metagRoot

F442601

General Info

Members	Datasets	Scaffolds	Average Seq Length
432	216	430	131

Family's Representative Sequence

Representative Sequence	3300014745\|Ga0157377_10181243\|Ga0157377_101812432
Length	155
Sequence	LAALLFGLFTNHLAAINLSSVMAFELINPDSLGAPKGYSNGVLADAGGKLLFIAGQIAWNKNQKIVSDDFVEQFDQALANVIVVLNAAGGEPANVARLMIYVTNKAEYLERTREVGERYRKHMGKHYPAMALVQVAGLVDNAAKVEIEGMAVLPA

Samples

	Sample ID	Description	Type	Environment
1	2515154122	Paraburkholderia atlantica JPY251	Isolate	Nodule
2	2899275550	Paracoccus hibiscisoli CCTCC AB2016182	Isolate	Rhizosphere
3	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
4	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
5	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
6	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
7	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
8	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
9	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
10	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
11	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
12	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
13	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
14	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
15	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
16	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
17	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
18	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
19	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
20	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
21	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
22	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
23	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
24	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
25	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
26	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
27	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
28	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
29	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
30	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
31	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
32	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
33	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
34	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
35	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
36	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
37	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
38	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
39	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
40	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
41	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
42	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
43	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
44	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
45	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
46	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
47	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
48	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
49	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
50	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
51	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
52	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
53	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
54	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
55	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
56	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
57	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
58	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
59	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
60	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
61	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
62	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
63	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
64	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
65	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
66	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
67	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
68	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
69	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
70	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
71	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
72	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
73	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
74	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
75	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
76	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
77	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
78	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
79	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
80	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
81	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
82	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
83	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
84	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
85	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
86	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
87	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
88	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
89	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
90	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
91	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
92	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
93	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300027360	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
140	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
144	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
145	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
146	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
147	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
148	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
149	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
150	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
151	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
152	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
153	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
154	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
155	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
156	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
157	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
158	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
159	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
160	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
161	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
162	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
163	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
164	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
165	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
166	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
167	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
168	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
169	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
170	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
171	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
172	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
173	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
174	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
175	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
176	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
177	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
178	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
179	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
180	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
181	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
182	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
183	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
184	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
185	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
186	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
187	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
188	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
189	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
190	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
191	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
192	3300049680	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought	Metagenome	Rhizosphere
193	3300049683	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control	Metagenome	Rhizosphere
194	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
195	3300049708	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control	Metagenome	Rhizosphere
196	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
197	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
198	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
199	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
200	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
201	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
202	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
203	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
204	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
205	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
206	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
207	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
208	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
209	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
210	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
211	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
212	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
213	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
214	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
215	3300059421	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
216	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.54
Metatranscriptomes	0
Isolates	0.46

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.78
Nodule	0.23
Rhizoplane	2.08
Rhizosphere	93.29
Stem	0
Stem Tuber	0
Unclassified	1.62

