F442611

General Info

Members Datasets Scaffolds Average Seq Length
432 192 864 201

Family's Representative Sequence

Representative Sequence 3300025915|Ga0207693_10127609|Ga0207693_101276092
Length 235
Sequence MTRVTRVTVDRSCAICERTLLMGEQAIRFSPNGGVDYVDVCPLCADTAIEYGWVREGSPTSPTVPAERRRRRSSWLQTLLGTGPRDVETVVASEPILRRLSEQELAMVEAADLFNASQYRRTVGGISKSLGEPRVSVVTLSGVNAEVVVTVAWDISWYQYRVSPESDNPVRLEGRGHDPEQLEGPFKGWNAHMGVLRRRSNERPVLARVKPRALSSVRPAQGAKHHENYQPLRVN

Samples

Sample ID Description Type Environment
1 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
84 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
85 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
91 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
94 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
95 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
98 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
99 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
100 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
103 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
104 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
112 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
117 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
129 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
130 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
133 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
134 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
146 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
147 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
148 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
149 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
150 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
151 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
190 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.38
Metatranscriptomes 1.62
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 15.74
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 17.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207693_10127609 3300025915 Bacteria 1999
2 Ga0070683_100056841 3300005329 Bacteria 3634
3 Ga0070683_100858312 3300005329 Bacteria 871
4 Ga0070690_100169006 3300005330 Bacteria 1504
5 Ga0070680_100051511 3300005336 Bacteria 3359
6 Ga0070680_100210401 3300005336 Bacteria 1641
7 Ga0070682_100161843 3300005337 Bacteria 1546
8 Ga0068868_100114512 3300005338 Bacteria 2194
9 Ga0068868_100252064 3300005338 Bacteria 1486
10 Ga0070660_100032746 3300005339 Bacteria 3914
11 Ga0070660_100125285 3300005339 Bacteria 2052
12 Ga0070660_100206115 3300005339 Bacteria 1596
13 Ga0070661_100026319 3300005344 Bacteria 4183
14 Ga0070661_100062263 3300005344 Bacteria 2739
15 Ga0070671_100258495 3300005355 Bacteria 1480
16 Ga0070673_100807769 3300005364 Unclassified 866
17 Ga0070709_10343821 3300005434 Unclassified 1100
18 Ga0070714_100559194 3300005435 Unclassified 1096
19 Ga0070714_101388927 3300005435 Unclassified 686
20 Ga0070713_100754540 3300005436 Bacteria 931
21 Ga0070710_10580434 3300005437 Bacteria 778
22 Ga0070694_100152500 3300005444 Bacteria 1689
23 Ga0070663_100536105 3300005455 Bacteria 976
24 Ga0070681_10083661 3300005458 Bacteria 3144
25 Ga0070681_10139948 3300005458 Bacteria 2350
26 Ga0070681_10837293 3300005458 Bacteria 838
27 Ga0068867_100385125 3300005459 Bacteria 1179
28 Ga0070707_100392494 3300005468 Unclassified 1348
29 Ga0070707_100610736 3300005468 Bacteria 1053
30 Ga0070698_100045440 3300005471 Bacteria 4495
31 Ga0070699_100185853 3300005518 Bacteria 1845
32 Ga0070699_100626058 3300005518 Unclassified 982
33 Ga0070679_100081682 3300005530 Bacteria 3221
34 Ga0070679_100098681 3300005530 Bacteria 2908
35 Ga0070679_100167318 3300005530 Bacteria 2171
36 Ga0070679_100870162 3300005530 Unclassified 845
37 Ga0070684_100287876 3300005535 Unclassified 1506
38 Ga0070684_100616059 3300005535 Unclassified 1010
39 Ga0068853_100352243 3300005539 Bacteria 1370
40 Ga0068853_100687984 3300005539 Unclassified 975
41 Ga0070696_100055213 3300005546 Bacteria 2770
42 Ga0070696_100223344 3300005546 Unclassified 1414
43 Ga0070665_100006128 3300005548 Bacteria 12291
44 Ga0068855_100102257 3300005563 Bacteria 3298
45 Ga0068855_100409701 3300005563 Bacteria 1484
