F442611
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 432 | 192 | 864 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300025915|Ga0207693_10127609|Ga0207693_101276092 |
| Length | 235 |
| Sequence | MTRVTRVTVDRSCAICERTLLMGEQAIRFSPNGGVDYVDVCPLCADTAIEYGWVREGSPTSPTVPAERRRRRSSWLQTLLGTGPRDVETVVASEPILRRLSEQELAMVEAADLFNASQYRRTVGGISKSLGEPRVSVVTLSGVNAEVVVTVAWDISWYQYRVSPESDNPVRLEGRGHDPEQLEGPFKGWNAHMGVLRRRSNERPVLARVKPRALSSVRPAQGAKHHENYQPLRVN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 31 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 32 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 35 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 44 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 50 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 51 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 52 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 53 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 54 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 84 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 85 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 86 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 87 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 88 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 89 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 90 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 91 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 92 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 93 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 94 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 95 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 96 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 97 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 98 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 99 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 100 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 101 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 102 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 103 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 104 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 105 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 106 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 107 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 108 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 109 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 110 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 111 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 112 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 113 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 114 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 115 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 116 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 117 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 118 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 163 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 164 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 165 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 166 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 167 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 168 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 171 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 172 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 173 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 174 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 175 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 176 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 183 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 187 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 192 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.38 |
| Metatranscriptomes | 1.62 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 15.74 |
| Rhizosphere | 83.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207693_10127609 | 3300025915 | Bacteria | 1999 |
| 2 | Ga0070683_100056841 | 3300005329 | Bacteria | 3634 |
| 3 | Ga0070683_100858312 | 3300005329 | Bacteria | 871 |
| 4 | Ga0070690_100169006 | 3300005330 | Bacteria | 1504 |
| 5 | Ga0070680_100051511 | 3300005336 | Bacteria | 3359 |
| 6 | Ga0070680_100210401 | 3300005336 | Bacteria | 1641 |
| 7 | Ga0070682_100161843 | 3300005337 | Bacteria | 1546 |
| 8 | Ga0068868_100114512 | 3300005338 | Bacteria | 2194 |
| 9 | Ga0068868_100252064 | 3300005338 | Bacteria | 1486 |
| 10 | Ga0070660_100032746 | 3300005339 | Bacteria | 3914 |
| 11 | Ga0070660_100125285 | 3300005339 | Bacteria | 2052 |
| 12 | Ga0070660_100206115 | 3300005339 | Bacteria | 1596 |
| 13 | Ga0070661_100026319 | 3300005344 | Bacteria | 4183 |
| 14 | Ga0070661_100062263 | 3300005344 | Bacteria | 2739 |
| 15 | Ga0070671_100258495 | 3300005355 | Bacteria | 1480 |
| 16 | Ga0070673_100807769 | 3300005364 | Unclassified | 866 |
| 17 | Ga0070709_10343821 | 3300005434 | Unclassified | 1100 |
| 18 | Ga0070714_100559194 | 3300005435 | Unclassified | 1096 |
| 19 | Ga0070714_101388927 | 3300005435 | Unclassified | 686 |
| 20 | Ga0070713_100754540 | 3300005436 | Bacteria | 931 |
| 21 | Ga0070710_10580434 | 3300005437 | Bacteria | 778 |
| 22 | Ga0070694_100152500 | 3300005444 | Bacteria | 1689 |
| 23 | Ga0070663_100536105 | 3300005455 | Bacteria | 976 |
| 24 | Ga0070681_10083661 | 3300005458 | Bacteria | 3144 |
| 25 | Ga0070681_10139948 | 3300005458 | Bacteria | 2350 |
| 26 | Ga0070681_10837293 | 3300005458 | Bacteria | 838 |
| 27 | Ga0068867_100385125 | 3300005459 | Bacteria | 1179 |
| 28 | Ga0070707_100392494 | 3300005468 | Unclassified | 1348 |