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0065712_10345080	3300005290	Unclassified	795
2	Ga0070676_10255622	3300005328	Bacteria	1171
3	Ga0070676_10328499	3300005328	Bacteria	1045
4	Ga0070676_11056670	3300005328	Bacteria	612
5	Ga0070690_100956898	3300005330	Bacteria	673
6	Ga0070670_101254517	3300005331	Unclassified	678
7	Ga0070677_10786764	3300005333	Bacteria	542
8	Ga0068869_100021312	3300005334	Bacteria	4457
9	Ga0068869_101682444	3300005334	Bacteria	566
10	Ga0070680_100168865	3300005336	Bacteria	1840
11	Ga0070680_100252783	3300005336	Bacteria	1490
12	Ga0070680_100356983	3300005336	Bacteria	1243
13	Ga0068868_100065504	3300005338	Bacteria	2886
14	Ga0068868_101371314	3300005338	Bacteria	659
15	Ga0070660_100428906	3300005339	Bacteria	1095
16	Ga0070689_100009856	3300005340	Bacteria	6792
17	Ga0070689_100439704	3300005340	Unclassified	1108
18	Ga0070687_100001046	3300005343	Bacteria	9455
19	Ga0070687_100409362	3300005343	Bacteria	891
20	Ga0070692_10284801	3300005345	Bacteria	1003
21	Ga0070692_10524974	3300005345	Unclassified	771
22	Ga0070668_100193937	3300005347	Bacteria	1665
23	Ga0070668_100384157	3300005347	Bacteria	1195
24	Ga0070668_100985846	3300005347	Bacteria	757
25	Ga0070669_100014381	3300005353	Bacteria	5632
26	Ga0070669_100860125	3300005353	Bacteria	773
27	Ga0070669_100903722	3300005353	Bacteria	754
28	Ga0070675_100004234	3300005354	Bacteria	10914
29	Ga0070671_100005807	3300005355	Bacteria	9832
30	Ga0070671_100369366	3300005355	Bacteria	1225
31	Ga0070671_100599084	3300005355	Bacteria	952
32	Ga0070674_100013724	3300005356	Bacteria	5015
33	Ga0070674_100106755	3300005356	Bacteria	2049
34	Ga0070674_100149835	3300005356	Bacteria	1759
35	Ga0070674_100706829	3300005356	Bacteria	862
36	Ga0070674_101168622	3300005356	Unclassified	682
37	Ga0070673_100045410	3300005364	Bacteria	3407
38	Ga0070688_100038597	3300005365	Bacteria	2918
39	Ga0070688_100313980	3300005365	Bacteria	1137
40	Ga0070688_100987637	3300005365	Bacteria	668
41	Ga0070667_101167674	3300005367	Bacteria	720
42	Ga0070703_10151748	3300005406	Bacteria	871
43	Ga0070701_10002846	3300005438	Bacteria	6742
44	Ga0070701_10605771	3300005438	Unclassified	726
45	Ga0070700_100021017	3300005441	Bacteria	3790
46	Ga0070700_100100418	3300005441	Bacteria	1905
47	Ga0070700_100509333	3300005441	Unclassified	927
48	Ga0070700_100596361	3300005441	Bacteria	865
49	Ga0070700_101299542	3300005441	Bacteria	611
50	Ga0070694_100375625	3300005444	Bacteria	1107
51	Ga0070694_100448662	3300005444	Bacteria	1018
52	Ga0070694_101124459	3300005444	Unclassified	656
53	Ga0070708_100117721	3300005445	Bacteria	2447
54	Ga0070708_101179744	3300005445	Bacteria	716
55	Ga0070663_100174017	3300005455	Bacteria	1666
56	Ga0070662_100453614	3300005457	Bacteria	1064
57	Ga0068867_100047375	3300005459	Bacteria	3160
58	Ga0068867_100050343	3300005459	Bacteria	3070
59	Ga0068867_101417297	3300005459	Bacteria	645
60	Ga0068867_101845636	3300005459	Bacteria	569
61	Ga0070685_10028402	3300005466	Bacteria	3099
62	Ga0070706_100066563	3300005467	Bacteria	3332
63	Ga0070707_100294985	3300005468	Bacteria	1575
64	Ga0070699_100533352	3300005518	Bacteria	1068
65	Ga0070679_100177929	3300005530	Bacteria	2100
66	Ga0070684_101244459	3300005535	Bacteria	700
67	Ga0070697_101479639	3300005536	Bacteria	607
68	Ga0070672_100117753	3300005543	Bacteria	2172
69	Ga0070686_100191786	3300005544	Bacteria	1459
70	Ga0070695_100003463	3300005545	Bacteria	9219
71	Ga0070695_100725273	3300005545	Bacteria	791
72	Ga0070696_100975125	3300005546	Bacteria	707
73	Ga0070665_100018511	3300005548	Bacteria	6980
74	Ga0070665_100685206	3300005548	Bacteria	1038
75	Ga0070665_100980886	3300005548	Bacteria	857
76	Ga0070704_100053318	3300005549	Bacteria	2858
77	Ga0070704_100393565	3300005549	Bacteria	1181
78	Ga0070704_100564724	3300005549	Bacteria	996
79	Ga0070704_100723946	3300005549	Archaea	884
80	Ga0070664_101030309	3300005564	Bacteria	774
81	Ga0070702_100029580	3300005615	Bacteria	2981
82	Ga0070702_100859093	3300005615	Bacteria	707
83	Ga0068859_100038242	3300005617	Bacteria	4814
84	Ga0068859_100491921	3300005617	Bacteria	1322
85	Ga0068859_101777330	3300005617	Bacteria	681
86	Ga0068864_100002264	3300005618	Bacteria	15917
87	Ga0068866_10067733	3300005718	Bacteria	1875
88	Ga0068866_10442945	3300005718	Bacteria	848
89	Ga0068861_100005068	3300005719	Bacteria	8886
90	Ga0068861_100175604	3300005719	Bacteria	1779
91	Ga0068861_100182857	3300005719	Bacteria	1746
92	Ga0068861_100293607	3300005719	Bacteria	1405
93	Ga0068861_101102872	3300005719	Unclassified	763
94	Ga0068861_102538866	3300005719	Unclassified	516
95	Ga0068861_102715065	3300005719	Unclassified	500
96	Ga0068870_10076116	3300005840	Bacteria	1842
97	Ga0068870_10146399	3300005840	Bacteria	1387
98	Ga0068863_100318714	3300005841	Bacteria	1510
99	Ga0068863_100378309	3300005841	Bacteria	1382
100	Ga0068863_100684155	3300005841	Bacteria	1019
101	Ga0068863_101130512	3300005841	Unclassified	788
102	Ga0068863_101170681	3300005841	Bacteria	774
103	Ga0068863_102359463	3300005841	Bacteria	542
104	Ga0068858_100284627	3300005842	Bacteria	1574
105	Ga0068860_100590354	3300005843	Bacteria	1115
106	Ga0068860_100707742	3300005843	Bacteria	1017
107	Ga0068862_100067358	3300005844	Bacteria	3086
108	Ga0068862_100074764	3300005844	Bacteria	2929
109	Ga0068862_100171714	3300005844	Bacteria	1941
110	Ga0068862_100803581	3300005844	Bacteria	918
111	Ga0081539_10053048	3300005985	Bacteria	2273
112	Ga0070717_10710572	3300006028	Bacteria	913
113	Ga0075364_10118841	3300006051	Bacteria	1768
114	Ga0075367_10000213	3300006178	Bacteria	19327
115	Ga0075366_10000365	3300006195	Bacteria	20877
116	Ga0097621_100424190	3300006237	Bacteria	1194
117	Ga0075370_10048105	3300006353	Bacteria	2416
118	Ga0068871_100676887	3300006358	Bacteria	944
119	Ga0075428_100010886	3300006844	Bacteria	10113
120	Ga0075428_100110320	3300006844	Bacteria	2997
121	Ga0075428_100167503	3300006844	Bacteria	2383
122	Ga0075428_100434918	3300006844	Bacteria	1406
123	Ga0075428_100463886	3300006844	Bacteria	1356
124	Ga0075428_100848406	3300006844	Bacteria	970
125	Ga0075428_101178058	3300006844	Unclassified	808
126	Ga0075428_102286811	3300006844	Unclassified	556
127	Ga0075430_100050866	3300006846	Bacteria	3493
128	Ga0075430_100169662	3300006846	Bacteria	1815
129	Ga0075430_100252005	3300006846	Bacteria	1463
130	Ga0075431_100000489	3300006847	Bacteria	32879
131	Ga0075431_100009003	3300006847	Bacteria	10007
132	Ga0075431_100216071	3300006847	Bacteria	1957
133	Ga0075431_100261218	3300006847	Bacteria	1757
134	Ga0075431_100359428	3300006847	Bacteria	1463
135	Ga0075433_10019917	3300006852	Bacteria	5601
136	Ga0075433_10250767	3300006852	Bacteria	1570
137	Ga0075433_10591078	3300006852	Bacteria	975
138	Ga0075433_10612666	3300006852	Bacteria	955
139	Ga0075434_100031968	3300006871	Bacteria	5189
140	Ga0075434_100115524	3300006871	Bacteria	2697
141	Ga0075434_100285906	3300006871	Bacteria	1669
142	Ga0075429_100084172	3300006880	Bacteria	2772
143	Ga0075429_100105556	3300006880	Bacteria	2461
144	Ga0075429_100199748	3300006880	Bacteria	1752
