F442587

General Info

Members Datasets Scaffolds Average Seq Length
432 240 864 257

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_10841581|Ga0105248_108415811
Length 296
Sequence MDSSSRLNLSVDSSACKATATCAVDVILKHRSANAALETCLFTKAIVCIPSSNFASGLTTVDLGVPDFDQVLEQHARYCDALSECRLELTVLNADLRYPDSTFVEDTAVLTTKGAMLTRPGAATREGEVEAIKPILQSFFDPLPCIEAPGTLDGGDICEAEDHFFIGVSHRTNEEGAAQLAAHLDQLGYSSSLIDIRAMTSVLHLKSGLSYIGHNTIVVMEEMAGNPQFRDFNLVRVSIHESYAANCVRVNDRVLVPAGFPEILEELRRRGFSPLALDMSEFQKMDGGLSCLSLRF

Samples

Sample ID Description Type Environment
1 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
139 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
140 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
147 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
148 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
149 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
150 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
151 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
163 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
171 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
172 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
176 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
206 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
207 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
208 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
209 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
210 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
211 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
212 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
213 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
214 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
215 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
216 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
217 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
222 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
225 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
226 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
227 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
228 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
229 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
232 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
233 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
234 2852673933 Sporosarcina sp. JAI121 Isolate Rhizosphere
235 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
236 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
237 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
238 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
239 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
240 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.92
Metatranscriptomes 0
Isolates 2.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.16
Nodule 0
Rhizoplane 3.47
Rhizosphere 94.44
Stem 0
Stem Tuber 0
Unclassified 28.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105248_10841581 3300009177 Bacteria 1035
2 MRS1b_contig_1773955 2162886011 Unclassified 3378
3 CNAas_1000531 3300000532 Bacteria 3703
4 JGI25406J46586_10045649 3300003203 Unclassified 1506