| 29 | Ga0070707_100610736 | 3300005468 | Bacteria | 1053 |
| 30 | Ga0070698_100045440 | 3300005471 | Bacteria | 4495 |
| 31 | Ga0070699_100185853 | 3300005518 | Bacteria | 1845 |
| 32 | Ga0070699_100626058 | 3300005518 | Unclassified | 982 |
| 33 | Ga0070679_100081682 | 3300005530 | Bacteria | 3221 |
| 34 | Ga0070679_100098681 | 3300005530 | Bacteria | 2908 |
| 35 | Ga0070679_100167318 | 3300005530 | Bacteria | 2171 |
| 36 | Ga0070679_100870162 | 3300005530 | Unclassified | 845 |
| 37 | Ga0070684_100287876 | 3300005535 | Unclassified | 1506 |
| 38 | Ga0070684_100616059 | 3300005535 | Unclassified | 1010 |
| 39 | Ga0068853_100352243 | 3300005539 | Bacteria | 1370 |
| 40 | Ga0068853_100687984 | 3300005539 | Unclassified | 975 |
| 41 | Ga0070696_100055213 | 3300005546 | Bacteria | 2770 |
| 42 | Ga0070696_100223344 | 3300005546 | Unclassified | 1414 |
| 43 | Ga0070665_100006128 | 3300005548 | Bacteria | 12291 |
| 44 | Ga0068855_100102257 | 3300005563 | Bacteria | 3298 |
| 45 | Ga0068855_100409701 | 3300005563 | Bacteria | 1484 |
| 46 | Ga0068855_100563887 | 3300005563 | Bacteria | 1231 |
| 47 | Ga0068855_100825911 | 3300005563 | Unclassified | 983 |
| 48 | Ga0068857_100060636 | 3300005577 | Bacteria | 3360 |
| 49 | Ga0068857_100347315 | 3300005577 | Bacteria | 1373 |
| 50 | Ga0068856_100036403 | 3300005614 | Bacteria | 4826 |
| 51 | Ga0068856_100086357 | 3300005614 | Bacteria | 3117 |
| 52 | Ga0068856_100117907 | 3300005614 | Bacteria | 2655 |
| 53 | Ga0068852_100041396 | 3300005616 | Bacteria | 3893 |
| 54 | Ga0068852_100151856 | 3300005616 | Bacteria | 2155 |
| 55 | Ga0068864_100211328 | 3300005618 | Bacteria | 1787 |
| 56 | Ga0070716_100004103 | 3300006173 | Bacteria | 6910 |
| 57 | Ga0070712_100060375 | 3300006175 | Bacteria | 2674 |
| 58 | Ga0070712_100071737 | 3300006175 | Bacteria | 2479 |
| 59 | Ga0070712_100166066 | 3300006175 | Bacteria | 1709 |
| 60 | Ga0070712_100239140 | 3300006175 | Bacteria | 1446 |
| 61 | Ga0075434_100379337 | 3300006871 | Bacteria | 1435 |
| 62 | Ga0105240_10295241 | 3300009093 | Bacteria | 1856 |
| 63 | Ga0105240_10776817 | 3300009093 | Bacteria | 1039 |
| 64 | Ga0105245_10124678 | 3300009098 | Bacteria | 2409 |
| 65 | Ga0105245_10632400 | 3300009098 | Bacteria | 1099 |
| 66 | Ga0105245_10639663 | 3300009098 | Bacteria | 1093 |
| 67 | Ga0105241_10326401 | 3300009174 | Bacteria | 1325 |
| 68 | Ga0105237_10075490 | 3300009545 | Bacteria | 3362 |
| 69 | Ga0105237_10288025 | 3300009545 | Bacteria | 1645 |
| 70 | Ga0105238_10001956 | 3300009551 | Bacteria | 20739 |
| 71 | Ga0105238_10172414 | 3300009551 | Bacteria | 2140 |
| 72 | Ga0105239_10924877 | 3300010375 | Unclassified | 1001 |
| 73 | Ga0105239_10939010 | 3300010375 | Bacteria | 993 |
| 74 | Ga0105246_10560725 | 3300011119 | Bacteria | 980 |
| 75 | Ga0157371_10681550 | 3300013102 | Unclassified | 769 |
| 76 | Ga0157370_10065225 | 3300013104 | Bacteria | 3445 |
| 77 | Ga0157370_10309084 | 3300013104 | Bacteria | 1459 |
| 78 | Ga0157370_10522968 | 3300013104 | Bacteria | 1089 |
| 79 | Ga0157370_10719777 | 3300013104 | Bacteria | 910 |
| 80 | Ga0157369_10115190 | 3300013105 | Bacteria | 2855 |
| 81 | Ga0157369_10116670 | 3300013105 | Bacteria | 2834 |
| 82 | Ga0157369_10187602 | 3300013105 | Bacteria | 2174 |
| 83 | Ga0157369_11174612 | 3300013105 | Bacteria | 784 |
| 84 | Ga0157374_10082564 | 3300013296 | Bacteria | 3051 |
| 85 | Ga0157374_10734266 | 3300013296 | Unclassified | 1002 |
| 86 | Ga0157378_10156708 | 3300013297 | Bacteria | 2127 |
| 87 | Ga0157372_10068333 | 3300013307 | Bacteria | 3994 |
| 88 | Ga0157372_10184851 | 3300013307 | Bacteria | 2413 |
| 89 | Ga0157372_10414756 | 3300013307 | Bacteria | 1569 |
| 90 | Ga0157372_10732757 | 3300013307 | Bacteria | 1150 |
| 91 | Ga0157377_10707689 | 3300014745 | Unclassified | 732 |
| 92 | Ga0197907_10357015 | 3300020069 | Unclassified | 1149 |
| 93 | Ga0197907_10465661 | 3300020069 | Bacteria | 1294 |
| 94 | Ga0206356_10123609 | 3300020070 | Bacteria | 1292 |
| 95 | Ga0206356_10851575 | 3300020070 | Bacteria | 1270 |
| 96 | Ga0206350_10874619 | 3300020080 | Unclassified | 1101 |
| 97 | Ga0206354_10996108 | 3300020081 | Bacteria | 2030 |
| 98 | Ga0224712_10031408 | 3300022467 | Bacteria | 1927 |
| 99 | Ga0207692_10279838 | 3300025898 | Unclassified | 1009 |
| 100 | Ga0207684_10597386 | 3300025910 | Bacteria | 943 |
| 101 | Ga0207707_10055508 | 3300025912 | Bacteria | 3446 |
| 102 | Ga0207707_10096922 | 3300025912 | Bacteria | 2577 |
| 103 | Ga0207695_10454628 | 3300025913 | Unclassified | 1164 |
| 104 | Ga0207695_10487964 | 3300025913 | Unclassified | 1114 |
| 105 | Ga0207695_10556772 | 3300025913 | Bacteria | 1028 |
| 106 | Ga0207671_10144748 | 3300025914 | Bacteria | 1833 |
| 107 | Ga0207671_10445703 | 3300025914 | Unclassified | 1031 |
| 108 | Ga0207693_10009530 | 3300025915 | Bacteria | 7910 |
| 109 | Ga0207660_10015801 | 3300025917 | Bacteria | 4988 |
| 110 | Ga0207660_10660004 | 3300025917 | Bacteria | 853 |
| 111 | Ga0207657_10020531 | 3300025919 | Bacteria | 6240 |
| 112 | Ga0207657_10062358 | 3300025919 | Bacteria | 3192 |
| 113 | Ga0207649_10123788 | 3300025920 | Bacteria | 1747 |
| 114 | Ga0207649_10365153 | 3300025920 | Bacteria | 1072 |
| 115 | Ga0207652_10296382 | 3300025921 | Bacteria | 1459 |
| 116 | Ga0207652_10518507 | 3300025921 | Unclassified | 1072 |
| 117 | Ga0207646_10529763 | 3300025922 | Bacteria | 1060 |
| 118 | Ga0207694_10056739 | 3300025924 | Bacteria | 3042 |
| 119 | Ga0207694_10209876 | 3300025924 | Bacteria | 1586 |
| 120 | Ga0207687_10110025 | 3300025927 | Bacteria | 2042 |
| 121 | Ga0207687_10836881 | 3300025927 | Bacteria | 786 |
| 122 | Ga0207700_10192962 | 3300025928 | Bacteria | 1712 |