145	Ga0075429_100963238	3300006880	Bacteria	746
146	Ga0075429_101017206	3300006880	Bacteria	724
147	Ga0075429_101641297	3300006880	Unclassified	559
148	Ga0068865_100045473	3300006881	Bacteria	3010
149	Ga0068865_100594810	3300006881	Bacteria	934
150	Ga0068865_101313446	3300006881	Bacteria	643
151	Ga0075436_100016975	3300006914	Bacteria	4982
152	Ga0075436_100442541	3300006914	Bacteria	946
153	Ga0097620_100038245	3300006931	Bacteria	4814
154	Ga0097620_100491854	3300006931	Bacteria	1322
155	Ga0097620_101777613	3300006931	Bacteria	681
156	Ga0111539_10000467	3300009094	Bacteria	50881
157	Ga0111539_10002553	3300009094	Bacteria	24107
158	Ga0111539_10173396	3300009094	Bacteria	2520
159	Ga0111539_10652557	3300009094	Bacteria	1225
160	Ga0105245_10047709	3300009098	Bacteria	3829
161	Ga0105245_10619544	3300009098	Bacteria	1110
162	Ga0105245_11258278	3300009098	Bacteria	788
163	Ga0105247_10091124	3300009101	Bacteria	1935
164	Ga0105247_10882246	3300009101	Unclassified	689
165	Ga0114129_10009889	3300009147	Bacteria	13599
166	Ga0114129_10149214	3300009147	Bacteria	3200
167	Ga0114129_10183105	3300009147	Bacteria	2849
168	Ga0114129_10189587	3300009147	Bacteria	2793
169	Ga0114129_10282805	3300009147	Archaea	2216
170	Ga0114129_11305723	3300009147	Bacteria	899
171	Ga0114129_11426087	3300009147	Bacteria	854
172	Ga0114129_11639693	3300009147	Bacteria	786
173	Ga0105243_10008818	3300009148	Bacteria	7723
174	Ga0105243_10054425	3300009148	Bacteria	3177
175	Ga0105243_10088329	3300009148	Bacteria	2547
176	Ga0105243_10418462	3300009148	Bacteria	1249
177	Ga0105243_11343581	3300009148	Bacteria	733
178	Ga0105241_10498957	3300009174	Bacteria	1085
179	Ga0105241_10510517	3300009174	Unclassified	1073
180	Ga0105242_10033760	3300009176	Bacteria	4099
181	Ga0105242_10482616	3300009176	Bacteria	1175
182	Ga0105248_11013611	3300009177	Bacteria	938
183	Ga0105248_11585482	3300009177	Bacteria	742
184	Ga0105238_11175083	3300009551	Unclassified	791
185	Ga0105249_10034342	3300009553	Bacteria	4596
186	Ga0105249_10095146	3300009553	Bacteria	2792
187	Ga0105249_10443396	3300009553	Bacteria	1336
188	Ga0105249_10620859	3300009553	Bacteria	1137
189	Ga0105249_12478927	3300009553	Bacteria	591
190	Ga0105246_10402683	3300011119	Bacteria	1137
191	Ga0105246_10451784	3300011119	Bacteria	1080
192	Ga0157378_10793180	3300013297	Bacteria	972
193	Ga0163162_10575242	3300013306	Bacteria	1254
194	Ga0157372_10540100	3300013307	Bacteria	1359
195	Ga0157375_10007909	3300013308	Bacteria	9308
196	Ga0157375_10426226	3300013308	Bacteria	1493
197	Ga0157375_10487049	3300013308	Bacteria	1398
198	Ga0163163_10049709	3300014325	Bacteria	4127
199	Ga0163163_10117605	3300014325	Bacteria	2690
200	Ga0163163_11218280	3300014325	Bacteria	815
201	Ga0163163_11627837	3300014325	Bacteria	706
202	Ga0163163_11762382	3300014325	Bacteria	680
203	Ga0157380_10170659	3300014326	Bacteria	1900
204	Ga0157380_10321645	3300014326	Bacteria	1434
205	Ga0157380_10436959	3300014326	Bacteria	1253
206	Ga0157380_10442934	3300014326	Bacteria	1245
207	Ga0157380_10471668	3300014326	Bacteria	1211
208	Ga0157380_10675057	3300014326	Bacteria	1034
209	Ga0157380_11321098	3300014326	Unclassified	769
210	Ga0157380_11592296	3300014326	Bacteria	708
211	Ga0157377_10181243	3300014745	Bacteria	1325
212	Ga0157379_10424782	3300014968	Bacteria	1224
213	Ga0157379_10873537	3300014968	Bacteria	852
214	Ga0163161_10086656	3300017792	Bacteria	2312
215	Ga0213876_10000033	3300021384	Bacteria	205318
216	Ga0213876_10000143	3300021384	Bacteria	76974
217	Ga0213876_10059126	3300021384	Bacteria	2023
218	Ga0207653_10051031	3300025885	Bacteria	1377
219	Ga0207682_10032438	3300025893	Bacteria	2099
220	Ga0207642_10123091	3300025899	Bacteria	1341
221	Ga0207642_10199276	3300025899	Bacteria	1105
222	Ga0207642_10630569	3300025899	Bacteria	670
223	Ga0207680_10178821	3300025903	Bacteria	1433
224	Ga0207645_10258307	3300025907	Bacteria	1154
225	Ga0207643_10048181	3300025908	Bacteria	2413
226	Ga0207684_10193275	3300025910	Bacteria	1755
227	Ga0207654_10661238	3300025911	Unclassified	749
228	Ga0207654_10899861	3300025911	Unclassified	642
229	Ga0207660_10503146	3300025917	Bacteria	983
230	Ga0207662_10000831	3300025918	Bacteria	14208
231	Ga0207662_10270127	3300025918	Bacteria	1122
232	Ga0207652_10143466	3300025921	Bacteria	2136
233	Ga0207646_10022842	3300025922	Bacteria	5752
234	Ga0207681_10034990	3300025923	Bacteria	3307
235	Ga0207681_10321475	3300025923	Bacteria	1231
236	Ga0207681_10573533	3300025923	Bacteria	930
237	Ga0207681_10754978	3300025923	Unclassified	811
238	Ga0207694_11782275	3300025924	Bacteria	517
239	Ga0207650_10425703	3300025925	Bacteria	1102
240	Ga0207650_10685813	3300025925	Unclassified	865
241	Ga0207659_10280462	3300025926	Bacteria	1362
242	Ga0207687_10061841	3300025927	Bacteria	2646
243	Ga0207644_10001660	3300025931	Bacteria	14327
244	Ga0207644_11268642	3300025931	Bacteria	619
245	Ga0207690_10624574	3300025932	Bacteria	881
246	Ga0207706_10061394	3300025933	Bacteria	3310
247	Ga0207706_10137557	3300025933	Bacteria	2149
248	Ga0207686_10100537	3300025934	Bacteria	1930
249	Ga0207686_10445071	3300025934	Bacteria	996
250	Ga0207709_10024886	3300025935	Bacteria	3424
251	Ga0207709_10039519	3300025935	Bacteria	2818
252	Ga0207670_10012153	3300025936	Bacteria	5026
253	Ga0207670_10038509	3300025936	Bacteria	3123
254	Ga0207669_10018032	3300025937	Bacteria	3637
255	Ga0207669_10021108	3300025937	Bacteria	3430
256	Ga0207669_10384918	3300025937	Bacteria	1094
257	Ga0207669_11716884	3300025937	Bacteria	536
258	Ga0207704_10172755	3300025938	Bacteria	1552
259	Ga0207704_10417631	3300025938	Bacteria	1063
260	Ga0207691_10010819	3300025940	Bacteria	8757
261	Ga0207691_10091705	3300025940	Bacteria	2722
262	Ga0207711_10164280	3300025941	Bacteria	2011
263	Ga0207711_10406204	3300025941	Bacteria	1266
264	Ga0207689_10021590	3300025942	Bacteria	5412
265	Ga0207689_10397317	3300025942	Bacteria	1149
266	Ga0207689_10774410	3300025942	Unclassified	810
267	Ga0207679_10698920	3300025945	Bacteria	920
268	Ga0207651_10146970	3300025960	Bacteria	1830
269	Ga0207651_10575327	3300025960	Bacteria	982
270	Ga0207712_10016257	3300025961	Bacteria	4814
271	Ga0207712_10138290	3300025961	Bacteria	1866
272	Ga0207712_10149263	3300025961	Bacteria	1804
273	Ga0207668_10041879	3300025972	Bacteria	3098
274	Ga0207668_10112944	3300025972	Bacteria	2042
275	Ga0207668_10221676	3300025972	Bacteria	1519
276	Ga0207640_10155306	3300025981	Bacteria	1686
277	Ga0207658_10028907	3300025986	Bacteria	3908
278	Ga0207658_10978005	3300025986	Bacteria	772
279	Ga0207658_11081665	3300025986	Bacteria	732
280	Ga0207677_10026323	3300026023	Bacteria	3646
281	Ga0207703_10157142	3300026035	Bacteria	1988
282	Ga0207639_12073626	3300026041	Unclassified	530
283	Ga0207678_10008974	3300026067	Bacteria	8799
284	Ga0207678_10306458	3300026067	Bacteria	1365
285	Ga0207708_10013629	3300026075	Bacteria	6075
286	Ga0207708_10094485	3300026075	Bacteria	2308
287	Ga0207708_10272144	3300026075	Bacteria	1370
288	Ga0207708_10283032	3300026075	Bacteria	1344
289	Ga0207708_10412248	3300026075	Bacteria	1119
