815 Ga0075428_1001788152 248
305 3300006846 Ga0075430_100208650 Ga0075430_1002086502 248
306 3300006847 Ga0075431_100000110 Ga0075431_10000011047 248
307 3300006852 Ga0075433_10211467 Ga0075433_102114672 248
308 3300006871 Ga0075434_100806876 Ga0075434_1008068761 248
309 3300006880 Ga0075429_100005774 Ga0075429_10000577410 248
310 3300006914 Ga0075436_100028457 Ga0075436_1000284573 248
311 3300007076 Ga0075435_100008604 Ga0075435_10000860410 248
312 3300009094 Ga0111539_10000570 Ga0111539_1000057052 248
313 3300009147 Ga0114129_10000766 Ga0114129_1000076642 248
314 3300009147 Ga0114129_10035365 Ga0114129_100353655 248
315 3300009147 Ga0114129_10355511 Ga0114129_103555112 248
316 3300014325 Ga0163163_10075672 Ga0163163_100756721 248
317 3300025920 Ga0207649_10542743 Ga0207649_105427431 248
318 3300025922 Ga0207646_10216864 Ga0207646_102168641 248
319 3300025941 Ga0207711_10135864 Ga0207711_101358642 248
320 3300027907 Ga0207428_10044203 Ga0207428_100442033 248
321 3300028023 Ga0265357_1001015 Ga0265357_10010151 248
322 3300030763 Ga0265763_1003194 Ga0265763_10031942 248
323 3300035691 Ga0373931_0200787 Ga0373931_0200787_403_1161 248
324 3300048907 Ga0496104_0007245 Ga0496104_0007245_324_1082 248
325 3300048912 Ga0496109_0063967 Ga0496109_0063967_1935_2693 248
326 3300048913 Ga0496110_0130928 Ga0496110_0130928_1317_2075 248
327 3300048917 Ga0496114_0204545 Ga0496114_0204545_807_1565 248
328 3300048918 Ga0496115_0049993 Ga0496115_0049993_583_1341 248
329 3300048929 Ga0496126_0002382 Ga0496126_0002382_21260_22012 248
330 3300049580 Ga0501046_0034886 Ga0501046_0034886_1314_2093 248
331 3300049590 Ga0501074_0087465 Ga0501074_0087465_964_1743 248
332 3300050507 nmdc:mga05p37_160_c1 nmdc:mga05p37_160_c1_18594_19352 248
333 3300050507 nmdc:mga05p37_245068_c1 nmdc:mga05p37_245068_c1_622_1371 248
334 3300050508 nmdc:mga09592_6352_c1 nmdc:mga09592_6352_c1_964_1722 248
335 3300050508 nmdc:mga09592_692638_c1 nmdc:mga09592_692638_c1_76_825 248
336 3300050509 nmdc:mga0qj67_79059_c1 nmdc:mga0qj67_79059_c1_157_915 248
337 3300050510 nmdc:mga06r32_164372_c1 nmdc:mga06r32_164372_c1_730_1479 248
338 3300050510 nmdc:mga06r32_3114_c1 nmdc:mga06r32_3114_c1_2833_3591 248
339 3300050510 nmdc:mga06r32_837405_c1 nmdc:mga06r32_837405_c1_42_791 248
340 3300050511 nmdc:mga08y16_44897_c1 nmdc:mga08y16_44897_c1_2396_3154 248
341 3300050512 nmdc:mga0n895_226220_c1 nmdc:mga0n895_226220_c1_262_1011 248
342 3300050512 nmdc:mga0n895_847681_c1 nmdc:mga0n895_847681_c1_113_862 248
343 3300053153 Ga0500616_0043577 Ga0500616_0043577_1083_1829 248
344 3300002076 JGI24749J21850_1002332 JGI24749J21850_10023322 249
345 3300005328 Ga0070676_10086873 Ga0070676_100868732 249
346 3300005329 Ga0070683_100055909 Ga0070683_1000559092 249
347 3300005330 Ga0070690_100046953 Ga0070690_1000469532 249
348 3300005331 Ga0070670_100132685 Ga0070670_1001326852 249
349 3300005334 Ga0068869_100408206 Ga0068869_1004082062 249
350 3300005337 Ga0070682_100195806 Ga0070682_1001958062 249
351 3300005339 Ga0070660_100058223 Ga0070660_1000582232 249
352 3300005344 Ga0070661_100128855 Ga0070661_1001288552 249
353 3300005345 Ga0070692_10017873 Ga0070692_100178733 249
354 3300005354 Ga0070675_100230235 Ga0070675_1002302352 249
355 3300005355 Ga0070671_100313940 Ga0070671_1003139402 249
356 3300005356 Ga0070674_100064662 Ga0070674_1000646623 249
357 3300005364 Ga0070673_100181443 Ga0070673_1001814432 249
358 3300005366 Ga0070659_100118415 Ga0070659_1001184152 249
359 3300005438 Ga0070701_10010032 Ga0070701_100100324 249
360 3300005455 Ga0070663_100110315 Ga0070663_1001103152 249
361 3300005456 Ga0070678_100686272 Ga0070678_1006862722 249
362 3300005457 Ga0070662_100133133 Ga0070662_1001331331 249
363 3300005466 Ga0070685_10026154 Ga0070685_100261543 249
364 3300005539 Ga0068853_100037059 Ga0068853_1000370596 249
365 3300005544 Ga0070686_100055276 Ga0070686_1000552763 249
366 3300005548 Ga0070665_100091930 Ga0070665_1000919305 249