| 123 | Ga0207700_10204492 | 3300025928 | Bacteria | 1666 |
| 124 | Ga0207664_10258192 | 3300025929 | Bacteria | 1523 |
| 125 | Ga0207664_10675771 | 3300025929 | Unclassified | 928 |
| 126 | Ga0207644_10052298 | 3300025931 | Bacteria | 2935 |
| 127 | Ga0207644_10447005 | 3300025931 | Unclassified | 1061 |
| 128 | Ga0207690_10093342 | 3300025932 | Bacteria | 2132 |
| 129 | Ga0207690_10095150 | 3300025932 | Unclassified | 2115 |
| 130 | Ga0207686_10082604 | 3300025934 | Bacteria | 2101 |
| 131 | Ga0207665_10009108 | 3300025939 | Bacteria | 6518 |
| 132 | Ga0207661_10155745 | 3300025944 | Bacteria | 1979 |
| 133 | Ga0207667_10124545 | 3300025949 | Bacteria | 2655 |
| 134 | Ga0207651_10537278 | 3300025960 | Unclassified | 1015 |
| 135 | Ga0207677_10048454 | 3300026023 | Bacteria | 2861 |
| 136 | Ga0207639_10294349 | 3300026041 | Bacteria | 1432 |
| 137 | Ga0207639_10440649 | 3300026041 | Bacteria | 1181 |
| 138 | Ga0207678_10766679 | 3300026067 | Bacteria | 851 |
| 139 | Ga0207702_10261073 | 3300026078 | Bacteria | 1631 |
| 140 | Ga0207702_10296287 | 3300026078 | Bacteria | 1534 |
| 141 | Ga0207676_10929691 | 3300026095 | Bacteria | 854 |
| 142 | Ga0207674_10026168 | 3300026116 | Bacteria | 6207 |
| 143 | Ga0207674_10130786 | 3300026116 | Bacteria | 2473 |
| 144 | Ga0207698_10410198 | 3300026142 | Unclassified | 1297 |
| 145 | Ga0268266_10008317 | 3300028379 | Bacteria | 9240 |
| 146 | Ga0268266_10316189 | 3300028379 | Bacteria | 1460 |
| 147 | Ga0265338_10059602 | 3300028800 | Bacteria | 3362 |
| 148 | Ga0373944_0009257 | 3300035089 | Bacteria | 2669 |
| 149 | Ga0373936_0048203 | 3300035113 | Bacteria | 1719 |
| 150 | Ga0373945_0018290 | 3300035116 | Bacteria | 2383 |
| 151 | Ga0373953_0117652 | 3300035117 | Unclassified | 1127 |
| 152 | Ga0373956_0075192 | 3300035119 | Bacteria | 1545 |
| 153 | Ga0373957_0027675 | 3300035120 | Bacteria | 2061 |
| 154 | Ga0373943_0005559 | 3300035170 | Bacteria | 5659 |
| 155 | Ga0373943_0100013 | 3300035170 | Unclassified | 1515 |
| 156 | Ga0373946_0091389 | 3300035171 | Bacteria | 1349 |
| 157 | Ga0373955_0022070 | 3300035172 | Bacteria | 3223 |
| 158 | Ga0373935_0370438 | 3300035692 | Archaea | 1024 |
| 159 | Ga0373927_0065269 | 3300035695 | Bacteria | 2355 |
| 160 | Ga0373947_0002069 | 3300035725 | Bacteria | 12240 |
| 161 | Ga0373937_0033161 | 3300036401 | Bacteria | 4688 |
| 162 | Ga0373937_0075440 | 3300036401 | Bacteria | 3113 |
| 163 | Ga0373925_0153517 | 3300037068 | Bacteria | 1810 |
| 164 | Ga0373925_0465268 | 3300037068 | Bacteria | 1036 |
| 165 | Ga0373925_1207102 | 3300037068 | Bacteria | 621 |
| 166 | Ga0395899_0102113 | 3300037312 | Bacteria | 2069 |
| 167 | Ga0395899_0116331 | 3300037312 | Bacteria | 1918 |
| 168 | Ga0395899_0240541 | 3300037312 | Bacteria | 1246 |
| 169 | Ga0395900_0082218 | 3300037418 | Bacteria | 3309 |
| 170 | Ga0395900_0107936 | 3300037418 | Bacteria | 2860 |
| 171 | Ga0395900_0186729 | 3300037418 | Bacteria | 2104 |
| 172 | Ga0395900_0303433 | 3300037418 | Bacteria | 1582 |
| 173 | Ga0395900_0308995 | 3300037418 | Bacteria | 1565 |
| 174 | Ga0395900_0417963 | 3300037418 | Unclassified | 1302 |
| 175 | Ga0395900_0598993 | 3300037418 | Unclassified | 1043 |
| 176 | Ga0395900_0601666 | 3300037418 | Unclassified | 1040 |
| 177 | Ga0395900_0726759 | 3300037418 | Bacteria | 925 |
| 178 | Ga0395898_0012795 | 3300037466 | Bacteria | 8662 |
| 179 | Ga0395898_0031602 | 3300037466 | Bacteria | 5289 |
| 180 | Ga0395898_0059770 | 3300037466 | Unclassified | 3706 |
| 181 | Ga0395898_0076940 | 3300037466 | Bacteria | 3222 |
| 182 | Ga0395898_0120676 | 3300037466 | Bacteria | 2512 |
| 183 | Ga0395898_0167202 | 3300037466 | Bacteria | 2103 |
| 184 | Ga0395898_0198635 | 3300037466 | Bacteria | 1915 |
| 185 | Ga0395898_0409783 | 3300037466 | Unclassified | 1292 |
| 186 | Ga0395905_0015955 | 3300037471 | Bacteria | 7139 |
| 187 | Ga0395905_0060359 | 3300037471 | Bacteria | 3546 |
| 188 | Ga0395905_0209024 | 3300037471 | Bacteria | 1829 |
| 189 | Ga0395905_0445002 | 3300037471 | Bacteria | 1193 |
| 190 | Ga0395901_0027265 | 3300038443 | Bacteria | 5868 |
| 191 | Ga0395901_0039211 | 3300038443 | Bacteria | 4902 |
| 192 | Ga0395901_0045496 | 3300038443 | Bacteria | 4555 |
| 193 | Ga0395901_0062714 | 3300038443 | Bacteria | 3868 |
| 194 | Ga0395901_0101491 | 3300038443 | Bacteria | 3019 |
| 195 | Ga0395901_0265117 | 3300038443 | Bacteria | 1787 |
| 196 | Ga0395901_0307900 | 3300038443 | Bacteria | 1641 |
| 197 | Ga0395901_0509033 | 3300038443 | Unclassified | 1225 |
| 198 | Ga0395901_0712875 | 3300038443 | Unclassified | 1000 |
| 199 | Ga0395901_1261666 | 3300038443 | Bacteria | 702 |
| 200 | Ga0436365_0450878 | 3300039437 | Bacteria | 1272 |
| 201 | Ga0436365_0676969 | 3300039437 | Bacteria | 1931 |
| 202 | Ga0436365_1321600 | 3300039437 | Unclassified | 715 |
| 203 | Ga0436363_1024046 | 3300039450 | Bacteria | 714 |
| 204 | Ga0466972_0155336 | 3300044658 | Bacteria | 1075 |
| 205 | Ga0466966_0148361 | 3300044684 | Bacteria | 1431 |
| 206 | Ga0466961_0397558 | 3300044693 | Unclassified | 836 |
| 207 | Ga0466963_0006082 | 3300044694 | Bacteria | 7117 |
| 208 | Ga0466963_0012163 | 3300044694 | Bacteria | 5260 |
| 209 | Ga0466963_0014535 | 3300044694 | Bacteria | 4856 |
| 210 | Ga0466963_0026427 | 3300044694 | Bacteria | 3713 |
| 211 | Ga0466963_0067853 | 3300044694 | Bacteria | 2394 |
| 212 | Ga0466963_0146823 | 3300044694 | Bacteria | 1637 |
| 213 | Ga0466963_0151309 | 3300044694 | Bacteria | 1611 |
| 214 | Ga0466963_0160676 | 3300044694 | Bacteria | 1563 |
| 215 | Ga0466963_0294111 | 3300044694 | Bacteria | 1142 |
| 216 | Ga0466963_0351789 | 3300044694 | Bacteria | 1038 |
| 217 | Ga0466964_0043934 | 3300044706 | Bacteria | 1814 |
| 218 | Ga0466964_0096365 | 3300044706 | Unclassified | 1296 |