290	Ga0207708_11326132	3300026075	Unclassified	631
291	Ga0207708_11800629	3300026075	Unclassified	537
292	Ga0207641_10279957	3300026088	Bacteria	1568
293	Ga0207641_12506663	3300026088	Bacteria	514
294	Ga0207648_10008981	3300026089	Bacteria	9613
295	Ga0207648_10026555	3300026089	Bacteria	5144
296	Ga0207648_10053392	3300026089	Unclassified	3532
297	Ga0207648_10538010	3300026089	Unclassified	1072
298	Ga0207676_10051070	3300026095	Unclassified	3226
299	Ga0207676_10079141	3300026095	Bacteria	2665
300	Ga0207675_100048547	3300026118	Bacteria	3962
301	Ga0207675_100100693	3300026118	Bacteria	2722
302	Ga0207675_100649363	3300026118	Bacteria	1061
303	Ga0207675_100852195	3300026118	Bacteria	926
304	Ga0207683_10009938	3300026121	Bacteria	8116
305	Ga0207683_10058504	3300026121	Bacteria	3384
306	Ga0207698_10229308	3300026142	Bacteria	1685
307	Ga0209969_1029052	3300027360	Bacteria	841
308	Ga0207428_10000041	3300027907	Bacteria	203097
309	Ga0207428_10048724	3300027907	Bacteria	3397
310	Ga0268266_11232284	3300028379	Bacteria	723
311	Ga0268265_10165651	3300028380	Bacteria	1883
312	Ga0268265_10461700	3300028380	Bacteria	1188
313	Ga0268265_10639149	3300028380	Bacteria	1021
314	Ga0268264_10330147	3300028381	Bacteria	1445
315	Ga0268264_10441029	3300028381	Bacteria	1260
316	Ga0268264_10605419	3300028381	Bacteria	1080
317	Ga0268264_10705762	3300028381	Bacteria	1002
318	Ga0268264_12380298	3300028381	Unclassified	536
319	Ga0307408_100154596	3300031548	Bacteria	1815
320	Ga0265313_10337193	3300031595	Bacteria	600
321	Ga0316579_10604015	3300031691	Bacteria	531
322	Ga0265314_10358035	3300031711	Bacteria	801
323	Ga0316578_10283136	3300031728	Bacteria	993
324	Ga0307416_100728494	3300032002	Unclassified	1083
325	Ga0307416_102753268	3300032002	Bacteria	588
326	Ga0307416_103126206	3300032002	Unclassified	554
327	Ga0307414_11628765	3300032004	Unclassified	602
328	Ga0307411_11118157	3300032005	Unclassified	711
329	Ga0307415_100976465	3300032126	Bacteria	786
330	Ga0373948_0016051	3300034817	Bacteria	1381
331	Ga0373958_0007979	3300034819	Bacteria	1703
332	Ga0373938_0056041	3300034957	Bacteria	911
333	Ga0373940_0092644	3300035088	Bacteria	907
334	Ga0373951_0109737	3300035091	Bacteria	741
335	Ga0373932_0017948	3300035112	Bacteria	1824
336	Ga0373932_0423091	3300035112	Unclassified	519
337	Ga0373942_0005319	3300035207	Bacteria	2985
338	Ga0373962_0044242	3300035242	Bacteria	1264
339	Ga0373962_0238671	3300035242	Bacteria	628
340	Ga0373931_0003133	3300035691	Bacteria	7383
341	Ga0373937_1639896	3300036401	Bacteria	590
342	Ga0316582_0110460	3300036647	Bacteria	1829
343	Ga0316582_0756586	3300036647	Bacteria	666
344	Ga0316584_0429433	3300036712	Bacteria	937
345	Ga0400483_116063	3300039062	Bacteria	6051
346	Ga0400483_223246	3300039062	Bacteria	10367
347	Ga0436365_0198252	3300039437	Bacteria	179679
348	Ga0436365_0280278	3300039437	Bacteria	102177
349	Ga0439462_0166640	3300042015	Bacteria	622
350	Ga0451576_2169581	3300045051	Unclassified	571
351	Ga0466967_2145464	3300045976	Bacteria	555
352	Ga0495603_0871613	3300046455	Bacteria	512
353	Ga0495656_0127565	3300046615	Bacteria	1208
354	Ga0495646_0100572	3300046680	Bacteria	1659
355	Ga0495669_0105106	3300046684	Bacteria	1314
356	Ga0495669_0166757	3300046684	Bacteria	1047
357	Ga0495674_0014525	3300047319	Bacteria	7368
358	Ga0496102_0669113	3300048905	Bacteria	961
359	Ga0496104_0003917	3300048907	Bacteria	12888
360	Ga0496105_0194796	3300048908	Bacteria	1656
361	Ga0496108_0090894	3300048911	Unclassified	2595
362	Ga0496109_0268592	3300048912	Bacteria	1607
363	Ga0496112_0701477	3300048915	Bacteria	940
364	Ga0496114_0805169	3300048917	Bacteria	818
365	Ga0496114_1090797	3300048917	Unclassified	683
366	Ga0496115_0009398	3300048918	Bacteria	7265
367	Ga0501292_015043	3300049515	Unclassified	1206
368	Ga0501034_0049699	3300049571	Bacteria	4231
369	Ga0501040_1041622	3300049576	Bacteria	593
370	Ga0501046_0784494	3300049580	Unclassified	668
371	Ga0501048_1187452	3300049582	Unclassified	549
372	Ga0501068_1049277	3300049584	Bacteria	538
373	Ga0501069_0538733	3300049585	Bacteria	698
374	Ga0501071_0679212	3300049587	Bacteria	793
375	Ga0501076_0578837	3300049592	Bacteria	926
376	Ga0501224_037512	3300049664	Bacteria	730
377	Ga0501250_069382	3300049680	Unclassified	579
378	Ga0501253_114707	3300049683	Unclassified	646
379	Ga0501225_0012852	3300049705	Unclassified	2347
380	Ga0501245_010946	3300049708	Unclassified	1315
381	Ga0501279_040326	3300049775	Bacteria	715
382	Ga0501279_102073	3300049775	Unclassified	518
383	Ga0501035_0569036	3300049822	Bacteria	926
384	nmdc:mga03683_119324_c1	3300050489	Bacteria	1172
385	nmdc:mga03n38_123907_c1	3300050490	Bacteria	1273
386	nmdc:mga00v17_317333_c1	3300050491	Bacteria	1013
387	nmdc:mga0yw44_1004251_c1	3300050492	Unclassified	565
388	nmdc:mga0k408_137_c1	3300050493	Bacteria	36779
389	nmdc:mga06z11_1269_c1	3300050494	Bacteria	9351
390	nmdc:mga06z11_767430_c1	3300050494	Bacteria	587
391	nmdc:mga04h51_15917_c1	3300050495	Bacteria	2175
392	nmdc:mga05p37_1194820_c1	3300050507	Bacteria	786
393	nmdc:mga05p37_189450_c1	3300050507	Bacteria	2498
394	nmdc:mga05p37_21005_c1	3300050507	Bacteria	7902
395	nmdc:mga05p37_34306_c1	3300050507	Bacteria	6214
396	nmdc:mga05p37_427307_c1	3300050507	Bacteria	1540
397	nmdc:mga05p37_46988_c1	3300050507	Bacteria	5308
398	nmdc:mga05p37_496356_c1	3300050507	Bacteria	1402
399	nmdc:mga05p37_562543_c1	3300050507	Bacteria	1295
400	nmdc:mga05p37_954584_c1	3300050507	Bacteria	917
401	nmdc:mga09592_209437_c1	3300050508	Bacteria	1689
402	nmdc:mga09592_391935_c1	3300050508	Bacteria	1201
403	nmdc:mga09592_739941_c1	3300050508	Bacteria	835
404	nmdc:mga09592_806570_c1	3300050508	Bacteria	794
405	nmdc:mga09592_8781_c1	3300050508	Bacteria	8223
406	nmdc:mga0qj67_147144_c1	3300050509	Bacteria	1910
407	nmdc:mga0qj67_38392_c1	3300050509	Bacteria	3757
408	nmdc:mga0qj67_804453_c1	3300050509	Bacteria	744
409	nmdc:mga06r32_10194_c1	3300050510	Bacteria	8484
410	nmdc:mga06r32_156053_c1	3300050510	Bacteria	2264
411	nmdc:mga06r32_246987_c1	3300050510	Bacteria	1772
412	nmdc:mga06r32_38408_c1	3300050510	Bacteria	4536
413	nmdc:mga06r32_423032_c1	3300050510	Bacteria	1313
414	nmdc:mga06r32_6609_c1	3300050510	Bacteria	10418
415	nmdc:mga06r32_9165_c1	3300050510	Bacteria	8919
416	nmdc:mga08y16_110837_c1	3300050511	Bacteria	2857
417	nmdc:mga08y16_1364415_c1	3300050511	Unclassified	673
418	nmdc:mga08y16_363_c1	3300050511	Bacteria	40879
419	nmdc:mga08y16_55224_c1	3300050511	Bacteria	4151
420	nmdc:mga0n895_159473_c1	3300050512	Bacteria	2287
421	nmdc:mga0n895_316170_c1	3300050512	Bacteria	1582
422	nmdc:mga0rr50_9209_c1	3300050513	Bacteria	6193
423	nmdc:mga08x19_336928_c1	3300050514	Bacteria	1052
424	nmdc:mga0a205_214949_c1	3300050515	Bacteria	1810
425	nmdc:mga0a205_31871_c1	3300050515	Bacteria	5052
426	nmdc:mga0a205_35767_c1	3300050515	Bacteria	1343
427	nmdc:mga0a205_60963_c1	3300050515	Bacteria	3643
428	Ga0501084_1510295	3300054114	Bacteria	562
429	Ga0590071_082737	3300059421	Unclassified	799
430	Ga0501082_0237320	3300060353	Bacteria	1587