367 3300005549 Ga0070704_100165446 Ga0070704_1001654462 249
368 3300005564 Ga0070664_100252533 Ga0070664_1002525332 249
369 3300005577 Ga0068857_100734720 Ga0068857_1007347202 249
370 3300005578 Ga0068854_100254863 Ga0068854_1002548632 249
371 3300005615 Ga0070702_100013504 Ga0070702_1000135044 249
372 3300005616 Ga0068852_100153382 Ga0068852_1001533823 249
373 3300005617 Ga0068859_100071958 Ga0068859_1000719583 249
374 3300005618 Ga0068864_100081191 Ga0068864_1000811912 249
375 3300005718 Ga0068866_10003204 Ga0068866_100032046 249
376 3300005719 Ga0068861_100342618 Ga0068861_1003426182 249
377 3300005834 Ga0068851_10002001 Ga0068851_100020018 249
378 3300005840 Ga0068870_10001807 Ga0068870_100018074 249
379 3300005842 Ga0068858_100032370 Ga0068858_1000323706 249
380 3300006237 Ga0097621_100154441 Ga0097621_1001544412 249
381 3300006880 Ga0075429_100503994 Ga0075429_1005039941 249
382 3300006881 Ga0068865_100229197 Ga0068865_1002291972 249
383 3300006931 Ga0097620_100071958 Ga0097620_1000719583 249
384 3300007076 Ga0075435_100696240 Ga0075435_1006962401 249
385 3300009094 Ga0111539_10022111 Ga0111539_100221112 249
386 3300009101 Ga0105247_10466937 Ga0105247_104669372 249
387 3300009176 Ga0105242_10044092 Ga0105242_100440923 249
388 3300009177 Ga0105248_11072141 Ga0105248_110721412 249
389 3300009553 Ga0105249_10118490 Ga0105249_101184903 249
390 3300010375 Ga0105239_10100473 Ga0105239_101004732 249
391 3300011119 Ga0105246_10033754 Ga0105246_100337544 249
392 3300013297 Ga0157378_10106390 Ga0157378_101063902 249
393 3300013307 Ga0157372_10750448 Ga0157372_107504482 249
394 3300014325 Ga0163163_10014985 Ga0163163_100149854 249
395 3300014326 Ga0157380_10046086 Ga0157380_100460863 249
396 3300014745 Ga0157377_10030847 Ga0157377_100308474 249
397 3300017792 Ga0163161_10159521 Ga0163161_101595212 249
398 3300025271 Ga0207666_1002957 Ga0207666_10029572 249
399 3300025315 Ga0207697_10001936 Ga0207697_1000193613 249
400 3300025893 Ga0207682_10000740 Ga0207682_1000074013 249
401 3300025901 Ga0207688_10000602 Ga0207688_100006023 249
402 3300025907 Ga0207645_10023348 Ga0207645_100233485 249
403 3300025908 Ga0207643_10000480 Ga0207643_1000048016 249
404 3300025919 Ga0207657_10008136 Ga0207657_1000813610 249
405 3300025920 Ga0207649_10038150 Ga0207649_100381502 249
406 3300025925 Ga0207650_10031721 Ga0207650_100317214 249
407 3300025926 Ga0207659_10061888 Ga0207659_100618882 249
408 3300025931 Ga0207644_10040337 Ga0207644_100403373 249
409 3300025933 Ga0207706_10006029 Ga0207706_100060295 249
410 3300025935 Ga0207709_10150295 Ga0207709_101502952 249
411 3300025937 Ga0207669_10181743 Ga0207669_101817432 249
412 3300025940 Ga0207691_10067244 Ga0207691_100672444 249
413 3300025942 Ga0207689_10011404 Ga0207689_100114043 249
414 3300025981 Ga0207640_10092244 Ga0207640_100922442 249
415 3300025986 Ga0207658_10120419 Ga0207658_101204192 249
416 3300026089 Ga0207648_10084202 Ga0207648_100842022 249
417 3300026095 Ga0207676_10043823 Ga0207676_100438232 249
418 3300026116 Ga0207674_10010464 Ga0207674_100104642 249
419 3300026118 Ga0207675_100022204 Ga0207675_1000222047 249
420 3300026121 Ga0207683_10077383 Ga0207683_100773834 249
421 3300027907 Ga0207428_10105674 Ga0207428_101056742 249
422 3300028379 Ga0268266_10140155 Ga0268266_101401553 249
423 3300028381 Ga0268264_10144795 Ga0268264_101447952 249
424 3300037068 Ga0373925_0642689 Ga0373925_0642689_96_845 249
425 3300048907 Ga0496104_0307463 Ga0496104_0307463_420_1169 249
426 3300048908 Ga0496105_0069232 Ga0496105_0069232_1351_2100 249
427 3300048909 Ga0496106_0057143 Ga0496106_0057143_1001_1750 249
428 3300048910 Ga0496107_0075702 Ga0496107_0075702_22_771 249
429 3300048911 Ga0496108_0090929 Ga0496108_0090929_1330_2079 249
430 3300048913 Ga0496110_0013548 Ga0496110_0013548_3936_4685 249
431 3300048914 Ga0496111_0239211 Ga0496111_0239211_123_872 249
432 3300048917 Ga0496114_0035986 Ga0496114_0035986_3202_3951 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09859