46 Ga0068855_100563887 3300005563 Bacteria 1231
47 Ga0068855_100825911 3300005563 Unclassified 983
48 Ga0068857_100060636 3300005577 Bacteria 3360
49 Ga0068857_100347315 3300005577 Bacteria 1373
50 Ga0068856_100036403 3300005614 Bacteria 4826
51 Ga0068856_100086357 3300005614 Bacteria 3117
52 Ga0068856_100117907 3300005614 Bacteria 2655
53 Ga0068852_100041396 3300005616 Bacteria 3893
54 Ga0068852_100151856 3300005616 Bacteria 2155
55 Ga0068864_100211328 3300005618 Bacteria 1787
56 Ga0070716_100004103 3300006173 Bacteria 6910
57 Ga0070712_100060375 3300006175 Bacteria 2674
58 Ga0070712_100071737 3300006175 Bacteria 2479
59 Ga0070712_100166066 3300006175 Bacteria 1709
60 Ga0070712_100239140 3300006175 Bacteria 1446
61 Ga0075434_100379337 3300006871 Bacteria 1435
62 Ga0105240_10295241 3300009093 Bacteria 1856
63 Ga0105240_10776817 3300009093 Bacteria 1039
64 Ga0105245_10124678 3300009098 Bacteria 2409
65 Ga0105245_10632400 3300009098 Bacteria 1099
66 Ga0105245_10639663 3300009098 Bacteria 1093
67 Ga0105241_10326401 3300009174 Bacteria 1325
68 Ga0105237_10075490 3300009545 Bacteria 3362
69 Ga0105237_10288025 3300009545 Bacteria 1645
70 Ga0105238_10001956 3300009551 Bacteria 20739
71 Ga0105238_10172414 3300009551 Bacteria 2140
72 Ga0105239_10924877 3300010375 Unclassified 1001
73 Ga0105239_10939010 3300010375 Bacteria 993
74 Ga0105246_10560725 3300011119 Bacteria 980
75 Ga0157371_10681550 3300013102 Unclassified 769
76 Ga0157370_10065225 3300013104 Bacteria 3445
77 Ga0157370_10309084 3300013104 Bacteria 1459
78 Ga0157370_10522968 3300013104 Bacteria 1089
79 Ga0157370_10719777 3300013104 Bacteria 910
80 Ga0157369_10115190 3300013105 Bacteria 2855
81 Ga0157369_10116670 3300013105 Bacteria 2834
82 Ga0157369_10187602 3300013105 Bacteria 2174
83 Ga0157369_11174612 3300013105 Bacteria 784
84 Ga0157374_10082564 3300013296 Bacteria 3051
85 Ga0157374_10734266 3300013296 Unclassified 1002
86 Ga0157378_10156708 3300013297 Bacteria 2127
87 Ga0157372_10068333 3300013307 Bacteria 3994
88 Ga0157372_10184851 3300013307 Bacteria 2413
89 Ga0157372_10414756 3300013307 Bacteria 1569
90 Ga0157372_10732757 3300013307 Bacteria 1150
91 Ga0157377_10707689 3300014745 Unclassified 732
92 Ga0197907_10357015 3300020069 Unclassified 1149
93 Ga0197907_10465661 3300020069 Bacteria 1294
94 Ga0206356_10123609 3300020070 Bacteria 1292
95 Ga0206356_10851575 3300020070 Bacteria 1270
96 Ga0206350_10874619 3300020080 Unclassified 1101
97 Ga0206354_10996108 3300020081 Bacteria 2030
98 Ga0224712_10031408 3300022467 Bacteria 1927
99 Ga0207692_10279838 3300025898 Unclassified 1009
100 Ga0207684_10597386 3300025910 Bacteria 943
101 Ga0207707_10055508 3300025912 Bacteria 3446
102 Ga0207707_10096922 3300025912 Bacteria 2577
103 Ga0207695_10454628 3300025913 Unclassified 1164
104 Ga0207695_10487964 3300025913 Unclassified 1114
105 Ga0207695_10556772 3300025913 Bacteria 1028
106 Ga0207671_10144748 3300025914 Bacteria 1833
107 Ga0207671_10445703 3300025914 Unclassified 1031
108 Ga0207693_10009530 3300025915 Bacteria 7910
109 Ga0207660_10015801 3300025917 Bacteria 4988
110 Ga0207660_10660004 3300025917 Bacteria 853
111 Ga0207657_10020531 3300025919 Bacteria 6240
112 Ga0207657_10062358 3300025919 Bacteria 3192
113 Ga0207649_10123788 3300025920 Bacteria 1747
114 Ga0207649_10365153 3300025920 Bacteria 1072
115 Ga0207652_10296382 3300025921 Bacteria 1459
116 Ga0207652_10518507 3300025921 Unclassified 1072
117 Ga0207646_10529763 3300025922 Bacteria 1060
118 Ga0207694_10056739 3300025924 Bacteria 3042
119 Ga0207694_10209876 3300025924 Bacteria 1586
120 Ga0207687_10110025 3300025927 Bacteria 2042
121 Ga0207687_10836881 3300025927 Bacteria 786
122 Ga0207700_10192962 3300025928 Bacteria 1712
123 Ga0207700_10204492 3300025928 Bacteria 1666
124 Ga0207664_10258192 3300025929 Bacteria 1523
125 Ga0207664_10675771 3300025929 Unclassified 928
126 Ga0207644_10052298 3300025931 Bacteria 2935
127 Ga0207644_10447005 3300025931 Unclassified 1061
128 Ga0207690_10093342 3300025932 Bacteria 2132
129 Ga0207690_10095150 3300025932 Unclassified 2115
130 Ga0207686_10082604 3300025934 Bacteria 2101
131 Ga0207665_10009108 3300025939 Bacteria 6518
132 Ga0207661_10155745 3300025944 Bacteria 1979
133 Ga0207667_10124545 3300025949 Bacteria 2655