5 rootL2_10166353 3300003322 Unclassified 2881
6 Ga0065712_10000144 3300005290 Bacteria 54862
7 Ga0065715_10092089 3300005293 Bacteria 5342
8 Ga0065715_10107946 3300005293 Bacteria 2744
9 Ga0065715_10135525 3300005293 Bacteria 1937
10 Ga0065707_10098219 3300005295 Unclassified 3103
11 Ga0070676_10004323 3300005328 Bacteria 7463
12 Ga0070676_10025606 3300005328 Bacteria 3336
13 Ga0070676_10072484 3300005328 Bacteria 2071
14 Ga0070683_100142043 3300005329 Unclassified 2275
15 Ga0070690_100070055 3300005330 Bacteria 2276
16 Ga0070670_100023060 3300005331 Bacteria 5355
17 Ga0070670_100088040 3300005331 Bacteria 2669
18 Ga0068869_100021211 3300005334 Bacteria 4466
19 Ga0070666_10006151 3300005335 Bacteria 7380
20 Ga0068868_100212758 3300005338 Bacteria 1616
21 Ga0070692_10280974 3300005345 Unclassified 1009
22 Ga0070668_100124220 3300005347 Bacteria 2066
23 Ga0070668_100283013 3300005347 Bacteria 1386
24 Ga0070669_100027240 3300005353 Bacteria 4113
25 Ga0070675_100176786 3300005354 Unclassified 1844
26 Ga0070675_100189416 3300005354 Bacteria 1782
27 Ga0070671_100028346 3300005355 Unclassified 4610
28 Ga0070671_100061497 3300005355 Bacteria 3128
29 Ga0070671_100113887 3300005355 Unclassified 2273
30 Ga0070674_100082792 3300005356 Unclassified 2296
31 Ga0070674_100399543 3300005356 Bacteria 1123
32 Ga0070673_100432799 3300005364 Bacteria 1181
33 Ga0070688_100019669 3300005365 Bacteria 3914
34 Ga0070688_100036536 3300005365 Unclassified 2988
35 Ga0070667_100013504 3300005367 Bacteria 6749
36 Ga0070667_100029131 3300005367 Unclassified 4598
37 Ga0070667_100077237 3300005367 Bacteria 2843
38 Ga0070667_100077655 3300005367 Bacteria 2836
39 Ga0070667_100096807 3300005367 Bacteria 2545
40 Ga0070703_10003055 3300005406 Unclassified 4787
41 Ga0070709_10527880 3300005434 Bacteria 900
42 Ga0070714_100163967 3300005435 Bacteria 2013
43 Ga0070711_100108452 3300005439 Bacteria 2034
44 Ga0070700_100034979 3300005441 Unclassified 3037
45 Ga0070694_100028178 3300005444 Bacteria 3652
46 Ga0070694_100103994 3300005444 Unclassified 2013
47 Ga0070694_100290606 3300005444 Bacteria 1249
48 Ga0070708_100001683 3300005445 Bacteria 16984
49 Ga0070678_100039435 3300005456 Bacteria 3332
50 Ga0070678_100223153 3300005456 Unclassified 1567
51 Ga0070678_100421679 3300005456 Bacteria 1163
52 Ga0070678_100562121 3300005456 Unclassified 1014
53 Ga0070662_100062118 3300005457 Bacteria 2728
54 Ga0070662_100300029 3300005457 Unclassified 1305
55 Ga0070662_100507423 3300005457 Bacteria 1006
56 Ga0068867_100124548 3300005459 Unclassified 1996
57 Ga0068867_100130267 3300005459 Unclassified 1954
58 Ga0068867_100161996 3300005459 Unclassified 1764
59 Ga0070685_10025766 3300005466 Bacteria 3239
60 Ga0070685_10144046 3300005466 Bacteria 1503
61 Ga0070706_100009094 3300005467 Bacteria 9252
62 Ga0070706_100013803 3300005467 Bacteria 7468
63 Ga0070706_100061936 3300005467 Bacteria 3456
64 Ga0070698_100005151 3300005471 Bacteria 14298
65 Ga0070698_100020960 3300005471 Bacteria 6849
66 Ga0070698_100047703 3300005471 Bacteria 4378
67 Ga0070698_100061208 3300005471 Bacteria 3798
68 Ga0070699_100000814 3300005518 Bacteria 28861
69 Ga0070699_100029625 3300005518 Unclassified 4720
70 Ga0070699_100062478 3300005518 Bacteria 3228