| 219 | Ga0466964_0110412 | 3300044706 | Unclassified | 1225 |
| 220 | Ga0466971_0002355 | 3300044719 | Bacteria | 7975 |
| 221 | Ga0466968_0028597 | 3300044735 | Bacteria | 2299 |
| 222 | Ga0466970_0027224 | 3300044765 | Bacteria | 2999 |
| 223 | Ga0466970_0091183 | 3300044765 | Bacteria | 1654 |
| 224 | Ga0466957_0002656 | 3300044842 | Bacteria | 9650 |
| 225 | Ga0466957_0250904 | 3300044842 | Unclassified | 1177 |
| 226 | Ga0466960_0414385 | 3300044901 | Unclassified | 778 |
| 227 | Ga0466960_0469398 | 3300044901 | Unclassified | 734 |
| 228 | Ga0466960_0483869 | 3300044901 | Unclassified | 723 |
| 229 | Ga0466959_0039109 | 3300045049 | Bacteria | 3505 |
| 230 | Ga0466959_0179094 | 3300045049 | Unclassified | 1483 |
| 231 | Ga0466958_0001843 | 3300045836 | Bacteria | 10324 |
| 232 | Ga0466958_0111060 | 3300045836 | Bacteria | 1711 |
| 233 | Ga0466958_0193502 | 3300045836 | Bacteria | 1293 |
| 234 | Ga0466967_0001875 | 3300045976 | Bacteria | 12683 |
| 235 | Ga0466967_0003388 | 3300045976 | Bacteria | 10387 |
| 236 | Ga0466967_0004473 | 3300045976 | Bacteria | 9435 |
| 237 | Ga0466967_0004983 | 3300045976 | Bacteria | 9092 |
| 238 | Ga0466967_0031803 | 3300045976 | Bacteria | 4448 |
| 239 | Ga0466967_0040902 | 3300045976 | Bacteria | 3993 |
| 240 | Ga0466967_0050536 | 3300045976 | Bacteria | 3641 |
| 241 | Ga0466967_0092142 | 3300045976 | Bacteria | 2755 |
| 242 | Ga0466967_0095845 | 3300045976 | Bacteria | 2705 |
| 243 | Ga0466967_0125760 | 3300045976 | Bacteria | 2374 |
| 244 | Ga0466967_0163081 | 3300045976 | Bacteria | 2093 |
| 245 | Ga0466967_0240315 | 3300045976 | Bacteria | 1727 |
| 246 | Ga0466967_0580147 | 3300045976 | Bacteria | 1105 |
| 247 | Ga0466967_0733417 | 3300045976 | Bacteria | 979 |
| 248 | Ga0495592_0027615 | 3300046454 | Bacteria | 4301 |
| 249 | Ga0495592_0426834 | 3300046454 | Bacteria | 835 |
| 250 | Ga0495629_0000159 | 3300046459 | Bacteria | 59616 |
| 251 | Ga0495629_0266634 | 3300046459 | Bacteria | 1177 |
| 252 | Ga0495641_0007547 | 3300046461 | Bacteria | 6772 |
| 253 | Ga0495641_0160515 | 3300046461 | Unclassified | 1005 |
| 254 | Ga0495641_0223268 | 3300046461 | Archaea | 845 |
| 255 | Ga0495651_0129408 | 3300046462 | Bacteria | 1844 |
| 256 | Ga0495651_0476426 | 3300046462 | Unclassified | 802 |
| 257 | Ga0495653_0024544 | 3300046463 | Bacteria | 4857 |
| 258 | Ga0495653_0028612 | 3300046463 | Bacteria | 4455 |
| 259 | Ga0495582_0000183 | 3300046473 | Bacteria | 34098 |
| 260 | Ga0495639_0085179 | 3300046475 | Bacteria | 1477 |
| 261 | Ga0495662_0071511 | 3300046476 | Bacteria | 1681 |
| 262 | Ga0495662_0192156 | 3300046476 | Bacteria | 1006 |
| 263 | Ga0495584_0259287 | 3300046491 | Unclassified | 884 |
| 264 | Ga0495594_0156651 | 3300046499 | Bacteria | 1294 |
| 265 | Ga0495594_0347630 | 3300046499 | Unclassified | 844 |
| 266 | Ga0495608_0018507 | 3300046511 | Bacteria | 4804 |
| 267 | Ga0495608_0027394 | 3300046511 | Bacteria | 3877 |
| 268 | Ga0495608_0299546 | 3300046511 | Bacteria | 996 |
| 269 | Ga0495628_0056567 | 3300046516 | Bacteria | 3087 |
| 270 | Ga0495628_0206338 | 3300046516 | Unclassified | 1479 |
| 271 | Ga0495630_0012894 | 3300046517 | Bacteria | 6072 |
| 272 | Ga0495630_0030747 | 3300046517 | Bacteria | 3996 |
| 273 | Ga0495630_0146605 | 3300046517 | Bacteria | 1795 |
| 274 | Ga0495630_0966483 | 3300046517 | Bacteria | 648 |
| 275 | Ga0495666_0102363 | 3300046526 | Bacteria | 1349 |
| 276 | Ga0495652_0161892 | 3300046529 | Bacteria | 1736 |
| 277 | Ga0495652_0164790 | 3300046529 | Bacteria | 1716 |
| 278 | Ga0495665_0006222 | 3300046531 | Bacteria | 6444 |
| 279 | Ga0495665_0095905 | 3300046531 | Bacteria | 1558 |
| 280 | Ga0495640_0011908 | 3300046533 | Bacteria | 6670 |
| 281 | Ga0495640_0045724 | 3300046533 | Bacteria | 3037 |
| 282 | Ga0495640_0062149 | 3300046533 | Bacteria | 2534 |
| 283 | Ga0495640_0350273 | 3300046533 | Unclassified | 911 |
| 284 | Ga0495587_0016070 | 3300046536 | Bacteria | 4658 |
| 285 | Ga0495587_0069272 | 3300046536 | Bacteria | 2054 |
| 286 | Ga0495645_0155566 | 3300046543 | Bacteria | 1584 |
| 287 | Ga0495645_0363756 | 3300046543 | Unclassified | 929 |
| 288 | Ga0495667_0032620 | 3300046559 | Bacteria | 3489 |
| 289 | Ga0495667_0064237 | 3300046559 | Bacteria | 2401 |
| 290 | Ga0495634_0024626 | 3300046642 | Bacteria | 4220 |
| 291 | Ga0495635_0021005 | 3300046663 | Bacteria | 4551 |
| 292 | Ga0495635_0473351 | 3300046663 | Unclassified | 826 |
| 293 | Ga0495588_0143432 | 3300046674 | Bacteria | 1262 |
| 294 | Ga0495657_0044779 | 3300046675 | Bacteria | 3007 |
| 295 | Ga0495657_0106994 | 3300046675 | Bacteria | 1775 |
| 296 | Ga0495599_0097062 | 3300046678 | Bacteria | 1837 |
| 297 | Ga0495599_0179774 | 3300046678 | Bacteria | 1304 |
| 298 | Ga0495623_0023817 | 3300046679 | Bacteria | 3949 |
| 299 | Ga0495623_0140115 | 3300046679 | Bacteria | 1440 |
| 300 | Ga0495646_0183240 | 3300046680 | Unclassified | 1148 |
| 301 | Ga0495646_0197225 | 3300046680 | Bacteria | 1098 |
| 302 | Ga0495646_0222103 | 3300046680 | Bacteria | 1021 |
| 303 | Ga0495647_0068118 | 3300046681 | Unclassified | 1419 |
| 304 | Ga0495658_0009011 | 3300046683 | Bacteria | 4959 |
| 305 | Ga0495658_0218546 | 3300046683 | Bacteria | 1192 |
| 306 | Ga0495613_0008448 | 3300046689 | Bacteria | 7641 |
| 307 | Ga0495613_0106493 | 3300046689 | Bacteria | 2023 |
| 308 | Ga0495624_0126063 | 3300046690 | Bacteria | 1571 |
| 309 | Ga0495600_0151911 | 3300046809 | Bacteria | 1499 |
| 310 | Ga0495581_0256358 | 3300047315 | Unclassified | 1023 |
| 311 | Ga0495604_0073923 | 3300047317 | Bacteria | 2570 |
| 312 | Ga0495604_0090455 | 3300047317 | Bacteria | 2273 |
| 313 | Ga0495674_0012998 | 3300047319 | Bacteria | 7837 |