134 Ga0207651_10537278 3300025960 Unclassified 1015
135 Ga0207677_10048454 3300026023 Bacteria 2861
136 Ga0207639_10294349 3300026041 Bacteria 1432
137 Ga0207639_10440649 3300026041 Bacteria 1181
138 Ga0207678_10766679 3300026067 Bacteria 851
139 Ga0207702_10261073 3300026078 Bacteria 1631
140 Ga0207702_10296287 3300026078 Bacteria 1534
141 Ga0207676_10929691 3300026095 Bacteria 854
142 Ga0207674_10026168 3300026116 Bacteria 6207
143 Ga0207674_10130786 3300026116 Bacteria 2473
144 Ga0207698_10410198 3300026142 Unclassified 1297
145 Ga0268266_10008317 3300028379 Bacteria 9240
146 Ga0268266_10316189 3300028379 Bacteria 1460
147 Ga0265338_10059602 3300028800 Bacteria 3362
148 Ga0373944_0009257 3300035089 Bacteria 2669
149 Ga0373936_0048203 3300035113 Bacteria 1719
150 Ga0373945_0018290 3300035116 Bacteria 2383
151 Ga0373953_0117652 3300035117 Unclassified 1127
152 Ga0373956_0075192 3300035119 Bacteria 1545
153 Ga0373957_0027675 3300035120 Bacteria 2061
154 Ga0373943_0005559 3300035170 Bacteria 5659
155 Ga0373943_0100013 3300035170 Unclassified 1515
156 Ga0373946_0091389 3300035171 Bacteria 1349
157 Ga0373955_0022070 3300035172 Bacteria 3223
158 Ga0373935_0370438 3300035692 Archaea 1024
159 Ga0373927_0065269 3300035695 Bacteria 2355
160 Ga0373947_0002069 3300035725 Bacteria 12240
161 Ga0373937_0033161 3300036401 Bacteria 4688
162 Ga0373937_0075440 3300036401 Bacteria 3113
163 Ga0373925_0153517 3300037068 Bacteria 1810
164 Ga0373925_0465268 3300037068 Bacteria 1036
165 Ga0373925_1207102 3300037068 Bacteria 621
166 Ga0395899_0102113 3300037312 Bacteria 2069
167 Ga0395899_0116331 3300037312 Bacteria 1918
168 Ga0395899_0240541 3300037312 Bacteria 1246
169 Ga0395900_0082218 3300037418 Bacteria 3309
170 Ga0395900_0107936 3300037418 Bacteria 2860
171 Ga0395900_0186729 3300037418 Bacteria 2104
172 Ga0395900_0303433 3300037418 Bacteria 1582
173 Ga0395900_0308995 3300037418 Bacteria 1565
174 Ga0395900_0417963 3300037418 Unclassified 1302
175 Ga0395900_0598993 3300037418 Unclassified 1043
176 Ga0395900_0601666 3300037418 Unclassified 1040
177 Ga0395900_0726759 3300037418 Bacteria 925
178 Ga0395898_0012795 3300037466 Bacteria 8662
179 Ga0395898_0031602 3300037466 Bacteria 5289
180 Ga0395898_0059770 3300037466 Unclassified 3706
181 Ga0395898_0076940 3300037466 Bacteria 3222
182 Ga0395898_0120676 3300037466 Bacteria 2512
183 Ga0395898_0167202 3300037466 Bacteria 2103
184 Ga0395898_0198635 3300037466 Bacteria 1915
185 Ga0395898_0409783 3300037466 Unclassified 1292
186 Ga0395905_0015955 3300037471 Bacteria 7139
187 Ga0395905_0060359 3300037471 Bacteria 3546
188 Ga0395905_0209024 3300037471 Bacteria 1829
189 Ga0395905_0445002 3300037471 Bacteria 1193
190 Ga0395901_0027265 3300038443 Bacteria 5868
191 Ga0395901_0039211 3300038443 Bacteria 4902
192 Ga0395901_0045496 3300038443 Bacteria 4555
193 Ga0395901_0062714 3300038443 Bacteria 3868
194 Ga0395901_0101491 3300038443 Bacteria 3019
195 Ga0395901_0265117 3300038443 Bacteria 1787
196 Ga0395901_0307900 3300038443 Bacteria 1641
197 Ga0395901_0509033 3300038443 Unclassified 1225
198 Ga0395901_0712875 3300038443 Unclassified 1000
199 Ga0395901_1261666 3300038443 Bacteria 702
200 Ga0436365_0450878 3300039437 Bacteria 1272
201 Ga0436365_0676969 3300039437 Bacteria 1931
202 Ga0436365_1321600 3300039437 Unclassified 715
203 Ga0436363_1024046 3300039450 Bacteria 714
204 Ga0466972_0155336 3300044658 Bacteria 1075
205 Ga0466966_0148361 3300044684 Bacteria 1431
206 Ga0466961_0397558 3300044693 Unclassified 836
207 Ga0466963_0006082 3300044694 Bacteria 7117
208 Ga0466963_0012163 3300044694 Bacteria 5260
209 Ga0466963_0014535 3300044694 Bacteria 4856
210 Ga0466963_0026427 3300044694 Bacteria 3713
211 Ga0466963_0067853 3300044694 Bacteria 2394
212 Ga0466963_0146823 3300044694 Bacteria 1637
213 Ga0466963_0151309 3300044694 Bacteria 1611
214 Ga0466963_0160676 3300044694 Bacteria 1563
215 Ga0466963_0294111 3300044694 Bacteria 1142
216 Ga0466963_0351789 3300044694 Bacteria 1038
217 Ga0466964_0043934 3300044706 Bacteria 1814
218 Ga0466964_0096365 3300044706 Unclassified 1296
219 Ga0466964_0110412 3300044706 Unclassified 1225
220 Ga0466971_0002355 3300044719 Bacteria 7975
221 Ga0466968_0028597 3300044735 Bacteria 2299
222 Ga0466970_0027224 3300044765 Bacteria 2999