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005546	Ga0070696_100975125	Ga0070696_1009751251	110
2	3300005549	Ga0070704_100393565	Ga0070704_1003935651	110
3	3300006871	Ga0075434_100285906	Ga0075434_1002859063	110
4	3300009094	Ga0111539_10000467	Ga0111539_1000046722	110
5	3300009098	Ga0105245_10047709	Ga0105245_100477097	110
6	3300009148	Ga0105243_10008818	Ga0105243_100088182	110
7	3300009551	Ga0105238_11175083	Ga0105238_111750832	110
8	3300009553	Ga0105249_10034342	Ga0105249_100343424	110
9	3300013308	Ga0157375_10007909	Ga0157375_100079095	110
10	3300014325	Ga0163163_11762382	Ga0163163_117623822	110
11	3300014326	Ga0157380_10442934	Ga0157380_104429342	110
12	3300035112	Ga0373932_0423091	Ga0373932_0423091_16_348	110
13	3300035242	Ga0373962_0238671	Ga0373962_0238671_50_382	110
14	3300046615	Ga0495656_0127565	Ga0495656_0127565_767_1099	110
15	3300046684	Ga0495669_0105106	Ga0495669_0105106_412_744	110
16	3300050489	nmdc:mga03683_119324_c1	nmdc:mga03683_119324_c1_241_573	110
17	3300050490	nmdc:mga03n38_123907_c1	nmdc:mga03n38_123907_c1_919_1251	110
18	3300050491	nmdc:mga00v17_317333_c1	nmdc:mga00v17_317333_c1_371_703	110
19	3300050492	nmdc:mga0yw44_1004251_c1	nmdc:mga0yw44_1004251_c1_33_365	110
20	3300050493	nmdc:mga0k408_137_c1	nmdc:mga0k408_137_c1_32645_32977	110
21	3300050494	nmdc:mga06z11_1269_c1	nmdc:mga06z11_1269_c1_6219_6551	110
22	3300050494	nmdc:mga06z11_767430_c1	nmdc:mga06z11_767430_c1_15_347	110
23	3300050495	nmdc:mga04h51_15917_c1	nmdc:mga04h51_15917_c1_38_370	110
24	3300050507	nmdc:mga05p37_1194820_c1	nmdc:mga05p37_1194820_c1_60_392	110
25	3300050508	nmdc:mga09592_209437_c1	nmdc:mga09592_209437_c1_1157_1489	110
26	3300050509	nmdc:mga0qj67_804453_c1	nmdc:mga0qj67_804453_c1_131_463	110
27	3300050510	nmdc:mga06r32_246987_c1	nmdc:mga06r32_246987_c1_346_678	110
28	3300050511	nmdc:mga08y16_363_c1	nmdc:mga08y16_363_c1_22801_23133	110
29	3300050512	nmdc:mga0n895_159473_c1	nmdc:mga0n895_159473_c1_572_904	110
30	3300050512	nmdc:mga0n895_316170_c1	nmdc:mga0n895_316170_c1_400_732	110
31	3300050513	nmdc:mga0rr50_9209_c1	nmdc:mga0rr50_9209_c1_5834_6166	110
32	3300050515	nmdc:mga0a205_31871_c1	nmdc:mga0a205_31871_c1_843_1175	110
33	3300050515	nmdc:mga0a205_60963_c1	nmdc:mga0a205_60963_c1_45_377	110
34	3300025981	Ga0207640_10155306	Ga0207640_101553063	118
35	3300009177	Ga0105248_11013611	Ga0105248_110136112	126
36	iso_pu_bacteria	2515154122	2515683081	127
37	iso_pu_bacteria	2899275550	2899276271	127
38	3300005347	Ga0070668_100193937	Ga0070668_1001939371	129
39	3300005441	Ga0070700_100596361	Ga0070700_1005963612	129
40	3300005455	Ga0070663_100174017	Ga0070663_1001740172	129
41	3300005548	Ga0070665_100685206	Ga0070665_1006852062	129
42	3300005841	Ga0068863_100684155	Ga0068863_1006841552	129
43	3300006358	Ga0068871_100676887	Ga0068871_1006768873	129
44	3300006844	Ga0075428_100010886	Ga0075428_1000108862	129
45	3300006844	Ga0075428_100434918	Ga0075428_1004349182	129
46	3300006846	Ga0075430_100050866	Ga0075430_1000508664	129
47	3300006847	Ga0075431_100009003	Ga0075431_1000090036	129
48	3300006880	Ga0075429_100105556	Ga0075429_1001055562	129
49	3300006880	Ga0075429_101017206	Ga0075429_1010172062	129
50	3300009147	Ga0114129_10183105	Ga0114129_101831056	129
51	3300009148	Ga0105243_10088329	Ga0105243_100883294	129
52	3300009148	Ga0105243_10418462	Ga0105243_104184622	129
53	3300009176	Ga0105242_10033760	Ga0105242_100337603	129
54	3300009553	Ga0105249_10443396	Ga0105249_104433962	129
55	3300013306	Ga0163162_10575242	Ga0163162_105752423	129
56	3300013308	Ga0157375_10426226	Ga0157375_104262263	129
57	3300014325	Ga0163163_11218280	Ga0163163_112182801	129
58	3300014326	Ga0157380_10170659	Ga0157380_101706593	129
59	3300014968	Ga0157379_10424782	Ga0157379_104247822	129
60	3300017792	Ga0163161_10086656	Ga0163161_100866563	129
61	3300025893	Ga0207682_10032438	Ga0207682_100324383	129
62	3300025923	Ga0207681_10321475	Ga0207681_103214752	129
63	3300025923	Ga0207681_10573533	Ga0207681_105735331	129
64	3300025934	Ga0207686_10100537	Ga0207686_101005372	129
65	3300025935	Ga0207709_10039519	Ga0207709_100395192	129
66	3300025937	Ga0207669_11716884	Ga0207669_117168841	129
67	3300025961	Ga0207712_10149263	Ga0207712_101492633	129
68	3300025972	Ga0207668_10041879	Ga0207668_100418794	129
69	3300025986	Ga0207658_10978005	Ga0207658_109780052	129
70	3300026067	Ga0207678_10306458	Ga0207678_103064581	129
71	3300026075	Ga0207708_10272144	Ga0207708_102721442	129
72	3300026089	Ga0207648_10026555	Ga0207648_100265557	129
73	3300026121	Ga0207683_10009938	Ga0207683_100099387	129
74	3300028379	Ga0268266_11232284	Ga0268266_112322842	129
75	3300028381	Ga0268264_10605419	Ga0268264_106054192	129
76	3300050507	nmdc:mga05p37_189450_c1	nmdc:mga05p37_189450_c1_111_500	129
77	3300050508	nmdc:mga09592_806570_c1	nmdc:mga09592_806570_c1_229_618	129
78	3300050509	nmdc:mga0qj67_147144_c1	nmdc:mga0qj67_147144_c1_888_1277	129
79	3300050510	nmdc:mga06r32_9165_c1	nmdc:mga06r32_9165_c1_2280_2669	129
80	3300005328	Ga0070676_10328499	Ga0070676_103284992	130
81	3300005328	Ga0070676_11056670	Ga0070676_110566701	130
82	3300005330	Ga0070690_100956898	Ga0070690_1009568981	130
83	3300005333	Ga0070677_10786764	Ga0070677_107867641	130
84	3300005334	Ga0068869_100021312	Ga0068869_1000213125	130
85	3300005336	Ga0070680_100252783	Ga0070680_1002527833	130
86	3300005338	Ga0068868_100065504	Ga0068868_1000655043	130
87	3300005338	Ga0068868_101371314	Ga0068868_1013713142	130
88	3300005340	Ga0070689_100009856	Ga0070689_1000098565	130
89	3300005343	Ga0070687_100001046	Ga0070687_1000010464	130
90	3300005343	Ga0070687_100409362	Ga0070687_1004093622	130
91	3300005345	Ga0070692_10284801	Ga0070692_102848012	130
92	3300005347	Ga0070668_100985846	Ga0070668_1009858462	130
93	3300005353	Ga0070669_100860125	Ga0070669_1008601251	130
94	3300005353	Ga0070669_100903722	Ga0070669_1009037222	130
95	3300005354	Ga0070675_100004234	Ga0070675_1000042345	130
96	3300005355	Ga0070671_100005807	Ga0070671_1000058075	130
97	3300005355	Ga0070671_100369366	Ga0070671_1003693662	130
98	3300005355	Ga0070671_100599084	Ga0070671_1005990842	130
99	3300005356	Ga0070674_100106755	Ga0070674_1001067552	130
100	3300005356	Ga0070674_100149835	Ga0070674_1001498352	130
101	3300005364	Ga0070673_100045410	Ga0070673_1000454102	130
102	3300005365	Ga0070688_100038597	Ga0070688_1000385972	130
103	3300005365	Ga0070688_100987637	Ga0070688_1009876371	130
104	3300005367	Ga0070667_101167674	Ga0070667_1011676742	130
105	3300005406	Ga0070703_10151748	Ga0070703_101517482	130
106	3300005438	Ga0070701_10002846	Ga0070701_100028467	130
107	3300005441	Ga0070700_100100418	Ga0070700_1001004182	130
108	3300005445	Ga0070708_100117721	Ga0070708_1001177213	130
109	3300005457	Ga0070662_100453614	Ga0070662_1004536142	130
110	3300005459	Ga0068867_100050343	Ga0068867_1000503435	130
111	3300005459	Ga0068867_101417297	Ga0068867_1014172971	130
112	3300005466	Ga0070685_10028402	Ga0070685_100284023	130
113	3300005467	Ga0070706_100066563	Ga0070706_1000665636	130
114	3300005468	Ga0070707_100294985	Ga0070707_1002949853	130
115	3300005518	Ga0070699_100533352	Ga0070699_1005333522	130
116	3300005535	Ga0070684_101244459	Ga0070684_1012444591	130
117	3300005536	Ga0070697_101479639	Ga0070697_1014796392	130
118	3300005543	Ga0070672_100117753	Ga0070672_1001177534	130
119	3300005545	Ga0070695_100725273	Ga0070695_1007252732	130
120	3300005548	Ga0070665_100018511	Ga0070665_1000185111	130
121	3300005548	Ga0070665_100980886	Ga0070665_1009808862	130
122	3300005549	Ga0070704_100053318	Ga0070704_1000533183	130
123	3300005564	Ga0070664_101030309	Ga0070664_1010303092	130
124	3300005615	Ga0070702_100859093	Ga0070702_1008590932	130
125	3300005617	Ga0068859_100038242	Ga0068859_1000382427	130
126	3300005718	Ga0068866_10442945	Ga0068866_104429451	130
127	3300005719	Ga0068861_100005068	Ga0068861_1000050682	130
128	3300005719	Ga0068861_100293607	Ga0068861_1002936072	130
129	3300005840	Ga0068870_10076116	Ga0068870_100761162	130
130	3300005841	Ga0068863_100318714	Ga0068863_1003187143	130
131	3300005841	Ga0068863_101170681	Ga0068863_1011706812	130
132	3300005841	Ga0068863_102359463	Ga0068863_1023594631	130
133	3300005842	Ga0068858_100284627	Ga0068858_1002846272	130
134	3300005843	Ga0068860_100590354	Ga0068860_1005903543	130
135	3300005843	Ga0068860_100707742	Ga0068860_1007077422	130
136	3300005844	Ga0068862_100067358	Ga0068862_1000673581	130
137	3300005844	Ga0068862_100074764	Ga0068862_1000747644	130
138	3300005844	Ga0068862_100803581	Ga0068862_1008035812	130
139	3300005985	Ga0081539_10053048	Ga0081539_100530482	130
140	3300006028	Ga0070717_10710572	Ga0070717_107105722	130
141	3300006051	Ga0075364_10118841	Ga0075364_101188412	130
142	3300006178	Ga0075367_10000213	Ga0075367_1000021315	130
143	3300006195	Ga0075366_10000365	Ga0075366_1000036517	130
144	3300006237	Ga0097621_100424190	Ga0097621_1004241901	130