| 314 | Ga0495674_0086110 | 3300047319 | Bacteria | 2691 |
| 315 | Ga0495674_0097278 | 3300047319 | Bacteria | 2507 |
| 316 | Ga0495674_0397146 | 3300047319 | Unclassified | 1113 |
| 317 | Ga0495674_1067902 | 3300047319 | Bacteria | 616 |
| 318 | Ga0495676_0002313 | 3300047321 | Bacteria | 16914 |
| 319 | Ga0495680_0008139 | 3300047322 | Bacteria | 9555 |
| 320 | Ga0495680_0012325 | 3300047322 | Bacteria | 7530 |
| 321 | Ga0495680_0026009 | 3300047322 | Bacteria | 4833 |
| 322 | Ga0495675_0034702 | 3300047444 | Bacteria | 3220 |
| 323 | Ga0495675_0242718 | 3300047444 | Bacteria | 1084 |
| 324 | Ga0495684_0026160 | 3300047471 | Bacteria | 4484 |
| 325 | Ga0495684_0036575 | 3300047471 | Bacteria | 3763 |
| 326 | Ga0495684_0079683 | 3300047471 | Bacteria | 2486 |
| 327 | Ga0495684_0357942 | 3300047471 | Unclassified | 1034 |
| 328 | Ga0495593_0013125 | 3300047673 | Bacteria | 4730 |
| 329 | Ga0495602_0168245 | 3300048088 | Bacteria | 1704 |
| 330 | Ga0495602_0298558 | 3300048088 | Unclassified | 1180 |
| 331 | Ga0495614_0003012 | 3300048089 | Bacteria | 7504 |
| 332 | Ga0496100_0034551 | 3300048903 | Bacteria | 3174 |
| 333 | Ga0496100_0044445 | 3300048903 | Bacteria | 2845 |
| 334 | Ga0496100_0050883 | 3300048903 | Bacteria | 2686 |
| 335 | Ga0496101_0004053 | 3300048904 | Bacteria | 9156 |
| 336 | Ga0496101_0008031 | 3300048904 | Bacteria | 6878 |
| 337 | Ga0496101_0020896 | 3300048904 | Bacteria | 4491 |
| 338 | Ga0496101_0054124 | 3300048904 | Bacteria | 2897 |
| 339 | Ga0496101_0069353 | 3300048904 | Bacteria | 2579 |
| 340 | Ga0496102_0006873 | 3300048905 | Bacteria | 9708 |
| 341 | Ga0496102_0031241 | 3300048905 | Bacteria | 4775 |
| 342 | Ga0496102_0170538 | 3300048905 | Bacteria | 2049 |
| 343 | Ga0496102_0595718 | 3300048905 | Bacteria | 1028 |
| 344 | Ga0496102_0656262 | 3300048905 | Unclassified | 972 |
| 345 | Ga0496102_0662152 | 3300048905 | Bacteria | 967 |
| 346 | Ga0496103_0002833 | 3300048906 | Bacteria | 10788 |
| 347 | Ga0496104_0046529 | 3300048907 | Bacteria | 4086 |
| 348 | Ga0496104_0064200 | 3300048907 | Bacteria | 3483 |
| 349 | Ga0496104_0242185 | 3300048907 | Bacteria | 1716 |
| 350 | Ga0496104_0374066 | 3300048907 | Bacteria | 1337 |
| 351 | Ga0496104_0514688 | 3300048907 | Bacteria | 1108 |
| 352 | Ga0496105_0017323 | 3300048908 | Bacteria | 5774 |
| 353 | Ga0496105_0034432 | 3300048908 | Bacteria | 4165 |
| 354 | Ga0496105_0517877 | 3300048908 | Bacteria | 934 |
| 355 | Ga0496105_0536462 | 3300048908 | Bacteria | 915 |
| 356 | Ga0496105_0815932 | 3300048908 | Unclassified | 708 |
| 357 | Ga0496106_0004804 | 3300048909 | Bacteria | 9996 |
| 358 | Ga0496106_0122381 | 3300048909 | Bacteria | 2035 |
| 359 | Ga0496106_0193744 | 3300048909 | Bacteria | 1616 |
| 360 | Ga0496106_0667152 | 3300048909 | Bacteria | 830 |
| 361 | Ga0496107_0021137 | 3300048910 | Bacteria | 4600 |
| 362 | Ga0496107_0021487 | 3300048910 | Bacteria | 4561 |
| 363 | Ga0496107_0039676 | 3300048910 | Bacteria | 3378 |
| 364 | Ga0496107_0095376 | 3300048910 | Unclassified | 2177 |
| 365 | Ga0496108_0023797 | 3300048911 | Bacteria | 5040 |
| 366 | Ga0496108_0104646 | 3300048911 | Bacteria | 2415 |
| 367 | Ga0496108_0452995 | 3300048911 | Bacteria | 1121 |
| 368 | Ga0496109_0007451 | 3300048912 | Bacteria | 9265 |
| 369 | Ga0496109_0037167 | 3300048912 | Bacteria | 4399 |
| 370 | Ga0496109_0656813 | 3300048912 | Unclassified | 985 |
| 371 | Ga0496110_0004546 | 3300048913 | Bacteria | 10771 |
| 372 | Ga0496110_0143052 | 3300048913 | Bacteria | 2162 |
| 373 | Ga0496111_0032783 | 3300048914 | Bacteria | 3704 |
| 374 | Ga0496111_0077551 | 3300048914 | Bacteria | 2422 |
| 375 | Ga0496111_0342372 | 3300048914 | Bacteria | 1107 |
| 376 | Ga0496112_0011784 | 3300048915 | Bacteria | 8004 |
| 377 | Ga0496112_0016528 | 3300048915 | Bacteria | 6917 |
| 378 | Ga0496112_0060260 | 3300048915 | Bacteria | 3740 |
| 379 | Ga0496112_0171341 | 3300048915 | Bacteria | 2136 |
| 380 | Ga0496112_0302598 | 3300048915 | Bacteria | 1544 |
| 381 | Ga0496112_0424280 | 3300048915 | Bacteria | 1268 |
| 382 | Ga0496113_0006784 | 3300048916 | Bacteria | 7297 |
| 383 | Ga0496113_0038609 | 3300048916 | Bacteria | 3511 |
| 384 | Ga0496113_0236062 | 3300048916 | Bacteria | 1459 |
| 385 | Ga0496113_0400036 | 3300048916 | Unclassified | 1103 |
| 386 | Ga0496114_0002801 | 3300048917 | Bacteria | 13360 |
| 387 | Ga0496114_0003912 | 3300048917 | Bacteria | 11490 |
| 388 | Ga0496114_0090232 | 3300048917 | Bacteria | 2601 |
| 389 | Ga0496114_0111402 | 3300048917 | Bacteria | 2345 |
| 390 | Ga0496114_0160551 | 3300048917 | Bacteria | 1954 |
| 391 | Ga0496114_0338977 | 3300048917 | Bacteria | 1329 |
| 392 | Ga0496115_0002511 | 3300048918 | Bacteria | 13174 |
| 393 | Ga0496115_0012806 | 3300048918 | Bacteria | 6323 |
| 394 | Ga0496115_0035312 | 3300048918 | Bacteria | 3955 |
| 395 | Ga0496115_0049060 | 3300048918 | Bacteria | 3378 |
| 396 | Ga0496115_0049721 | 3300048918 | Bacteria | 3357 |
| 397 | Ga0496115_0211170 | 3300048918 | Bacteria | 1603 |
| 398 | Ga0496115_0564595 | 3300048918 | Unclassified | 908 |
| 399 | Ga0496115_0743590 | 3300048918 | Bacteria | 767 |
| 400 | Ga0501031_0349109 | 3300049568 | Bacteria | 958 |
| 401 | Ga0501040_0361300 | 3300049576 | Bacteria | 1041 |
| 402 | Ga0501047_0303565 | 3300049581 | Unclassified | 1438 |
| 403 | Ga0501047_0636518 | 3300049581 | Unclassified | 886 |
| 404 | Ga0501067_0022806 | 3300049583 | Bacteria | 3465 |
| 405 | Ga0501067_0146592 | 3300049583 | Bacteria | 1315 |
| 406 | Ga0501067_0261482 | 3300049583 | Bacteria | 963 |
| 407 | Ga0501068_0098927 | 3300049584 | Bacteria | 1807 |
| 408 | Ga0501069_0012557 | 3300049585 | Bacteria | 4504 |
| 409 | Ga0501069_0069759 | 3300049585 | Bacteria | 1968 |
| 410 | Ga0501069_0395818 | 3300049585 | Bacteria | 817 |