71 Ga0070684_100477634 3300005535 Unclassified 1153
72 Ga0070697_100005327 3300005536 Bacteria 9886
73 Ga0070697_100034131 3300005536 Bacteria 4100
74 Ga0070697_100051978 3300005536 Bacteria 3330
75 Ga0070697_100122402 3300005536 Bacteria 2177
76 Ga0070697_100135344 3300005536 Bacteria 2069
77 Ga0070672_100068700 3300005543 Bacteria 2811
78 Ga0070672_100234115 3300005543 Unclassified 1544
79 Ga0070695_100043991 3300005545 Bacteria 2841
80 Ga0070695_100130576 3300005545 Bacteria 1731
81 Ga0070696_100001106 3300005546 Bacteria 17448
82 Ga0070696_100003247 3300005546 Bacteria 10834
83 Ga0070693_100010664 3300005547 Bacteria 4608
84 Ga0070693_100068650 3300005547 Unclassified 2081
85 Ga0070665_100130477 3300005548 Unclassified 2515
86 Ga0070704_100178847 3300005549 Bacteria 1695
87 Ga0070704_100552148 3300005549 Bacteria 1007
88 Ga0068857_100011245 3300005577 Bacteria 7782
89 Ga0068852_100113708 3300005616 Bacteria 2465
90 Ga0068852_100634571 3300005616 Unclassified 1075
91 Ga0068852_100756422 3300005616 Unclassified 984
92 Ga0068859_100012901 3300005617 Bacteria 8395
93 Ga0068859_100013245 3300005617 Bacteria 8275
94 Ga0068859_100023271 3300005617 Bacteria 6217
95 Ga0068859_100058917 3300005617 Unclassified 3869
96 Ga0068859_100094203 3300005617 Bacteria 3047
97 Ga0068859_100330301 3300005617 Unclassified 1619
98 Ga0068859_101073341 3300005617 Unclassified 885
99 Ga0068864_100013274 3300005618 Bacteria 6823
100 Ga0068864_100058554 3300005618 Bacteria 3330
101 Ga0068861_100004002 3300005719 Bacteria 9870
102 Ga0068861_100009014 3300005719 Bacteria 6876
103 Ga0068861_100081665 3300005719 Bacteria 2531
104 Ga0068861_100175196 3300005719 Unclassified 1781
105 Ga0068861_100324131 3300005719 Bacteria 1342
106 Ga0068870_10007958 3300005840 Unclassified 4746
107 Ga0068870_10233253 3300005840 Bacteria 1132
108 Ga0068863_100040866 3300005841 Bacteria 4409
109 Ga0068863_100113581 3300005841 Bacteria 2580
110 Ga0068858_100068744 3300005842 Bacteria 3282
111 Ga0068860_100015249 3300005843 Bacteria 7505
112 Ga0068860_100106142 3300005843 Bacteria 2682
113 Ga0068860_100161231 3300005843 Bacteria 2162
114 Ga0068860_100453346 3300005843 Unclassified 1275
115 Ga0068862_100025036 3300005844 Bacteria 5009
116 Ga0081539_10005833 3300005985 Bacteria 12228
117 Ga0097621_100010358 3300006237 Bacteria 6817
118 Ga0097621_100188650 3300006237 Bacteria 1784
119 Ga0068871_100031750 3300006358 Unclassified 4167
120 Ga0068871_100055828 3300006358 Bacteria 3207
121 Ga0075428_100137954 3300006844 Bacteria 2652
122 Ga0075428_100762181 3300006844 Bacteria 1029
123 Ga0075430_100062215 3300006846 Bacteria 3136
124 Ga0075431_100151241 3300006847 Bacteria 2390
125 Ga0075433_10042267 3300006852 Bacteria 3954
126 Ga0075433_10050194 3300006852 Bacteria 3631
127 Ga0075433_10088904 3300006852 Unclassified 2730
128 Ga0075433_10096471 3300006852 Bacteria 2617
129 Ga0075434_100003693 3300006871 Bacteria 13671
130 Ga0075434_100004484 3300006871 Bacteria 12603
131 Ga0075434_100040243 3300006871 Bacteria 4629
132 Ga0075434_100047384 3300006871 Unclassified 4265
133 Ga0075434_100099293 3300006871 Bacteria 2917
134 Ga0068865_100044681 3300006881 Bacteria 3033
135 Ga0068865_100364975 3300006881 Unclassified 1174