223 Ga0466970_0091183 3300044765 Bacteria 1654
224 Ga0466957_0002656 3300044842 Bacteria 9650
225 Ga0466957_0250904 3300044842 Unclassified 1177
226 Ga0466960_0414385 3300044901 Unclassified 778
227 Ga0466960_0469398 3300044901 Unclassified 734
228 Ga0466960_0483869 3300044901 Unclassified 723
229 Ga0466959_0039109 3300045049 Bacteria 3505
230 Ga0466959_0179094 3300045049 Unclassified 1483
231 Ga0466958_0001843 3300045836 Bacteria 10324
232 Ga0466958_0111060 3300045836 Bacteria 1711
233 Ga0466958_0193502 3300045836 Bacteria 1293
234 Ga0466967_0001875 3300045976 Bacteria 12683
235 Ga0466967_0003388 3300045976 Bacteria 10387
236 Ga0466967_0004473 3300045976 Bacteria 9435
237 Ga0466967_0004983 3300045976 Bacteria 9092
238 Ga0466967_0031803 3300045976 Bacteria 4448
239 Ga0466967_0040902 3300045976 Bacteria 3993
240 Ga0466967_0050536 3300045976 Bacteria 3641
241 Ga0466967_0092142 3300045976 Bacteria 2755
242 Ga0466967_0095845 3300045976 Bacteria 2705
243 Ga0466967_0125760 3300045976 Bacteria 2374
244 Ga0466967_0163081 3300045976 Bacteria 2093
245 Ga0466967_0240315 3300045976 Bacteria 1727
246 Ga0466967_0580147 3300045976 Bacteria 1105
247 Ga0466967_0733417 3300045976 Bacteria 979
248 Ga0495592_0027615 3300046454 Bacteria 4301
249 Ga0495592_0426834 3300046454 Bacteria 835
250 Ga0495629_0000159 3300046459 Bacteria 59616
251 Ga0495629_0266634 3300046459 Bacteria 1177
252 Ga0495641_0007547 3300046461 Bacteria 6772
253 Ga0495641_0160515 3300046461 Unclassified 1005
254 Ga0495641_0223268 3300046461 Archaea 845
255 Ga0495651_0129408 3300046462 Bacteria 1844
256 Ga0495651_0476426 3300046462 Unclassified 802
257 Ga0495653_0024544 3300046463 Bacteria 4857
258 Ga0495653_0028612 3300046463 Bacteria 4455
259 Ga0495582_0000183 3300046473 Bacteria 34098
260 Ga0495639_0085179 3300046475 Bacteria 1477
261 Ga0495662_0071511 3300046476 Bacteria 1681
262 Ga0495662_0192156 3300046476 Bacteria 1006
263 Ga0495584_0259287 3300046491 Unclassified 884
264 Ga0495594_0156651 3300046499 Bacteria 1294
265 Ga0495594_0347630 3300046499 Unclassified 844
266 Ga0495608_0018507 3300046511 Bacteria 4804
267 Ga0495608_0027394 3300046511 Bacteria 3877
268 Ga0495608_0299546 3300046511 Bacteria 996
269 Ga0495628_0056567 3300046516 Bacteria 3087
270 Ga0495628_0206338 3300046516 Unclassified 1479
271 Ga0495630_0012894 3300046517 Bacteria 6072
272 Ga0495630_0030747 3300046517 Bacteria 3996
273 Ga0495630_0146605 3300046517 Bacteria 1795
274 Ga0495630_0966483 3300046517 Bacteria 648
275 Ga0495666_0102363 3300046526 Bacteria 1349
276 Ga0495652_0161892 3300046529 Bacteria 1736
277 Ga0495652_0164790 3300046529 Bacteria 1716
278 Ga0495665_0006222 3300046531 Bacteria 6444
279 Ga0495665_0095905 3300046531 Bacteria 1558
280 Ga0495640_0011908 3300046533 Bacteria 6670
281 Ga0495640_0045724 3300046533 Bacteria 3037
282 Ga0495640_0062149 3300046533 Bacteria 2534
283 Ga0495640_0350273 3300046533 Unclassified 911
284 Ga0495587_0016070 3300046536 Bacteria 4658
285 Ga0495587_0069272 3300046536 Bacteria 2054
286 Ga0495645_0155566 3300046543 Bacteria 1584
287 Ga0495645_0363756 3300046543 Unclassified 929
288 Ga0495667_0032620 3300046559 Bacteria 3489
289 Ga0495667_0064237 3300046559 Bacteria 2401
290 Ga0495634_0024626 3300046642 Bacteria 4220
291 Ga0495635_0021005 3300046663 Bacteria 4551
292 Ga0495635_0473351 3300046663 Unclassified 826
293 Ga0495588_0143432 3300046674 Bacteria 1262
294 Ga0495657_0044779 3300046675 Bacteria 3007
295 Ga0495657_0106994 3300046675 Bacteria 1775
296 Ga0495599_0097062 3300046678 Bacteria 1837
297 Ga0495599_0179774 3300046678 Bacteria 1304
298 Ga0495623_0023817 3300046679 Bacteria 3949
299 Ga0495623_0140115 3300046679 Bacteria 1440
300 Ga0495646_0183240 3300046680 Unclassified 1148
301 Ga0495646_0197225 3300046680 Bacteria 1098
302 Ga0495646_0222103 3300046680 Bacteria 1021
303 Ga0495647_0068118 3300046681 Unclassified 1419
304 Ga0495658_0009011 3300046683 Bacteria 4959
305 Ga0495658_0218546 3300046683 Bacteria 1192
306 Ga0495613_0008448 3300046689 Bacteria 7641
307 Ga0495613_0106493 3300046689 Bacteria 2023
308 Ga0495624_0126063 3300046690 Bacteria 1571
309 Ga0495600_0151911 3300046809 Bacteria 1499
310 Ga0495581_0256358 3300047315 Unclassified 1023
311 Ga0495604_0073923 3300047317 Bacteria 2570