| 411 | Ga0501070_0000159 | 3300049586 | Bacteria | 62347 |
| 412 | Ga0501070_0193639 | 3300049586 | Bacteria | 1670 |
| 413 | Ga0501070_0838376 | 3300049586 | Unclassified | 720 |
| 414 | Ga0501073_0081318 | 3300049589 | Bacteria | 2254 |
| 415 | Ga0501074_0205484 | 3300049590 | Bacteria | 1403 |
| 416 | Ga0501075_0710776 | 3300049591 | Unclassified | 765 |
| 417 | Ga0501080_0146756 | 3300049742 | Bacteria | 2181 |
| 418 | Ga0501080_0601298 | 3300049742 | Unclassified | 976 |
| 419 | nmdc:mga0rr50_80600_c1 | 3300050513 | Bacteria | 2510 |
| 420 | Ga0495601_0035279 | 3300053077 | Bacteria | 3121 |
| 421 | Ga0495601_0137116 | 3300053077 | Bacteria | 1595 |
| 422 | Ga0495601_0173076 | 3300053077 | Unclassified | 1411 |
| 423 | Ga0495601_0216295 | 3300053077 | Unclassified | 1252 |
| 424 | Ga0495595_0017460 | 3300053084 | Bacteria | 3086 |
| 425 | Ga0495595_0182152 | 3300053084 | Bacteria | 1042 |
| 426 | Ga0495619_0026234 | 3300053085 | Bacteria | 3747 |
| 427 | Ga0495619_0052622 | 3300053085 | Bacteria | 2692 |
| 428 | Ga0495619_0385408 | 3300053085 | Unclassified | 968 |
| 429 | Ga0495619_0386265 | 3300053085 | Bacteria | 967 |
| 430 | Ga0466962_0002146 | 3300061719 | Bacteria | 9316 |
| 431 | Ga0530510_0114350 | 3300061734 | Bacteria | 1978 |
| 432 | Ga0530510_0124803 | 3300061734 | Bacteria | 1892 |
| 433 | Ga0207693_10127609 | |||
| 434 | Ga0070683_100056841 | |||
| 435 | Ga0070683_100858312 | |||
| 436 | Ga0070690_100169006 | |||
| 437 | Ga0070680_100051511 | |||
| 438 | Ga0070680_100210401 | |||
| 439 | Ga0070682_100161843 | |||
| 440 | Ga0068868_100114512 | |||
| 441 | Ga0068868_100252064 | |||
| 442 | Ga0070660_100032746 | |||
| 443 | Ga0070660_100125285 | |||
| 444 | Ga0070660_100206115 | |||
| 445 | Ga0070661_100026319 | |||
| 446 | Ga0070661_100062263 | |||
| 447 | Ga0070671_100258495 | |||
| 448 | Ga0070673_100807769 | |||
| 449 | Ga0070709_10343821 | |||
| 450 | Ga0070714_100559194 | |||
| 451 | Ga0070714_101388927 | |||
| 452 | Ga0070713_100754540 | |||
| 453 | Ga0070710_10580434 | |||
| 454 | Ga0070694_100152500 | |||
| 455 | Ga0070663_100536105 | |||
| 456 | Ga0070681_10083661 | |||
| 457 | Ga0070681_10139948 | |||
| 458 | Ga0070681_10837293 | |||
| 459 | Ga0068867_100385125 | |||
| 460 | Ga0070707_100392494 | |||
| 461 | Ga0070707_100610736 | |||
| 462 | Ga0070698_100045440 | |||
| 463 | Ga0070699_100185853 | |||
| 464 | Ga0070699_100626058 | |||
| 465 | Ga0070679_100081682 | |||
| 466 | Ga0070679_100098681 | |||
| 467 | Ga0070679_100167318 | |||
| 468 | Ga0070679_100870162 | |||
| 469 | Ga0070684_100287876 | |||
| 470 | Ga0070684_100616059 | |||
| 471 | Ga0068853_100352243 | |||
| 472 | Ga0068853_100687984 | |||
| 473 | Ga0070696_100055213 | |||
| 474 | Ga0070696_100223344 | |||
| 475 | Ga0070665_100006128 | |||
| 476 | Ga0068855_100102257 | |||
| 477 | Ga0068855_100409701 | |||
| 478 | Ga0068855_100563887 | |||
| 479 | Ga0068855_100825911 | |||
| 480 | Ga0068857_100060636 | |||
| 481 | Ga0068857_100347315 | |||
| 482 | Ga0068856_100036403 | |||
| 483 | Ga0068856_100086357 | |||
| 484 | Ga0068856_100117907 | |||
| 485 | Ga0068852_100041396 | |||
| 486 | Ga0068852_100151856 | |||
| 487 | Ga0068864_100211328 | |||
| 488 | Ga0070716_100004103 | |||
| 489 | Ga0070712_100060375 | |||
| 490 | Ga0070712_100071737 | |||
| 491 | Ga0070712_100166066 | |||
| 492 | Ga0070712_100239140 | |||
| 493 | Ga0075434_100379337 | |||
| 494 | Ga0105240_10295241 | |||
| 495 | Ga0105240_10776817 | |||
| 496 | Ga0105245_10124678 | |||
| 497 | Ga0105245_10632400 | |||
| 498 | Ga0105245_10639663 | |||
| 499 | Ga0105241_10326401 | |||
| 500 | Ga0105237_10075490 | |||
| 501 | Ga0105237_10288025 | |||
| 502 | Ga0105238_10001956 | |||
| 503 | Ga0105238_10172414 | |||
| 504 | Ga0105239_10924877 | |||
| 505 | Ga0105239_10939010 | |||
| 506 | Ga0105246_10560725 | |||
| 507 | Ga0157371_10681550 | |||
| 508 | Ga0157370_10065225 | |||
| 509 | Ga0157370_10309084 | |||
| 510 | Ga0157370_10522968 | |||
| 511 | Ga0157370_10719777 | |||
| 512 | Ga0157369_10115190 | |||
| 513 | Ga0157369_10116670 | |||
| 514 | Ga0157369_10187602 | |||
| 515 | Ga0157369_11174612 | |||
| 516 | Ga0157374_10082564 | |||
| 517 | Ga0157374_10734266 | |||
| 518 | Ga0157378_10156708 | |||
| 519 | Ga0157372_10068333 | |||
| 520 | Ga0157372_10184851 | |||
| 521 | Ga0157372_10414756 | |||
| 522 | Ga0157372_10732757 | |||
| 523 | Ga0157377_10707689 | |||
| 524 | Ga0197907_10357015 | |||
| 525 | Ga0197907_10465661 | |||
| 526 | Ga0206356_10123609 | |||
| 527 | Ga0206356_10851575 | |||
| 528 | Ga0206350_10874619 | |||
| 529 | Ga0206354_10996108 | |||
| 530 | Ga0224712_10031408 | |||
| 531 | Ga0207692_10279838 | |||
| 532 | Ga0207684_10597386 | |||
| 533 | Ga0207707_10055508 | |||
| 534 | Ga0207707_10096922 | |||
| 535 | Ga0207695_10454628 | |||
| 536 | Ga0207695_10487964 | |||
| 537 | Ga0207695_10556772 | |||
| 538 | Ga0207671_10144748 | |||
| 539 | Ga0207671_10445703 | |||
| 540 | Ga0207693_10009530 | |||
| 541 | Ga0207660_10015801 | |||
| 542 | Ga0207660_10660004 | |||
| 543 | Ga0207657_10020531 | |||
| 544 | Ga0207657_10062358 | |||
| 545 | Ga0207649_10123788 | |||
| 546 | Ga0207649_10365153 | |||
| 547 | Ga0207652_10296382 | |||
| 548 | Ga0207652_10518507 | |||
| 549 | Ga0207646_10529763 | |||
| 550 | Ga0207694_10056739 | |||
| 551 | Ga0207694_10209876 | |||
| 552 | Ga0207687_10110025 | |||
| 553 | Ga0207687_10836881 | |||
| 554 | Ga0207700_10192962 | |||
| 555 | Ga0207700_10204492 | |||
| 556 | Ga0207664_10258192 | |||
| 557 | Ga0207664_10675771 | |||
| 558 | Ga0207644_10052298 | |||
| 559 | Ga0207644_10447005 | |||
| 560 | Ga0207690_10093342 | |||
| 561 | Ga0207690_10095150 | |||
| 562 | Ga0207686_10082604 | |||
| 563 | Ga0207665_10009108 | |||