145	3300006353	Ga0075370_10048105	Ga0075370_100481054	130
146	3300006844	Ga0075428_100167503	Ga0075428_1001675032	130
147	3300006844	Ga0075428_100463886	Ga0075428_1004638862	130
148	3300006844	Ga0075428_100848406	Ga0075428_1008484062	130
149	3300006844	Ga0075428_102286811	Ga0075428_1022868112	130
150	3300006846	Ga0075430_100169662	Ga0075430_1001696622	130
151	3300006846	Ga0075430_100252005	Ga0075430_1002520053	130
152	3300006847	Ga0075431_100000489	Ga0075431_10000048915	130
153	3300006847	Ga0075431_100216071	Ga0075431_1002160712	130
154	3300006847	Ga0075431_100261218	Ga0075431_1002612183	130
155	3300006847	Ga0075431_100359428	Ga0075431_1003594283	130
156	3300006852	Ga0075433_10591078	Ga0075433_105910781	130
157	3300006852	Ga0075433_10612666	Ga0075433_106126662	130
158	3300006871	Ga0075434_100115524	Ga0075434_1001155244	130
159	3300006880	Ga0075429_100084172	Ga0075429_1000841722	130
160	3300006880	Ga0075429_100199748	Ga0075429_1001997482	130
161	3300006880	Ga0075429_100963238	Ga0075429_1009632381	130
162	3300006880	Ga0075429_101641297	Ga0075429_1016412972	130
163	3300006881	Ga0068865_100045473	Ga0068865_1000454733	130
164	3300006881	Ga0068865_100594810	Ga0068865_1005948102	130
165	3300006881	Ga0068865_101313446	Ga0068865_1013134462	130
166	3300006931	Ga0097620_100038245	Ga0097620_1000382453	130
167	3300009094	Ga0111539_10002553	Ga0111539_1000255321	130
168	3300009094	Ga0111539_10652557	Ga0111539_106525572	130
169	3300009098	Ga0105245_11258278	Ga0105245_112582781	130
170	3300009101	Ga0105247_10091124	Ga0105247_100911242	130
171	3300009147	Ga0114129_10149214	Ga0114129_101492143	130
172	3300009147	Ga0114129_10189587	Ga0114129_101895872	130
173	3300009147	Ga0114129_11426087	Ga0114129_114260871	130
174	3300009176	Ga0105242_10482616	Ga0105242_104826162	130
175	3300009177	Ga0105248_11585482	Ga0105248_115854821	130
176	3300009553	Ga0105249_10620859	Ga0105249_106208591	130
177	3300013307	Ga0157372_10540100	Ga0157372_105401002	130
178	3300014325	Ga0163163_10049709	Ga0163163_100497092	130
179	3300014325	Ga0163163_10117605	Ga0163163_101176052	130
180	3300014325	Ga0163163_11627837	Ga0163163_116278371	130
181	3300014326	Ga0157380_10321645	Ga0157380_103216452	130
182	3300014326	Ga0157380_10436959	Ga0157380_104369592	130
183	3300014326	Ga0157380_11592296	Ga0157380_115922962	130
184	3300014968	Ga0157379_10873537	Ga0157379_108735372	130
185	3300021384	Ga0213876_10000033	Ga0213876_10000033100	130
186	3300021384	Ga0213876_10000143	Ga0213876_1000014329	130
187	3300025885	Ga0207653_10051031	Ga0207653_100510312	130
188	3300025899	Ga0207642_10123091	Ga0207642_101230913	130
189	3300025899	Ga0207642_10199276	Ga0207642_101992762	130
190	3300025899	Ga0207642_10630569	Ga0207642_106305691	130
191	3300025903	Ga0207680_10178821	Ga0207680_101788212	130
192	3300025907	Ga0207645_10258307	Ga0207645_102583072	130
193	3300025908	Ga0207643_10048181	Ga0207643_100481813	130
194	3300025910	Ga0207684_10193275	Ga0207684_101932752	130
195	3300025917	Ga0207660_10503146	Ga0207660_105031462	130
196	3300025918	Ga0207662_10000831	Ga0207662_1000083116	130
197	3300025918	Ga0207662_10270127	Ga0207662_102701272	130
198	3300025922	Ga0207646_10022842	Ga0207646_100228425	130
199	3300025923	Ga0207681_10754978	Ga0207681_107549782	130
200	3300025924	Ga0207694_11782275	Ga0207694_117822751	130
201	3300025926	Ga0207659_10280462	Ga0207659_102804622	130
202	3300025927	Ga0207687_10061841	Ga0207687_100618412	130
203	3300025931	Ga0207644_10001660	Ga0207644_1000166010	130
204	3300025931	Ga0207644_11268642	Ga0207644_112686422	130
205	3300025932	Ga0207690_10624574	Ga0207690_106245742	130
206	3300025934	Ga0207686_10445071	Ga0207686_104450712	130
207	3300025935	Ga0207709_10024886	Ga0207709_100248864	130
208	3300025936	Ga0207670_10038509	Ga0207670_100385095	130
209	3300025937	Ga0207669_10018032	Ga0207669_100180325	130
210	3300025937	Ga0207669_10384918	Ga0207669_103849182	130
211	3300025938	Ga0207704_10172755	Ga0207704_101727553	130
212	3300025938	Ga0207704_10417631	Ga0207704_104176312	130
213	3300025940	Ga0207691_10010819	Ga0207691_100108197	130
214	3300025941	Ga0207711_10164280	Ga0207711_101642804	130
215	3300025941	Ga0207711_10406204	Ga0207711_104062042	130
216	3300025942	Ga0207689_10021590	Ga0207689_100215903	130
217	3300025945	Ga0207679_10698920	Ga0207679_106989202	130
218	3300025960	Ga0207651_10575327	Ga0207651_105753271	130
219	3300025961	Ga0207712_10016257	Ga0207712_100162576	130
220	3300025972	Ga0207668_10112944	Ga0207668_101129443	130
221	3300025986	Ga0207658_10028907	Ga0207658_100289072	130
222	3300025986	Ga0207658_11081665	Ga0207658_110816652	130
223	3300026023	Ga0207677_10026323	Ga0207677_100263235	130
224	3300026035	Ga0207703_10157142	Ga0207703_101571424	130
225	3300026041	Ga0207639_12073626	Ga0207639_120736262	130
226	3300026067	Ga0207678_10008974	Ga0207678_100089749	130
227	3300026075	Ga0207708_10013629	Ga0207708_100136292	130
228	3300026075	Ga0207708_10412248	Ga0207708_104122482	130
229	3300026088	Ga0207641_10279957	Ga0207641_102799573	130
230	3300026088	Ga0207641_12506663	Ga0207641_125066631	130
231	3300026089	Ga0207648_10008981	Ga0207648_1000898110	130
232	3300026118	Ga0207675_100100693	Ga0207675_1001006932	130
233	3300026118	Ga0207675_100649363	Ga0207675_1006493632	130
234	3300026118	Ga0207675_100852195	Ga0207675_1008521952	130
235	3300026121	Ga0207683_10058504	Ga0207683_100585044	130
236	3300026142	Ga0207698_10229308	Ga0207698_102293083	130
237	3300027907	Ga0207428_10000041	Ga0207428_10000041110	130
238	3300027907	Ga0207428_10048724	Ga0207428_100487244	130
239	3300028380	Ga0268265_10165651	Ga0268265_101656513	130
240	3300028380	Ga0268265_10461700	Ga0268265_104617002	130
241	3300028380	Ga0268265_10639149	Ga0268265_106391492	130
242	3300028381	Ga0268264_10330147	Ga0268264_103301472	130
243	3300028381	Ga0268264_10441029	Ga0268264_104410292	130
244	3300028381	Ga0268264_10705762	Ga0268264_107057622	130
245	3300032002	Ga0307416_102753268	Ga0307416_1027532682	130
246	3300034817	Ga0373948_0016051	Ga0373948_0016051_315_710	130
247	3300034819	Ga0373958_0007979	Ga0373958_0007979_162_557	130
248	3300034957	Ga0373938_0056041	Ga0373938_0056041_285_680	130
249	3300035088	Ga0373940_0092644	Ga0373940_0092644_64_459	130
250	3300035091	Ga0373951_0109737	Ga0373951_0109737_168_563	130
251	3300035112	Ga0373932_0017948	Ga0373932_0017948_866_1261	130
252	3300035242	Ga0373962_0044242	Ga0373962_0044242_17_412	130
253	3300035691	Ga0373931_0003133	Ga0373931_0003133_5588_5983	130
254	3300039437	Ga0436365_0198252	Ga0436365_0198252_59204_59596	130
255	3300039437	Ga0436365_0280278	Ga0436365_0280278_20136_20528	130
256	3300048905	Ga0496102_0669113	Ga0496102_0669113_431_832	130
257	3300048907	Ga0496104_0003917	Ga0496104_0003917_1365_1766	130
258	3300048908	Ga0496105_0194796	Ga0496105_0194796_209_610	130
259	3300048912	Ga0496109_0268592	Ga0496109_0268592_1001_1402	130
260	3300048915	Ga0496112_0701477	Ga0496112_0701477_384_785	130
261	3300048917	Ga0496114_0805169	Ga0496114_0805169_189_590	130
262	3300048917	Ga0496114_1090797	Ga0496114_1090797_138_533	130
263	3300048918	Ga0496115_0009398	Ga0496115_0009398_6650_7051	130
264	3300049584	Ga0501068_1049277	Ga0501068_1049277_78_473	130
265	3300049775	Ga0501279_040326	Ga0501279_040326_297_689	130
266	3300049822	Ga0501035_0569036	Ga0501035_0569036_491_889	130
267	3300050507	nmdc:mga05p37_34306_c1	nmdc:mga05p37_34306_c1_1546_1938	130
268	3300050507	nmdc:mga05p37_427307_c1	nmdc:mga05p37_427307_c1_782_1186	130
269	3300050507	nmdc:mga05p37_46988_c1	nmdc:mga05p37_46988_c1_4646_5038	130
270	3300050507	nmdc:mga05p37_496356_c1	nmdc:mga05p37_496356_c1_71_463	130
271	3300050507	nmdc:mga05p37_562543_c1	nmdc:mga05p37_562543_c1_829_1233	130
272	3300050508	nmdc:mga09592_391935_c1	nmdc:mga09592_391935_c1_299_703	130
273	3300050508	nmdc:mga09592_739941_c1	nmdc:mga09592_739941_c1_82_474	130
274	3300050509	nmdc:mga0qj67_38392_c1	nmdc:mga0qj67_38392_c1_3010_3414	130
275	3300050510	nmdc:mga06r32_10194_c1	nmdc:mga06r32_10194_c1_6692_7084	130
276	3300050510	nmdc:mga06r32_156053_c1	nmdc:mga06r32_156053_c1_326_730	130
277	3300050510	nmdc:mga06r32_38408_c1	nmdc:mga06r32_38408_c1_2296_2688	130
278	3300050510	nmdc:mga06r32_423032_c1	nmdc:mga06r32_423032_c1_529_921	130
279	3300050511	nmdc:mga08y16_110837_c1	nmdc:mga08y16_110837_c1_44_448	130
280	3300050511	nmdc:mga08y16_55224_c1	nmdc:mga08y16_55224_c1_311_703	130
281	3300060353	Ga0501082_0237320	Ga0501082_0237320_70_462	130
282	3300006914	Ga0075436_100016975	Ga0075436_1000169753	131
283	3300025933	Ga0207706_10061394	Ga0207706_100613943	131
284	3300031595	Ga0265313_10337193	Ga0265313_103371931	131
285	3300031711	Ga0265314_10358035	Ga0265314_103580352	131
286	3300039062	Ga0400483_116063	Ga0400483_116063_629_1024	131
287	3300039062	Ga0400483_223246	Ga0400483_223246_412_807	131
288	3300045976	Ga0466967_2145464	Ga0466967_2145464_144_539	131