Oxygenase-NA

Oxygenase, catalysing oxidative methylation of damaged DNA

117

292

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ey1-assembly1.cif.gz_A prolyl hydroxylase from trichoplax adhaerens 0.6922 9 240
7u1j-assembly3.cif.gz_C crystal structure of pisum sativum convicilin 0.6896 137 243
5e1r-assembly2.cif.gz_D crystal structure of pecan (carya illinoinensis) vicilin, a new food allergen 0.6883 125 240
5e1r-assembly1.cif.gz_B crystal structure of pecan (carya illinoinensis) vicilin, a new food allergen 0.6866 125 240
6xwv-assembly1.cif.gz_C crystal structure of drosophila melanogaster cenp-c bound to cal1 0.6864 137 241
ID Description Score Start End Superfamily
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9491 80 246 2.60.120.590
af_P9WLH7_61_232_2.60.120.590 Mainly Beta;Sandwich;Jelly Rolls;Alpha-ketoglutarate-dependent dioxygenase AlkB-like 0.9172 80 246 2.60.120.590
af_Q54TF2_42_233_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.699 38 241 2.60.120.620
af_Q9VVQ4_306_472_2.60.120.620 Mainly Beta;Sandwich;Jelly Rolls;q2cbj1_9rhob like domain 0.6802 38 242 2.60.120.620
af_C6T0Q1_25_220_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.6727 137 240 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A440J433-F1-model_v4 deleted 0.9865 14 216
AF-A0A534SS43-F1-model_v4 Proline hydroxylase 0.9865 24 208
AF-A0A7Z7B6Q4-F1-model_v4 Proline hydroxylase 0.9848 12 247
AF-A0A2V2ANZ7-F1-model_v4 Fe2OG dioxygenase domain-containing protein 0.9848 29 247
AF-A0A1W9IQ22-F1-model_v4 Proline hydroxylase 0.9844 14 247

Feature Viewer

pLDDT pTM Quality
89.26 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map