| 564 | Ga0207661_10155745 | |||
| 565 | Ga0207667_10124545 | |||
| 566 | Ga0207651_10537278 | |||
| 567 | Ga0207677_10048454 | |||
| 568 | Ga0207639_10294349 | |||
| 569 | Ga0207639_10440649 | |||
| 570 | Ga0207678_10766679 | |||
| 571 | Ga0207702_10261073 | |||
| 572 | Ga0207702_10296287 | |||
| 573 | Ga0207676_10929691 | |||
| 574 | Ga0207674_10026168 | |||
| 575 | Ga0207674_10130786 | |||
| 576 | Ga0207698_10410198 | |||
| 577 | Ga0268266_10008317 | |||
| 578 | Ga0268266_10316189 | |||
| 579 | Ga0265338_10059602 | |||
| 580 | Ga0373944_0009257 | |||
| 581 | Ga0373936_0048203 | |||
| 582 | Ga0373945_0018290 | |||
| 583 | Ga0373953_0117652 | |||
| 584 | Ga0373956_0075192 | |||
| 585 | Ga0373957_0027675 | |||
| 586 | Ga0373943_0005559 | |||
| 587 | Ga0373943_0100013 | |||
| 588 | Ga0373946_0091389 | |||
| 589 | Ga0373955_0022070 | |||
| 590 | Ga0373935_0370438 | |||
| 591 | Ga0373927_0065269 | |||
| 592 | Ga0373947_0002069 | |||
| 593 | Ga0373937_0033161 | |||
| 594 | Ga0373937_0075440 | |||
| 595 | Ga0373925_0153517 | |||
| 596 | Ga0373925_0465268 | |||
| 597 | Ga0373925_1207102 | |||
| 598 | Ga0395899_0102113 | |||
| 599 | Ga0395899_0116331 | |||
| 600 | Ga0395899_0240541 | |||
| 601 | Ga0395900_0082218 | |||
| 602 | Ga0395900_0107936 | |||
| 603 | Ga0395900_0186729 | |||
| 604 | Ga0395900_0303433 | |||
| 605 | Ga0395900_0308995 | |||
| 606 | Ga0395900_0417963 | |||
| 607 | Ga0395900_0598993 | |||
| 608 | Ga0395900_0601666 | |||
| 609 | Ga0395900_0726759 | |||
| 610 | Ga0395898_0012795 | |||
| 611 | Ga0395898_0031602 | |||
| 612 | Ga0395898_0059770 | |||
| 613 | Ga0395898_0076940 | |||
| 614 | Ga0395898_0120676 | |||
| 615 | Ga0395898_0167202 | |||
| 616 | Ga0395898_0198635 | |||
| 617 | Ga0395898_0409783 | |||
| 618 | Ga0395905_0015955 | |||
| 619 | Ga0395905_0060359 | |||
| 620 | Ga0395905_0209024 | |||
| 621 | Ga0395905_0445002 | |||
| 622 | Ga0395901_0027265 | |||
| 623 | Ga0395901_0039211 | |||
| 624 | Ga0395901_0045496 | |||
| 625 | Ga0395901_0062714 | |||
| 626 | Ga0395901_0101491 | |||
| 627 | Ga0395901_0265117 | |||
| 628 | Ga0395901_0307900 | |||
| 629 | Ga0395901_0509033 | |||
| 630 | Ga0395901_0712875 | |||
| 631 | Ga0395901_1261666 | |||
| 632 | Ga0436365_0450878 | |||
| 633 | Ga0436365_0676969 | |||
| 634 | Ga0436365_1321600 | |||
| 635 | Ga0436363_1024046 | |||
| 636 | Ga0466972_0155336 | |||
| 637 | Ga0466966_0148361 | |||
| 638 | Ga0466961_0397558 | |||
| 639 | Ga0466963_0006082 | |||
| 640 | Ga0466963_0012163 | |||
| 641 | Ga0466963_0014535 | |||
| 642 | Ga0466963_0026427 | |||
| 643 | Ga0466963_0067853 | |||
| 644 | Ga0466963_0146823 | |||
| 645 | Ga0466963_0151309 | |||
| 646 | Ga0466963_0160676 | |||
| 647 | Ga0466963_0294111 | |||
| 648 | Ga0466963_0351789 | |||
| 649 | Ga0466964_0043934 | |||
| 650 | Ga0466964_0096365 | |||
| 651 | Ga0466964_0110412 | |||
| 652 | Ga0466971_0002355 | |||
| 653 | Ga0466968_0028597 | |||
| 654 | Ga0466970_0027224 | |||
| 655 | Ga0466970_0091183 | |||
| 656 | Ga0466957_0002656 | |||
| 657 | Ga0466957_0250904 | |||
| 658 | Ga0466960_0414385 | |||
| 659 | Ga0466960_0469398 | |||
| 660 | Ga0466960_0483869 | |||
| 661 | Ga0466959_0039109 | |||
| 662 | Ga0466959_0179094 | |||
| 663 | Ga0466958_0001843 | |||
| 664 | Ga0466958_0111060 | |||
| 665 | Ga0466958_0193502 | |||
| 666 | Ga0466967_0001875 | |||
| 667 | Ga0466967_0003388 | |||
| 668 | Ga0466967_0004473 | |||
| 669 | Ga0466967_0004983 | |||
| 670 | Ga0466967_0031803 | |||
| 671 | Ga0466967_0040902 | |||
| 672 | Ga0466967_0050536 | |||
| 673 | Ga0466967_0092142 | |||
| 674 | Ga0466967_0095845 | |||
| 675 | Ga0466967_0125760 | |||
| 676 | Ga0466967_0163081 | |||
| 677 | Ga0466967_0240315 | |||
| 678 | Ga0466967_0580147 | |||
| 679 | Ga0466967_0733417 | |||
| 680 | Ga0495592_0027615 | |||
| 681 | Ga0495592_0426834 | |||
| 682 | Ga0495629_0000159 | |||
| 683 | Ga0495629_0266634 | |||
| 684 | Ga0495641_0007547 | |||
| 685 | Ga0495641_0160515 | |||
| 686 | Ga0495641_0223268 | |||
| 687 | Ga0495651_0129408 | |||
| 688 | Ga0495651_0476426 | |||
| 689 | Ga0495653_0024544 | |||
| 690 | Ga0495653_0028612 | |||
| 691 | Ga0495582_0000183 | |||
| 692 | Ga0495639_0085179 | |||
| 693 | Ga0495662_0071511 | |||
| 694 | Ga0495662_0192156 | |||
| 695 | Ga0495584_0259287 | |||
| 696 | Ga0495594_0156651 | |||
| 697 | Ga0495594_0347630 | |||
| 698 | Ga0495608_0018507 | |||
| 699 | Ga0495608_0027394 | |||
| 700 | Ga0495608_0299546 | |||
| 701 | Ga0495628_0056567 | |||
| 702 | Ga0495628_0206338 | |||
| 703 | Ga0495630_0012894 | |||
| 704 | Ga0495630_0030747 | |||
| 705 | Ga0495630_0146605 | |||
| 706 | Ga0495630_0966483 | |||
| 707 | Ga0495666_0102363 | |||
| 708 | Ga0495652_0161892 | |||
| 709 | Ga0495652_0164790 | |||
| 710 | Ga0495665_0006222 | |||
| 711 | Ga0495665_0095905 | |||
| 712 | Ga0495640_0011908 | |||
| 713 | Ga0495640_0045724 | |||
| 714 | Ga0495640_0062149 | |||
| 715 | Ga0495640_0350273 | |||
| 716 | Ga0495587_0016070 | |||
| 717 | Ga0495587_0069272 | |||
| 718 | Ga0495645_0155566 | |||
| 719 | Ga0495645_0363756 | |||
| 720 | Ga0495667_0032620 | |||
| 721 | Ga0495667_0064237 | |||
| 722 | Ga0495634_0024626 | |||
| 723 | Ga0495635_0021005 | |||
| 724 | Ga0495635_0473351 | |||
| 725 | Ga0495588_0143432 | |||
| 726 | Ga0495657_0044779 | |||
| 727 | Ga0495657_0106994 | |||
| 728 | Ga0495599_0097062 | |||
| 729 | Ga0495599_0179774 | |||
| 730 | Ga0495623_0023817 | |||
| 731 | Ga0495623_0140115 | |||
| 732 | Ga0495646_0183240 | |||
| 733 | Ga0495646_0197225 | |||
| 734 | Ga0495646_0222103 | |||
| 735 | Ga0495647_0068118 | |||
| 736 | Ga0495658_0009011 | |||
| 737 | Ga0495658_0218546 | |||
| 738 | Ga0495613_0008448 | |||
| 739 | Ga0495613_0106493 | |||
| 740 | Ga0495624_0126063 | |||