289	3300046680	Ga0495646_0100572	Ga0495646_0100572_735_1130	131
290	3300046684	Ga0495669_0166757	Ga0495669_0166757_102_497	131
291	3300047319	Ga0495674_0014525	Ga0495674_0014525_4723_5118	131
292	3300049571	Ga0501034_0049699	Ga0501034_0049699_1523_1921	131
293	3300049580	Ga0501046_0784494	Ga0501046_0784494_61_456	131
294	3300049582	Ga0501048_1187452	Ga0501048_1187452_51_446	131
295	3300054114	Ga0501084_1510295	Ga0501084_1510295_120_515	131
296	3300005336	Ga0070680_100168865	Ga0070680_1001688651	132
297	3300005336	Ga0070680_100356983	Ga0070680_1003569832	132
298	3300005339	Ga0070660_100428906	Ga0070660_1004289061	132
299	3300005345	Ga0070692_10524974	Ga0070692_105249742	132
300	3300005347	Ga0070668_100384157	Ga0070668_1003841572	132
301	3300005353	Ga0070669_100014381	Ga0070669_1000143813	132
302	3300005356	Ga0070674_100013724	Ga0070674_1000137242	132
303	3300005356	Ga0070674_100706829	Ga0070674_1007068292	132
304	3300005356	Ga0070674_101168622	Ga0070674_1011686222	132
305	3300005438	Ga0070701_10605771	Ga0070701_106057711	132
306	3300005441	Ga0070700_100021017	Ga0070700_1000210172	132
307	3300005441	Ga0070700_101299542	Ga0070700_1012995421	132
308	3300005444	Ga0070694_100375625	Ga0070694_1003756252	132
309	3300005444	Ga0070694_100448662	Ga0070694_1004486621	132
310	3300005445	Ga0070708_101179744	Ga0070708_1011797442	132
311	3300005459	Ga0068867_100047375	Ga0068867_1000473751	132
312	3300005459	Ga0068867_101845636	Ga0068867_1018456361	132
313	3300005530	Ga0070679_100177929	Ga0070679_1001779292	132
314	3300005544	Ga0070686_100191786	Ga0070686_1001917862	132
315	3300005545	Ga0070695_100003463	Ga0070695_1000034635	132
316	3300005549	Ga0070704_100564724	Ga0070704_1005647241	132
317	3300005617	Ga0068859_100491921	Ga0068859_1004919212	132
318	3300005718	Ga0068866_10067733	Ga0068866_100677332	132
319	3300005719	Ga0068861_100175604	Ga0068861_1001756042	132
320	3300005719	Ga0068861_100182857	Ga0068861_1001828572	132
321	3300005844	Ga0068862_100171714	Ga0068862_1001717142	132
322	3300006931	Ga0097620_100491854	Ga0097620_1004918542	132
323	3300009148	Ga0105243_10054425	Ga0105243_100544253	132
324	3300009174	Ga0105241_10510517	Ga0105241_105105172	132
325	3300009553	Ga0105249_10095146	Ga0105249_100951462	132
326	3300009553	Ga0105249_12478927	Ga0105249_124789271	132
327	3300014326	Ga0157380_11321098	Ga0157380_113210982	132
328	3300025911	Ga0207654_10661238	Ga0207654_106612382	132
329	3300025921	Ga0207652_10143466	Ga0207652_101434662	132
330	3300025923	Ga0207681_10034990	Ga0207681_100349902	132
331	3300025933	Ga0207706_10137557	Ga0207706_101375572	132
332	3300025937	Ga0207669_10021108	Ga0207669_100211083	132
333	3300025961	Ga0207712_10138290	Ga0207712_101382901	132
334	3300025972	Ga0207668_10221676	Ga0207668_102216762	132
335	3300026075	Ga0207708_10094485	Ga0207708_100944851	132
336	3300026075	Ga0207708_10283032	Ga0207708_102830321	132
337	3300026075	Ga0207708_11800629	Ga0207708_118006291	132
338	3300026089	Ga0207648_10538010	Ga0207648_105380102	132
339	3300026118	Ga0207675_100048547	Ga0207675_1000485472	132
340	3300027360	Ga0209969_1029052	Ga0209969_10290522	132
341	3300031691	Ga0316579_10604015	Ga0316579_106040151	132
342	3300031728	Ga0316578_10283136	Ga0316578_102831362	132
343	3300032002	Ga0307416_100728494	Ga0307416_1007284942	132
344	3300036401	Ga0373937_1639896	Ga0373937_1639896_111_509	132
345	3300036647	Ga0316582_0110460	Ga0316582_0110460_892_1323	132
346	3300036647	Ga0316582_0756586	Ga0316582_0756586_110_541	132
347	3300036712	Ga0316584_0429433	Ga0316584_0429433_479_910	132
348	3300046455	Ga0495603_0871613	Ga0495603_0871613_27_440	132
349	3300049576	Ga0501040_1041622	Ga0501040_1041622_161_565	132
350	3300049585	Ga0501069_0538733	Ga0501069_0538733_95_505	132
351	3300049587	Ga0501071_0679212	Ga0501071_0679212_363_767	132
352	3300049592	Ga0501076_0578837	Ga0501076_0578837_86_490	132
353	3300005334	Ga0068869_101682444	Ga0068869_1016824441	133
354	3300005444	Ga0070694_101124459	Ga0070694_1011244591	133
355	3300005549	Ga0070704_100723946	Ga0070704_1007239461	133
356	3300006844	Ga0075428_100110320	Ga0075428_1001103202	133
357	3300006852	Ga0075433_10250767	Ga0075433_102507673	133
358	3300006914	Ga0075436_100442541	Ga0075436_1004425412	133
359	3300009147	Ga0114129_10009889	Ga0114129_1000988911	133
360	3300009147	Ga0114129_10282805	Ga0114129_102828052	133
361	3300009147	Ga0114129_11305723	Ga0114129_113057232	133
362	3300042015	Ga0439462_0166640	Ga0439462_0166640_204_605	133
363	3300048911	Ga0496108_0090894	Ga0496108_0090894_1288_1689	133
364	3300050507	nmdc:mga05p37_21005_c1	nmdc:mga05p37_21005_c1_6498_6899	133
365	3300050507	nmdc:mga05p37_954584_c1	nmdc:mga05p37_954584_c1_198_620	133
366	3300050508	nmdc:mga09592_8781_c1	nmdc:mga09592_8781_c1_4721_5143	133
367	3300050510	nmdc:mga06r32_6609_c1	nmdc:mga06r32_6609_c1_9540_9962	133
368	3300050514	nmdc:mga08x19_336928_c1	nmdc:mga08x19_336928_c1_566_973	133
369	3300050515	nmdc:mga0a205_214949_c1	nmdc:mga0a205_214949_c1_529_930	133
370	3300005290	Ga0065712_10345080	Ga0065712_103450801	134
371	3300005328	Ga0070676_10255622	Ga0070676_102556222	134
372	3300005331	Ga0070670_101254517	Ga0070670_1012545172	134
373	3300005340	Ga0070689_100439704	Ga0070689_1004397042	134
374	3300005365	Ga0070688_100313980	Ga0070688_1003139802	134
375	3300005441	Ga0070700_100509333	Ga0070700_1005093331	134
376	3300005615	Ga0070702_100029580	Ga0070702_1000295804	134
377	3300005617	Ga0068859_101777330	Ga0068859_1017773301	134
378	3300005618	Ga0068864_100002264	Ga0068864_10000226413	134
379	3300005719	Ga0068861_101102872	Ga0068861_1011028722	134
380	3300005719	Ga0068861_102538866	Ga0068861_1025388661	134
381	3300005719	Ga0068861_102715065	Ga0068861_1027150651	134
382	3300005840	Ga0068870_10146399	Ga0068870_101463992	134
383	3300005841	Ga0068863_100378309	Ga0068863_1003783092	134
384	3300005841	Ga0068863_101130512	Ga0068863_1011305121	134
385	3300006844	Ga0075428_101178058	Ga0075428_1011780582	134
386	3300006852	Ga0075433_10019917	Ga0075433_100199173	134
387	3300006871	Ga0075434_100031968	Ga0075434_1000319683	134
388	3300006931	Ga0097620_101777613	Ga0097620_1017776131	134
389	3300009094	Ga0111539_10173396	Ga0111539_101733962	134
390	3300009098	Ga0105245_10619544	Ga0105245_106195442	134
391	3300009101	Ga0105247_10882246	Ga0105247_108822462	134
392	3300009147	Ga0114129_11639693	Ga0114129_116396932	134
393	3300009148	Ga0105243_11343581	Ga0105243_113435811	134
394	3300009174	Ga0105241_10498957	Ga0105241_104989572	134
395	3300011119	Ga0105246_10402683	Ga0105246_104026832	134
396	3300011119	Ga0105246_10451784	Ga0105246_104517841	134
397	3300013297	Ga0157378_10793180	Ga0157378_107931801	134
398	3300013308	Ga0157375_10487049	Ga0157375_104870492	134
399	3300014326	Ga0157380_10471668	Ga0157380_104716681	134
400	3300014326	Ga0157380_10675057	Ga0157380_106750572	134
401	3300014745	Ga0157377_10181243	Ga0157377_101812432	134
402	3300021384	Ga0213876_10059126	Ga0213876_100591262	134
403	3300025911	Ga0207654_10899861	Ga0207654_108998611	134
404	3300025925	Ga0207650_10425703	Ga0207650_104257032	134
405	3300025925	Ga0207650_10685813	Ga0207650_106858132	134
406	3300025936	Ga0207670_10012153	Ga0207670_100121535	134
407	3300025940	Ga0207691_10091705	Ga0207691_100917053	134
408	3300025942	Ga0207689_10397317	Ga0207689_103973172	134
409	3300025942	Ga0207689_10774410	Ga0207689_107744102	134
410	3300025960	Ga0207651_10146970	Ga0207651_101469703	134
411	3300026075	Ga0207708_11326132	Ga0207708_113261321	134
412	3300026089	Ga0207648_10053392	Ga0207648_100533923	134
413	3300026095	Ga0207676_10051070	Ga0207676_100510704	134
414	3300026095	Ga0207676_10079141	Ga0207676_100791413	134
415	3300028381	Ga0268264_12380298	Ga0268264_123802982	134
416	3300031548	Ga0307408_100154596	Ga0307408_1001545961	134
417	3300032002	Ga0307416_103126206	Ga0307416_1031262062	134
418	3300032004	Ga0307414_11628765	Ga0307414_116287651	134
419	3300032005	Ga0307411_11118157	Ga0307411_111181572	134
420	3300032126	Ga0307415_100976465	Ga0307415_1009764652	134
421	3300035207	Ga0373942_0005319	Ga0373942_0005319_1158_1562	134
422	3300045051	Ga0451576_2169581	Ga0451576_2169581_76_480	134
423	3300049515	Ga0501292_015043	Ga0501292_015043_358_762	134
424	3300049664	Ga0501224_037512	Ga0501224_037512_38_442	134
425	3300049680	Ga0501250_069382	Ga0501250_069382_108_512	134
426	3300049683	Ga0501253_114707	Ga0501253_114707_156_560	134
427	3300049705	Ga0501225_0012852	Ga0501225_0012852_1847_2251	134
428	3300049708	Ga0501245_010946	Ga0501245_010946_835_1239	134
429	3300049775	Ga0501279_102073	Ga0501279_102073_19_423	134
430	3300050511	nmdc:mga08y16_1364415_c1	nmdc:mga08y16_1364415_c1_248_652	134
431	3300050515	nmdc:mga0a205_35767_c1	nmdc:mga0a205_35767_c1_95_499	134
432	3300059421	Ga0590071_082737	Ga0590071_082737_207_611	134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