136 Ga0075436_100104224 3300006914 Unclassified 1977
137 Ga0075436_100191052 3300006914 Bacteria 1449
138 Ga0097620_100012898 3300006931 Bacteria 8395
139 Ga0097620_100013245 3300006931 Bacteria 8275
140 Ga0097620_100023273 3300006931 Bacteria 6217
141 Ga0097620_100058917 3300006931 Unclassified 3869
142 Ga0097620_100094202 3300006931 Bacteria 3047
143 Ga0097620_100330293 3300006931 Unclassified 1619
144 Ga0097620_101073325 3300006931 Unclassified 885
145 Ga0075435_100001131 3300007076 Bacteria 16995
146 Ga0075435_100358166 3300007076 Unclassified 1251
147 Ga0111539_10159491 3300009094 Bacteria 2638
148 Ga0111539_10651085 3300009094 Bacteria 1227
149 Ga0114129_10003007 3300009147 Bacteria 23625
150 Ga0114129_10412286 3300009147 Unclassified 1779
151 Ga0105243_10000578 3300009148 Bacteria 36889
152 Ga0105243_10004438 3300009148 Bacteria 11098
153 Ga0105243_10028725 3300009148 Bacteria 4271
154 Ga0105241_10000121 3300009174 Bacteria 57041
155 Ga0105241_10043199 3300009174 Bacteria 3413
156 Ga0105241_10167375 3300009174 Unclassified 1812
157 Ga0105241_10187649 3300009174 Bacteria 1719
158 Ga0105242_10001346 3300009176 Bacteria 19400
159 Ga0105242_10030986 3300009176 Bacteria 4271
160 Ga0105242_10153857 3300009176 Bacteria 2007
161 Ga0105242_10297155 3300009176 Bacteria 1472
162 Ga0105248_10014574 3300009177 Bacteria 8653
163 Ga0105248_10042884 3300009177 Bacteria 5073
164 Ga0105248_10099271 3300009177 Unclassified 3281
165 Ga0105237_10420939 3300009545 Unclassified 1341
166 Ga0105238_10019542 3300009551 Bacteria 6900
167 Ga0105238_10032179 3300009551 Bacteria 5337
168 Ga0105249_10032050 3300009553 Bacteria 4754
169 Ga0105239_10183918 3300010375 Bacteria 2338
170 Ga0105239_10191949 3300010375 Unclassified 2286
171 Ga0105246_10006819 3300011119 Bacteria 6980
172 Ga0105246_10066240 3300011119 Bacteria 2528
173 Ga0157369_10026371 3300013105 Bacteria 6446
174 Ga0157374_10007880 3300013296 Bacteria 9092
175 Ga0157374_10189377 3300013296 Bacteria 2012
176 Ga0157374_10855077 3300013296 Unclassified 927
177 Ga0157378_10000001 3300013297 Bacteria 352632
178 Ga0157378_10050360 3300013297 Bacteria 3707
179 Ga0157378_10052652 3300013297 Unclassified 3621
180 Ga0163162_10015863 3300013306 Bacteria 7361
181 Ga0163162_10268542 3300013306 Bacteria 1837
182 Ga0163162_10529593 3300013306 Unclassified 1307
183 Ga0157372_10000541 3300013307 Bacteria 41628
184 Ga0157372_10038818 3300013307 Bacteria 5254
185 Ga0157372_10469007 3300013307 Bacteria 1467
186 Ga0157375_10023336 3300013308 Bacteria 5708
187 Ga0157375_10083575 3300013308 Unclassified 3238
188 Ga0157375_10201264 3300013308 Bacteria 2147
189 Ga0157375_10212079 3300013308 Unclassified 2094
190 Ga0157375_10398430 3300013308 Unclassified 1543
191 Ga0163163_10000243 3300014325 Bacteria 55738
192 Ga0163163_10049238 3300014325 Bacteria 4146
193 Ga0163163_10295906 3300014325 Bacteria 1671
194 Ga0163163_10529738 3300014325 Unclassified 1240
195 Ga0157380_10015139 3300014326 Bacteria 5661
196 Ga0157380_10053831 3300014326 Unclassified 3192
197 Ga0157379_10002528 3300014968 Bacteria 15328
198 Ga0157376_10040972 3300014969 Bacteria 3789
199 Ga0163161_10002937 3300017792 Bacteria 12078
200 Ga0209676_1010512 3300025292 Bacteria 3842