312 Ga0495604_0090455 3300047317 Bacteria 2273
313 Ga0495674_0012998 3300047319 Bacteria 7837
314 Ga0495674_0086110 3300047319 Bacteria 2691
315 Ga0495674_0097278 3300047319 Bacteria 2507
316 Ga0495674_0397146 3300047319 Unclassified 1113
317 Ga0495674_1067902 3300047319 Bacteria 616
318 Ga0495676_0002313 3300047321 Bacteria 16914
319 Ga0495680_0008139 3300047322 Bacteria 9555
320 Ga0495680_0012325 3300047322 Bacteria 7530
321 Ga0495680_0026009 3300047322 Bacteria 4833
322 Ga0495675_0034702 3300047444 Bacteria 3220
323 Ga0495675_0242718 3300047444 Bacteria 1084
324 Ga0495684_0026160 3300047471 Bacteria 4484
325 Ga0495684_0036575 3300047471 Bacteria 3763
326 Ga0495684_0079683 3300047471 Bacteria 2486
327 Ga0495684_0357942 3300047471 Unclassified 1034
328 Ga0495593_0013125 3300047673 Bacteria 4730
329 Ga0495602_0168245 3300048088 Bacteria 1704
330 Ga0495602_0298558 3300048088 Unclassified 1180
331 Ga0495614_0003012 3300048089 Bacteria 7504
332 Ga0496100_0034551 3300048903 Bacteria 3174
333 Ga0496100_0044445 3300048903 Bacteria 2845
334 Ga0496100_0050883 3300048903 Bacteria 2686
335 Ga0496101_0004053 3300048904 Bacteria 9156
336 Ga0496101_0008031 3300048904 Bacteria 6878
337 Ga0496101_0020896 3300048904 Bacteria 4491
338 Ga0496101_0054124 3300048904 Bacteria 2897
339 Ga0496101_0069353 3300048904 Bacteria 2579
340 Ga0496102_0006873 3300048905 Bacteria 9708
341 Ga0496102_0031241 3300048905 Bacteria 4775
342 Ga0496102_0170538 3300048905 Bacteria 2049
343 Ga0496102_0595718 3300048905 Bacteria 1028
344 Ga0496102_0656262 3300048905 Unclassified 972
345 Ga0496102_0662152 3300048905 Bacteria 967
346 Ga0496103_0002833 3300048906 Bacteria 10788
347 Ga0496104_0046529 3300048907 Bacteria 4086
348 Ga0496104_0064200 3300048907 Bacteria 3483
349 Ga0496104_0242185 3300048907 Bacteria 1716
350 Ga0496104_0374066 3300048907 Bacteria 1337
351 Ga0496104_0514688 3300048907 Bacteria 1108
352 Ga0496105_0017323 3300048908 Bacteria 5774
353 Ga0496105_0034432 3300048908 Bacteria 4165
354 Ga0496105_0517877 3300048908 Bacteria 934
355 Ga0496105_0536462 3300048908 Bacteria 915
356 Ga0496105_0815932 3300048908 Unclassified 708
357 Ga0496106_0004804 3300048909 Bacteria 9996
358 Ga0496106_0122381 3300048909 Bacteria 2035
359 Ga0496106_0193744 3300048909 Bacteria 1616
360 Ga0496106_0667152 3300048909 Bacteria 830
361 Ga0496107_0021137 3300048910 Bacteria 4600
362 Ga0496107_0021487 3300048910 Bacteria 4561
363 Ga0496107_0039676 3300048910 Bacteria 3378
364 Ga0496107_0095376 3300048910 Unclassified 2177
365 Ga0496108_0023797 3300048911 Bacteria 5040
366 Ga0496108_0104646 3300048911 Bacteria 2415
367 Ga0496108_0452995 3300048911 Bacteria 1121
368 Ga0496109_0007451 3300048912 Bacteria 9265
369 Ga0496109_0037167 3300048912 Bacteria 4399
370 Ga0496109_0656813 3300048912 Unclassified 985
371 Ga0496110_0004546 3300048913 Bacteria 10771
372 Ga0496110_0143052 3300048913 Bacteria 2162
373 Ga0496111_0032783 3300048914 Bacteria 3704
374 Ga0496111_0077551 3300048914 Bacteria 2422
375 Ga0496111_0342372 3300048914 Bacteria 1107
376 Ga0496112_0011784 3300048915 Bacteria 8004
377 Ga0496112_0016528 3300048915 Bacteria 6917
378 Ga0496112_0060260 3300048915 Bacteria 3740
379 Ga0496112_0171341 3300048915 Bacteria 2136
380 Ga0496112_0302598 3300048915 Bacteria 1544
381 Ga0496112_0424280 3300048915 Bacteria 1268
382 Ga0496113_0006784 3300048916 Bacteria 7297
383 Ga0496113_0038609 3300048916 Bacteria 3511
384 Ga0496113_0236062 3300048916 Bacteria 1459
385 Ga0496113_0400036 3300048916 Unclassified 1103
386 Ga0496114_0002801 3300048917 Bacteria 13360
387 Ga0496114_0003912 3300048917 Bacteria 11490
388 Ga0496114_0090232 3300048917 Bacteria 2601
389 Ga0496114_0111402 3300048917 Bacteria 2345
390 Ga0496114_0160551 3300048917 Bacteria 1954
391 Ga0496114_0338977 3300048917 Bacteria 1329
392 Ga0496115_0002511 3300048918 Bacteria 13174
393 Ga0496115_0012806 3300048918 Bacteria 6323
394 Ga0496115_0035312 3300048918 Bacteria 3955
395 Ga0496115_0049060 3300048918 Bacteria 3378
396 Ga0496115_0049721 3300048918 Bacteria 3357
397 Ga0496115_0211170 3300048918 Bacteria 1603
398 Ga0496115_0564595 3300048918 Unclassified 908
399 Ga0496115_0743590 3300048918 Bacteria 767
400 Ga0501031_0349109 3300049568 Bacteria 958
401 Ga0501040_0361300 3300049576 Bacteria 1041