29

153

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5v4f-assembly1.cif.gz_A	crystal structure of the protein of unknown function of the conserved rid protein family yyfb from yersinia pestis	0.8759	1	132
5hp7-assembly1.cif.gz_A	crystal structures of rida in the apo form	0.8651	23	132
5v4f-assembly1.cif.gz_A	crystal structure of the protein of unknown function of the conserved rid protein family yyfb from yersinia pestis	0.8637	1	132
7cd2-assembly5.cif.gz_R	crystal structure of the s103f mutant of bacillus subtilis (natto) yabj protein.	0.8366	22	132
5hp7-assembly1.cif.gz_A	crystal structures of rida in the apo form	0.8358	23	132

ID	Description	Score	Start	End	Superfamily
5hp8A00	Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like	0.8667	23	132	3.30.1330.40
5hp8A00	Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like	0.837	23	132	3.30.1330.40
3k12B01	Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like	0.8057	23	131	3.30.1330.40
1jd1F00	Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like	0.8046	12	132	3.30.1330.40
1pf5A00	Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like	0.7978	17	134	3.30.1330.40

ID	Description	Score	Start	End	GO Terms
AF-A0A7Y2CI40-F1-model_v4	RidA family protein	0.9929	49	132
AF-A0A2E8K4U8-F1-model_v4	RidA family protein	0.9925	58	132
AF-A0A511D8H3-F1-model_v4	Enamine deaminase RidA	0.9896	30	134	GO:0005829 GO:0019239
AF-A0A6J7TSM9-F1-model_v4	Unannotated protein	0.9892	2	132
AF-A0A6N6JSJ9-F1-model_v4	RidA family protein	0.9878	30	134	GO:0005829 GO:0019239

Feature Viewer

pLDDT	pTM	Quality
95.42	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F442601

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

29

153

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map