201 Ga0209676_1012095 3300025292 Bacteria 3422
202 Ga0209676_1022990 3300025292 Bacteria 2050
203 Ga0209676_1028676 3300025292 Bacteria 1729
204 Ga0209025_1016221 3300025294 Bacteria 4419
205 Ga0207697_10051572 3300025315 Bacteria 1701
206 Ga0207682_10001496 3300025893 Bacteria 10791
207 Ga0207680_10000506 3300025903 Bacteria 18601
208 Ga0207647_10057202 3300025904 Unclassified 2391
209 Ga0207699_10188389 3300025906 Unclassified 1391
210 Ga0207645_10238938 3300025907 Unclassified 1200
211 Ga0207684_10029961 3300025910 Bacteria 4633
212 Ga0207684_10048824 3300025910 Bacteria 3590
213 Ga0207684_10063916 3300025910 Unclassified 3124
214 Ga0207654_10000023 3300025911 Bacteria 161401
215 Ga0207663_10087231 3300025916 Bacteria 2060
216 Ga0207662_10017501 3300025918 Bacteria 4056
217 Ga0207646_10174952 3300025922 Bacteria 1939
218 Ga0207694_10001323 3300025924 Bacteria 21316
219 Ga0207650_10339685 3300025925 Unclassified 1233
220 Ga0207644_10085886 3300025931 Bacteria 2335
221 Ga0207644_10429670 3300025931 Bacteria 1083
222 Ga0207706_10008430 3300025933 Bacteria 9512
223 Ga0207706_10014714 3300025933 Bacteria 7085
224 Ga0207686_10001357 3300025934 Bacteria 13942
225 Ga0207686_10098817 3300025934 Bacteria 1944
226 Ga0207709_10004107 3300025935 Bacteria 8480
227 Ga0207709_10004124 3300025935 Bacteria 8462
228 Ga0207709_10026467 3300025935 Unclassified 3332
229 Ga0207670_10393414 3300025936 Bacteria 1107
230 Ga0207669_10252532 3300025937 Bacteria 1314
231 Ga0207704_10198290 3300025938 Bacteria 1467
232 Ga0207704_10246359 3300025938 Bacteria 1338
233 Ga0207665_10178160 3300025939 Bacteria 1538
234 Ga0207665_10464261 3300025939 Unclassified 973
235 Ga0207691_10002530 3300025940 Bacteria 17862
236 Ga0207691_10008471 3300025940 Bacteria 9874
237 Ga0207691_10076514 3300025940 Unclassified 3016
238 Ga0207691_10210351 3300025940 Bacteria 1690
239 Ga0207691_10229812 3300025940 Unclassified 1607
240 Ga0207711_10024095 3300025941 Bacteria 5094
241 Ga0207711_10027374 3300025941 Bacteria 4788
242 Ga0207711_10486712 3300025941 Unclassified 1149
243 Ga0207689_10004543 3300025942 Bacteria 12559
244 Ga0207689_10262658 3300025942 Unclassified 1428
245 Ga0207679_10136169 3300025945 Unclassified 1978
246 Ga0207651_10016248 3300025960 Bacteria 4354
247 Ga0207651_10389890 3300025960 Bacteria 1182
248 Ga0207668_10123780 3300025972 Bacteria 1962
249 Ga0207668_10550329 3300025972 Unclassified 999
250 Ga0207658_10022329 3300025986 Unclassified 4406
251 Ga0207658_10167241 3300025986 Unclassified 1808
252 Ga0207658_10222778 3300025986 Unclassified 1588
253 Ga0207677_10051438 3300026023 Unclassified 2793
254 Ga0207677_10090895 3300026023 Bacteria 2219
255 Ga0207703_10004367 3300026035 Bacteria 11622
256 Ga0207703_10386204 3300026035 Unclassified 1296
257 Ga0207639_10003114 3300026041 Bacteria 11153
258 Ga0207708_10053658 3300026075 Unclassified 3072
259 Ga0207641_10014709 3300026088 Bacteria 6416
260 Ga0207641_10327147 3300026088 Bacteria 1455
261 Ga0207641_10338375 3300026088 Bacteria 1431
262 Ga0207648_10008065 3300026089 Bacteria 10262
263 Ga0207648_10044901 3300026089 Bacteria 3877
264 Ga0207648_10603136 3300026089 Bacteria 1012
265 Ga0207676_10011601 3300026095 Bacteria 6301