402 Ga0501047_0303565 3300049581 Unclassified 1438
403 Ga0501047_0636518 3300049581 Unclassified 886
404 Ga0501067_0022806 3300049583 Bacteria 3465
405 Ga0501067_0146592 3300049583 Bacteria 1315
406 Ga0501067_0261482 3300049583 Bacteria 963
407 Ga0501068_0098927 3300049584 Bacteria 1807
408 Ga0501069_0012557 3300049585 Bacteria 4504
409 Ga0501069_0069759 3300049585 Bacteria 1968
410 Ga0501069_0395818 3300049585 Bacteria 817
411 Ga0501070_0000159 3300049586 Bacteria 62347
412 Ga0501070_0193639 3300049586 Bacteria 1670
413 Ga0501070_0838376 3300049586 Unclassified 720
414 Ga0501073_0081318 3300049589 Bacteria 2254
415 Ga0501074_0205484 3300049590 Bacteria 1403
416 Ga0501075_0710776 3300049591 Unclassified 765
417 Ga0501080_0146756 3300049742 Bacteria 2181
418 Ga0501080_0601298 3300049742 Unclassified 976
419 nmdc:mga0rr50_80600_c1 3300050513 Bacteria 2510
420 Ga0495601_0035279 3300053077 Bacteria 3121
421 Ga0495601_0137116 3300053077 Bacteria 1595
422 Ga0495601_0173076 3300053077 Unclassified 1411
423 Ga0495601_0216295 3300053077 Unclassified 1252
424 Ga0495595_0017460 3300053084 Bacteria 3086
425 Ga0495595_0182152 3300053084 Bacteria 1042
426 Ga0495619_0026234 3300053085 Bacteria 3747
427 Ga0495619_0052622 3300053085 Bacteria 2692
428 Ga0495619_0385408 3300053085 Unclassified 968
429 Ga0495619_0386265 3300053085 Bacteria 967
430 Ga0466962_0002146 3300061719 Bacteria 9316
431 Ga0530510_0114350 3300061734 Bacteria 1978
432 Ga0530510_0124803 3300061734 Bacteria 1892
433 Ga0207693_10127609
434 Ga0070683_100056841
435 Ga0070683_100858312
436 Ga0070690_100169006
437 Ga0070680_100051511
438 Ga0070680_100210401
439 Ga0070682_100161843
440 Ga0068868_100114512
441 Ga0068868_100252064
442 Ga0070660_100032746
443 Ga0070660_100125285
444 Ga0070660_100206115
445 Ga0070661_100026319
446 Ga0070661_100062263
447 Ga0070671_100258495
448 Ga0070673_100807769
449 Ga0070709_10343821
450 Ga0070714_100559194
451 Ga0070714_101388927
452 Ga0070713_100754540
453 Ga0070710_10580434
454 Ga0070694_100152500
455 Ga0070663_100536105
456 Ga0070681_10083661
457 Ga0070681_10139948
458 Ga0070681_10837293
459 Ga0068867_100385125
460 Ga0070707_100392494
461 Ga0070707_100610736
462 Ga0070698_100045440
463 Ga0070699_100185853
464 Ga0070699_100626058
465 Ga0070679_100081682
466 Ga0070679_100098681
467 Ga0070679_100167318
468 Ga0070679_100870162
469 Ga0070684_100287876
470 Ga0070684_100616059
471 Ga0068853_100352243
472 Ga0068853_100687984
473 Ga0070696_100055213
474 Ga0070696_100223344
475 Ga0070665_100006128
476 Ga0068855_100102257
477 Ga0068855_100409701
478 Ga0068855_100563887
479 Ga0068855_100825911
480 Ga0068857_100060636
481 Ga0068857_100347315
482 Ga0068856_100036403
483 Ga0068856_100086357
484 Ga0068856_100117907
485 Ga0068852_100041396
486 Ga0068852_100151856
487 Ga0068864_100211328
488 Ga0070716_100004103
489 Ga0070712_100060375
490 Ga0070712_100071737
491 Ga0070712_100166066
492 Ga0070712_100239140
493 Ga0075434_100379337
494 Ga0105240_10295241
495 Ga0105240_10776817
496 Ga0105245_10124678
497 Ga0105245_10632400
498 Ga0105245_10639663
499 Ga0105241_10326401
500 Ga0105237_10075490
501 Ga0105237_10288025
502 Ga0105238_10001956
503 Ga0105238_10172414
504 Ga0105239_10924877
505 Ga0105239_10939010
506 Ga0105246_10560725
507 Ga0157371_10681550
508 Ga0157370_10065225
509 Ga0157370_10309084
510 Ga0157370_10522968
511 Ga0157370_10719777
512 Ga0157369_10115190
513 Ga0157369_10116670
514 Ga0157369_10187602
515 Ga0157369_11174612
516 Ga0157374_10082564
517 Ga0157374_10734266
518 Ga0157378_10156708
519 Ga0157372_10068333
520 Ga0157372_10184851
521 Ga0157372_10414756
522 Ga0157372_10732757
523 Ga0157377_10707689
524 Ga0197907_10357015
525 Ga0197907_10465661
526 Ga0206356_10123609
527 Ga0206356_10851575
528 Ga0206350_10874619
529 Ga0206354_10996108
530 Ga0224712_10031408
531 Ga0207692_10279838
532 Ga0207684_10597386
533 Ga0207707_10055508
534 Ga0207707_10096922
535 Ga0207695_10454628
536 Ga0207695_10487964
537 Ga0207695_10556772
538 Ga0207671_10144748
539 Ga0207671_10445703
540 Ga0207693_10009530
541 Ga0207660_10015801
542 Ga0207660_10660004
543 Ga0207657_10020531
544 Ga0207657_10062358
545 Ga0207649_10123788
546 Ga0207649_10365153
547 Ga0207652_10296382
548 Ga0207652_10518507
549 Ga0207646_10529763