| 741 | Ga0495600_0151911 | |||
| 742 | Ga0495581_0256358 | |||
| 743 | Ga0495604_0073923 | |||
| 744 | Ga0495604_0090455 | |||
| 745 | Ga0495674_0012998 | |||
| 746 | Ga0495674_0086110 | |||
| 747 | Ga0495674_0097278 | |||
| 748 | Ga0495674_0397146 | |||
| 749 | Ga0495674_1067902 | |||
| 750 | Ga0495676_0002313 | |||
| 751 | Ga0495680_0008139 | |||
| 752 | Ga0495680_0012325 | |||
| 753 | Ga0495680_0026009 | |||
| 754 | Ga0495675_0034702 | |||
| 755 | Ga0495675_0242718 | |||
| 756 | Ga0495684_0026160 | |||
| 757 | Ga0495684_0036575 | |||
| 758 | Ga0495684_0079683 | |||
| 759 | Ga0495684_0357942 | |||
| 760 | Ga0495593_0013125 | |||
| 761 | Ga0495602_0168245 | |||
| 762 | Ga0495602_0298558 | |||
| 763 | Ga0495614_0003012 | |||
| 764 | Ga0496100_0034551 | |||
| 765 | Ga0496100_0044445 | |||
| 766 | Ga0496100_0050883 | |||
| 767 | Ga0496101_0004053 | |||
| 768 | Ga0496101_0008031 | |||
| 769 | Ga0496101_0020896 | |||
| 770 | Ga0496101_0054124 | |||
| 771 | Ga0496101_0069353 | |||
| 772 | Ga0496102_0006873 | |||
| 773 | Ga0496102_0031241 | |||
| 774 | Ga0496102_0170538 | |||
| 775 | Ga0496102_0595718 | |||
| 776 | Ga0496102_0656262 | |||
| 777 | Ga0496102_0662152 | |||
| 778 | Ga0496103_0002833 | |||
| 779 | Ga0496104_0046529 | |||
| 780 | Ga0496104_0064200 | |||
| 781 | Ga0496104_0242185 | |||
| 782 | Ga0496104_0374066 | |||
| 783 | Ga0496104_0514688 | |||
| 784 | Ga0496105_0017323 | |||
| 785 | Ga0496105_0034432 | |||
| 786 | Ga0496105_0517877 | |||
| 787 | Ga0496105_0536462 | |||
| 788 | Ga0496105_0815932 | |||
| 789 | Ga0496106_0004804 | |||
| 790 | Ga0496106_0122381 | |||
| 791 | Ga0496106_0193744 | |||
| 792 | Ga0496106_0667152 | |||
| 793 | Ga0496107_0021137 | |||
| 794 | Ga0496107_0021487 | |||
| 795 | Ga0496107_0039676 | |||
| 796 | Ga0496107_0095376 | |||
| 797 | Ga0496108_0023797 | |||
| 798 | Ga0496108_0104646 | |||
| 799 | Ga0496108_0452995 | |||
| 800 | Ga0496109_0007451 | |||
| 801 | Ga0496109_0037167 | |||
| 802 | Ga0496109_0656813 | |||
| 803 | Ga0496110_0004546 | |||
| 804 | Ga0496110_0143052 | |||
| 805 | Ga0496111_0032783 | |||
| 806 | Ga0496111_0077551 | |||
| 807 | Ga0496111_0342372 | |||
| 808 | Ga0496112_0011784 | |||
| 809 | Ga0496112_0016528 | |||
| 810 | Ga0496112_0060260 | |||
| 811 | Ga0496112_0171341 | |||
| 812 | Ga0496112_0302598 | |||
| 813 | Ga0496112_0424280 | |||
| 814 | Ga0496113_0006784 | |||
| 815 | Ga0496113_0038609 | |||
| 816 | Ga0496113_0236062 | |||
| 817 | Ga0496113_0400036 | |||
| 818 | Ga0496114_0002801 | |||
| 819 | Ga0496114_0003912 | |||
| 820 | Ga0496114_0090232 | |||
| 821 | Ga0496114_0111402 | |||
| 822 | Ga0496114_0160551 | |||
| 823 | Ga0496114_0338977 | |||
| 824 | Ga0496115_0002511 | |||
| 825 | Ga0496115_0012806 | |||
| 826 | Ga0496115_0035312 | |||
| 827 | Ga0496115_0049060 | |||
| 828 | Ga0496115_0049721 | |||
| 829 | Ga0496115_0211170 | |||
| 830 | Ga0496115_0564595 | |||
| 831 | Ga0496115_0743590 | |||
| 832 | Ga0501031_0349109 | |||
| 833 | Ga0501040_0361300 | |||
| 834 | Ga0501047_0303565 | |||
| 835 | Ga0501047_0636518 | |||
| 836 | Ga0501067_0022806 | |||
| 837 | Ga0501067_0146592 | |||
| 838 | Ga0501067_0261482 | |||
| 839 | Ga0501068_0098927 | |||
| 840 | Ga0501069_0012557 | |||
| 841 | Ga0501069_0069759 | |||
| 842 | Ga0501069_0395818 | |||
| 843 | Ga0501070_0000159 | |||
| 844 | Ga0501070_0193639 | |||
| 845 | Ga0501070_0838376 | |||
| 846 | Ga0501073_0081318 | |||
| 847 | Ga0501074_0205484 | |||
| 848 | Ga0501075_0710776 | |||
| 849 | Ga0501080_0146756 | |||
| 850 | Ga0501080_0601298 | |||
| 851 | nmdc:mga0rr50_80600_c1 | |||
| 852 | Ga0495601_0035279 | |||
| 853 | Ga0495601_0137116 | |||
| 854 | Ga0495601_0173076 | |||
| 855 | Ga0495601_0216295 | |||
| 856 | Ga0495595_0017460 | |||
| 857 | Ga0495595_0182152 | |||
| 858 | Ga0495619_0026234 | |||
| 859 | Ga0495619_0052622 | |||
| 860 | Ga0495619_0385408 | |||
| 861 | Ga0495619_0386265 | |||
| 862 | Ga0466962_0002146 | |||
| 863 | Ga0530510_0114350 | |||
| 864 | Ga0530510_0124803 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5nmr-assembly1.cif.gz_A | monomeric mouse sortilin extracellular domain | 0.794 | 139 | 179 |
| 3zi8-assembly1.cif.gz_A | structure of the r17a mutant of the ralstonia soleanacerum lectin at 1.5 angstrom in complex with l-fucose | 0.7656 | 139 | 184 |
| 7e7u-assembly2.cif.gz_B | crystal structure of rsl mutant in complex with sugar ligand | 0.751 | 139 | 184 |
| 8cf7-assembly1.cif.gz_A | dimethylated rsl-r5 in complex with cucurbit[7]uril, c121 sheet assembly | 0.7496 | 139 | 184 |
| 8c9y-assembly1.cif.gz_A | the mk-rsl - sulfonato-calix[8]arene complex, h32 form | 0.7454 | 139 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q6P773_245_397_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.8045 | 139 | 186 | 2.130.10.10 |
| af_I1JEP8_69_247_2.120.10.80 | Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller | 0.8028 | 142 | 181 | 2.120.10.80 |
| af_Q54ID7_176_349_2.40.160.120 | Mainly Beta;Beta Barrel;Porin; | 0.8009 | 138 | 170 | 2.40.160.120 |
| af_E9AGJ5_1_486_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7801 | 139 | 186 | 2.130.10.10 |
| af_P34423_248_486_2.130.10.10 | Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase | 0.7779 | 149 | 184 | 2.130.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V5LFF6-F1-model_v4 | Uncharacterized protein | 0.9386 | 118 | 208 |
|
| AF-A0A7W0GZS8-F1-model_v4 | Uncharacterized protein | 0.9321 | 104 | 211 |
|
| AF-A0A2W6EFW6-F1-model_v4 | Uncharacterized protein | 0.9189 | 111 | 208 |
|
| AF-A0A4V2NWC5-F1-model_v4 | Aminoacyl-transfer RNA synthetases class-II family profile domain-containing protein | 0.9045 | 109 | 211 |
|
| AF-A0A7W1DHR1-F1-model_v4 | Chromosome segregation protein SMC | 0.8942 | 109 | 211 |
|