266 Ga0207676_10093628 3300026095 Bacteria 2474
267 Ga0207676_10166063 3300026095 Bacteria 1918
268 Ga0207676_10195480 3300026095 Unclassified 1783
269 Ga0207676_10263664 3300026095 Unclassified 1557
270 Ga0207676_10645174 3300026095 Unclassified 1021
271 Ga0207674_10016201 3300026116 Bacteria 8164
272 Ga0207675_100001203 3300026118 Bacteria 25766
273 Ga0207675_100005917 3300026118 Bacteria 11669
274 Ga0207675_100007834 3300026118 Bacteria 10080
275 Ga0207675_100842202 3300026118 Bacteria 932
276 Ga0207683_10000392 3300026121 Bacteria 40319
277 Ga0207683_10003275 3300026121 Bacteria 14115
278 Ga0207683_10259597 3300026121 Bacteria 1586
279 Ga0207698_10013351 3300026142 Bacteria 5416
280 Ga0207698_10572851 3300026142 Unclassified 1110
281 Ga0207428_10001341 3300027907 Bacteria 26195
282 Ga0268266_10084986 3300028379 Unclassified 2764
283 Ga0268265_10082410 3300028380 Unclassified 2544
284 Ga0268265_10166607 3300028380 Bacteria 1878
285 Ga0268265_10417475 3300028380 Bacteria 1245
286 Ga0268264_10039483 3300028381 Bacteria 3900
287 Ga0268264_10047846 3300028381 Bacteria 3556
288 Ga0268264_10090652 3300028381 Bacteria 2635
289 Ga0268264_10099565 3300028381 Unclassified 2523
290 Ga0268264_10359867 3300028381 Unclassified 1387
291 Ga0268264_10517897 3300028381 Unclassified 1165
292 Ga0265319_1003462 3300028563 Bacteria 8214
293 Ga0265318_10008144 3300028577 Bacteria 4685
294 Ga0265338_10044791 3300028800 Bacteria 4078
295 Ga0265332_10017806 3300031238 Bacteria 3135
296 Ga0265328_10010620 3300031239 Bacteria 3699
297 Ga0265320_10004596 3300031240 Bacteria 9021
298 Ga0265325_10005611 3300031241 Bacteria 7726
299 Ga0265325_10006923 3300031241 Bacteria 6843
300 Ga0265325_10015716 3300031241 Bacteria 4248
301 Ga0265340_10001555 3300031247 Bacteria 13173
302 Ga0265339_10000026 3300031249 Bacteria 165764
303 Ga0265339_10027426 3300031249 Bacteria 3251
304 Ga0265331_10012918 3300031250 Bacteria 4502
305 Ga0265331_10032614 3300031250 Bacteria 2580
306 Ga0265316_10012326 3300031344 Bacteria 7673
307 Ga0265316_10062698 3300031344 Unclassified 2885
308 Ga0265313_10006567 3300031595 Bacteria 8194
309 Ga0265313_10062080 3300031595 Bacteria 1746
310 Ga0265314_10065045 3300031711 Bacteria 2465
311 Ga0265314_10206008 3300031711 Bacteria 1158
312 Ga0265342_10000788 3300031712 Bacteria 31973
313 Ga0307410_10000268 3300031852 Bacteria 19964
314 Ga0307410_10085836 3300031852 Unclassified 2222
315 Ga0307406_10146808 3300031901 Unclassified 1677
316 Ga0307407_10009092 3300031903 Bacteria 4609
317 Ga0307409_100001661 3300031995 Bacteria 11172
318 Ga0307416_100063449 3300032002 Bacteria 3025
319 Ga0307416_100139912 3300032002 Unclassified 2198
320 Ga0307416_100357391 3300032002 Unclassified 1481
321 Ga0307414_10002197 3300032004 Bacteria 10181
322 Ga0307411_10352128 3300032005 Unclassified 1201
323 Ga0307415_100000642 3300032126 Bacteria 15355
324 Ga0373951_0002452 3300035091 Bacteria 4676
325 Ga0373931_0007415 3300035691 Bacteria 5166
326 Ga0373937_0003006 3300036401 Bacteria 14140
327 Ga0439460_0115932 3300042461 Bacteria 873
328 Ga0451577_0110631 3300042876 Unclassified 2457
329 Ga0453683_0015434 3300044673 Bacteria 4946
330 Ga0453683_0203259 3300044673 Bacteria 1258
331 Ga0453683_0432617 3300044673 Unclassified 850