550 Ga0207694_10056739
551 Ga0207694_10209876
552 Ga0207687_10110025
553 Ga0207687_10836881
554 Ga0207700_10192962
555 Ga0207700_10204492
556 Ga0207664_10258192
557 Ga0207664_10675771
558 Ga0207644_10052298
559 Ga0207644_10447005
560 Ga0207690_10093342
561 Ga0207690_10095150
562 Ga0207686_10082604
563 Ga0207665_10009108
564 Ga0207661_10155745
565 Ga0207667_10124545
566 Ga0207651_10537278
567 Ga0207677_10048454
568 Ga0207639_10294349
569 Ga0207639_10440649
570 Ga0207678_10766679
571 Ga0207702_10261073
572 Ga0207702_10296287
573 Ga0207676_10929691
574 Ga0207674_10026168
575 Ga0207674_10130786
576 Ga0207698_10410198
577 Ga0268266_10008317
578 Ga0268266_10316189
579 Ga0265338_10059602
580 Ga0373944_0009257
581 Ga0373936_0048203
582 Ga0373945_0018290
583 Ga0373953_0117652
584 Ga0373956_0075192
585 Ga0373957_0027675
586 Ga0373943_0005559
587 Ga0373943_0100013
588 Ga0373946_0091389
589 Ga0373955_0022070
590 Ga0373935_0370438
591 Ga0373927_0065269
592 Ga0373947_0002069
593 Ga0373937_0033161
594 Ga0373937_0075440
595 Ga0373925_0153517
596 Ga0373925_0465268
597 Ga0373925_1207102
598 Ga0395899_0102113
599 Ga0395899_0116331
600 Ga0395899_0240541
601 Ga0395900_0082218
602 Ga0395900_0107936
603 Ga0395900_0186729
604 Ga0395900_0303433
605 Ga0395900_0308995
606 Ga0395900_0417963
607 Ga0395900_0598993
608 Ga0395900_0601666
609 Ga0395900_0726759
610 Ga0395898_0012795
611 Ga0395898_0031602
612 Ga0395898_0059770
613 Ga0395898_0076940
614 Ga0395898_0120676
615 Ga0395898_0167202
616 Ga0395898_0198635
617 Ga0395898_0409783
618 Ga0395905_0015955
619 Ga0395905_0060359
620 Ga0395905_0209024
621 Ga0395905_0445002
622 Ga0395901_0027265
623 Ga0395901_0039211
624 Ga0395901_0045496
625 Ga0395901_0062714
626 Ga0395901_0101491
627 Ga0395901_0265117
628 Ga0395901_0307900
629 Ga0395901_0509033
630 Ga0395901_0712875
631 Ga0395901_1261666
632 Ga0436365_0450878
633 Ga0436365_0676969
634 Ga0436365_1321600
635 Ga0436363_1024046
636 Ga0466972_0155336
637 Ga0466966_0148361
638 Ga0466961_0397558
639 Ga0466963_0006082
640 Ga0466963_0012163
641 Ga0466963_0014535
642 Ga0466963_0026427
643 Ga0466963_0067853
644 Ga0466963_0146823
645 Ga0466963_0151309
646 Ga0466963_0160676
647 Ga0466963_0294111
648 Ga0466963_0351789
649 Ga0466964_0043934
650 Ga0466964_0096365
651 Ga0466964_0110412
652 Ga0466971_0002355
653 Ga0466968_0028597
654 Ga0466970_0027224
655 Ga0466970_0091183
656 Ga0466957_0002656
657 Ga0466957_0250904
658 Ga0466960_0414385
659 Ga0466960_0469398
660 Ga0466960_0483869
661 Ga0466959_0039109
662 Ga0466959_0179094
663 Ga0466958_0001843
664 Ga0466958_0111060
665 Ga0466958_0193502
666 Ga0466967_0001875
667 Ga0466967_0003388
668 Ga0466967_0004473
669 Ga0466967_0004983
670 Ga0466967_0031803
671 Ga0466967_0040902
672 Ga0466967_0050536
673 Ga0466967_0092142
674 Ga0466967_0095845
675 Ga0466967_0125760
676 Ga0466967_0163081
677 Ga0466967_0240315
678 Ga0466967_0580147
679 Ga0466967_0733417
680 Ga0495592_0027615
681 Ga0495592_0426834
682 Ga0495629_0000159
683 Ga0495629_0266634
684 Ga0495641_0007547
685 Ga0495641_0160515
686 Ga0495641_0223268
687 Ga0495651_0129408
688 Ga0495651_0476426
689 Ga0495653_0024544
690 Ga0495653_0028612
691 Ga0495582_0000183
692 Ga0495639_0085179
693 Ga0495662_0071511
694 Ga0495662_0192156
695 Ga0495584_0259287
696 Ga0495594_0156651
697 Ga0495594_0347630
698 Ga0495608_0018507
699 Ga0495608_0027394
700 Ga0495608_0299546
701 Ga0495628_0056567
702 Ga0495628_0206338
703 Ga0495630_0012894
704 Ga0495630_0030747
705 Ga0495630_0146605
706 Ga0495630_0966483
707 Ga0495666_0102363
708 Ga0495652_0161892
709 Ga0495652_0164790
710 Ga0495665_0006222
711 Ga0495665_0095905
712 Ga0495640_0011908
713 Ga0495640_0045724
714 Ga0495640_0062149
715 Ga0495640_0350273
716 Ga0495587_0016070
717 Ga0495587_0069272
718 Ga0495645_0155566
719 Ga0495645_0363756
720 Ga0495667_0032620
721 Ga0495667_0064237
722 Ga0495634_0024626
723 Ga0495635_0021005
724 Ga0495635_0473351
725 Ga0495588_0143432
726 Ga0495657_0044779
727 Ga0495657_0106994
728 Ga0495599_0097062
729 Ga0495599_0179774
730 Ga0495623_0023817
731 Ga0495623_0140115
732 Ga0495646_0183240
733 Ga0495646_0197225
734 Ga0495646_0222103
735 Ga0495647_0068118
736 Ga0495658_0009011
737 Ga0495658_0218546
738 Ga0495613_0008448
739 Ga0495613_0106493
740 Ga0495624_0126063
741 Ga0495600_0151911
742 Ga0495581_0256358
743 Ga0495604_0073923
744 Ga0495604_0090455
745 Ga0495674_0012998
746 Ga0495674_0086110
747 Ga0495674_0097278
748 Ga0495674_0397146
749 Ga0495674_1067902
750 Ga0495676_0002313
751 Ga0495680_0008139
752 Ga0495680_0012325
753 Ga0495680_0026009
754 Ga0495675_0034702
755 Ga0495675_0242718
756 Ga0495684_0026160
757 Ga0495684_0036575
758 Ga0495684_0079683
759 Ga0495684_0357942
760 Ga0495593_0013125
761 Ga0495602_0168245
762 Ga0495602_0298558
763 Ga0495614_0003012
764 Ga0496100_0034551
765 Ga0496100_0044445
766 Ga0496100_0050883
767 Ga0496101_0004053
768 Ga0496101_0008031
769 Ga0496101_0020896
770 Ga0496101_0054124
771 Ga0496101_0069353
772 Ga0496102_0006873
773 Ga0496102_0031241
774 Ga0496102_0170538
775 Ga0496102_0595718
776 Ga0496102_0656262
777 Ga0496102_0662152
778 Ga0496103_0002833
779 Ga0496104_0046529
780 Ga0496104_0064200
781 Ga0496104_0242185
782 Ga0496104_0374066
783 Ga0496104_0514688
784 Ga0496105_0017323
785 Ga0496105_0034432
786 Ga0496105_0517877
787 Ga0496105_0536462
788 Ga0496105_0815932
789 Ga0496106_0004804
790 Ga0496106_0122381
791 Ga0496106_0193744
792 Ga0496106_0667152
793 Ga0496107_0021137
794 Ga0496107_0021487
795 Ga0496107_0039676
796 Ga0496107_0095376
797 Ga0496108_0023797
798 Ga0496108_0104646
799 Ga0496108_0452995
800 Ga0496109_0007451
801 Ga0496109_0037167
802 Ga0496109_0656813
803 Ga0496110_0004546
804 Ga0496110_0143052
805 Ga0496111_0032783
806 Ga0496111_0077551
807 Ga0496111_0342372
808 Ga0496112_0011784
809 Ga0496112_0016528
810 Ga0496112_0060260
811 Ga0496112_0171341
812 Ga0496112_0302598
813 Ga0496112_0424280
814 Ga0496113_0006784
815 Ga0496113_0038609
816 Ga0496113_0236062
817 Ga0496113_0400036
818 Ga0496114_0002801
819 Ga0496114_0003912
820 Ga0496114_0090232
821 Ga0496114_0111402
822 Ga0496114_0160551
823 Ga0496114_0338977
824 Ga0496115_0002511
825 Ga0496115_0012806
826 Ga0496115_0035312
827 Ga0496115_0049060
828 Ga0496115_0049721
829 Ga0496115_0211170
830 Ga0496115_0564595
831 Ga0496115_0743590
832 Ga0501031_0349109
833 Ga0501040_0361300
834 Ga0501047_0303565
835 Ga0501047_0636518
836 Ga0501067_0022806
837 Ga0501067_0146592
838 Ga0501067_0261482
839 Ga0501068_0098927
840 Ga0501069_0012557
841 Ga0501069_0069759
842 Ga0501069_0395818
843 Ga0501070_0000159
844 Ga0501070_0193639
845 Ga0501070_0838376
846 Ga0501073_0081318
847 Ga0501074_0205484
848 Ga0501075_0710776
849 Ga0501080_0146756
850 Ga0501080_0601298
851 nmdc:mga0rr50_80600_c1
852 Ga0495601_0035279
853 Ga0495601_0137116
854 Ga0495601_0173076
855 Ga0495601_0216295
856 Ga0495595_0017460
857 Ga0495595_0182152
858 Ga0495619_0026234
859 Ga0495619_0052622
860 Ga0495619_0385408
861 Ga0495619_0386265
862 Ga0466962_0002146
863 Ga0530510_0114350
864 Ga0530510_0124803

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nmr-assembly1.cif.gz_A monomeric mouse sortilin extracellular domain 0.794 139 179
3zi8-assembly1.cif.gz_A structure of the r17a mutant of the ralstonia soleanacerum lectin at 1.5 angstrom in complex with l-fucose 0.7656 139 184
7e7u-assembly2.cif.gz_B crystal structure of rsl mutant in complex with sugar ligand 0.751 139 184
8cf7-assembly1.cif.gz_A dimethylated rsl-r5 in complex with cucurbit[7]uril, c121 sheet assembly 0.7496 139 184
8c9y-assembly1.cif.gz_A the mk-rsl - sulfonato-calix[8]arene complex, h32 form 0.7454 139 184
ID Description Score Start End Superfamily
af_Q6P773_245_397_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8045 139 186 2.130.10.10
af_I1JEP8_69_247_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.8028 142 181 2.120.10.80
af_Q54ID7_176_349_2.40.160.120 Mainly Beta;Beta Barrel;Porin; 0.8009 138 170 2.40.160.120
af_E9AGJ5_1_486_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7801 139 186 2.130.10.10
af_P34423_248_486_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7779 149 184 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A1V5LFF6-F1-model_v4 Uncharacterized protein 0.9386 118 208
AF-A0A7W0GZS8-F1-model_v4 Uncharacterized protein 0.9321 104 211
AF-A0A2W6EFW6-F1-model_v4 Uncharacterized protein 0.9189 111 208
AF-A0A4V2NWC5-F1-model_v4 Aminoacyl-transfer RNA synthetases class-II family profile domain-containing protein 0.9045 109 211
AF-A0A7W1DHR1-F1-model_v4 Chromosome segregation protein SMC 0.8942 109 211

Map