332 Ga0453684_0030955 3300044712 Bacteria 7541
333 Ga0466959_0046246 3300045049 Unclassified 3203
334 Ga0451576_0067558 3300045051 Bacteria 3721
335 Ga0495629_0065373 3300046459 Unclassified 2539
336 Ga0495651_0180846 3300046462 Unclassified 1493
337 Ga0495630_0148217 3300046517 Unclassified 1785
338 Ga0495652_0024977 3300046529 Bacteria 5288
339 Ga0495665_0040307 3300046531 Bacteria 2487
340 Ga0495587_0205744 3300046536 Bacteria 1112
341 Ga0495598_0108136 3300046537 Unclassified 929
342 Ga0495645_0004403 3300046543 Bacteria 9622
343 Ga0495633_0082716 3300046558 Bacteria 1494
344 Ga0495635_0075027 3300046663 Bacteria 2317
345 Ga0495659_0026567 3300046664 Bacteria 1991
346 Ga0495623_0110502 3300046679 Unclassified 1666
347 Ga0495669_0074517 3300046684 Unclassified 1552
348 Ga0495669_0095291 3300046684 Unclassified 1378
349 Ga0495613_0179070 3300046689 Bacteria 1502
350 Ga0495600_0067213 3300046809 Unclassified 2343
351 Ga0495581_0024387 3300047315 Unclassified 3505
352 Ga0495604_0253875 3300047317 Unclassified 1198
353 Ga0495636_0094183 3300047318 Unclassified 1303
354 Ga0495674_0521701 3300047319 Bacteria 948
355 Ga0495684_0037261 3300047471 Unclassified 3730
356 Ga0495684_0069095 3300047471 Bacteria 2686
357 Ga0495602_0127048 3300048088 Bacteria 2041
358 Ga0496100_0041582 3300048903 Bacteria 2931
359 Ga0496101_0074596 3300048904 Bacteria 2495
360 Ga0496102_0205897 3300048905 Bacteria 1855
361 Ga0496104_0011381 3300048907 Bacteria 7964
362 Ga0496105_0187225 3300048908 Bacteria 1694
363 Ga0496107_0052104 3300048910 Bacteria 2952
364 Ga0496107_0098766 3300048910 Bacteria 2139
365 Ga0496108_0006002 3300048911 Bacteria 9836
366 Ga0496109_0001102 3300048912 Bacteria 22388
367 Ga0496111_0051291 3300048914 Bacteria 2978
368 Ga0496112_0000255 3300048915 Bacteria 34059
369 Ga0496113_0005819 3300048916 Bacteria 7735
370 Ga0496113_0224844 3300048916 Bacteria 1496
371 Ga0496115_0008820 3300048918 Bacteria 7472
372 Ga0496115_0186304 3300048918 Bacteria 1715
373 Ga0501298_003006 3300049521 Bacteria 2595
374 Ga0501038_0231689 3300049574 Bacteria 1470
375 Ga0501039_0397938 3300049575 Unclassified 1082
376 Ga0501040_0053141 3300049576 Bacteria 2774
377 Ga0501040_0056092 3300049576 Unclassified 2703
378 Ga0501041_0050333 3300049577 Bacteria 2539
379 Ga0501041_0187109 3300049577 Bacteria 1297
380 Ga0501046_0075425 3300049580 Bacteria 2615
381 Ga0501075_0168704 3300049591 Bacteria 1670
382 Ga0501076_0043815 3300049592 Bacteria 3528
383 Ga0501077_0032675 3300049593 Bacteria 3313
384 Ga0501077_0084822 3300049593 Bacteria 2007
385 Ga0501198_004059 3300049649 Unclassified 2023
386 Ga0501202_001588 3300049652 Bacteria 3671
387 Ga0501206_012523 3300049653 Unclassified 1152
388 Ga0501207_036754 3300049654 Unclassified 840
389 Ga0501233_041325 3300049668 Unclassified 1085
390 Ga0501235_010522 3300049669 Unclassified 2021
391 Ga0501243_005050 3300049675 Bacteria 1981
392 Ga0501259_050146 3300049688 Unclassified 845
393 Ga0501261_007793 3300049690 Bacteria 1377
394 Ga0501261_009160 3300049690 Bacteria 1289
395 Ga0501221_009701 3300049704 Unclassified 1695
396 Ga0501221_072396 3300049704 Unclassified 816
397 Ga0501079_0006130 3300049741 Bacteria 9016
398 Ga0501241_011991 3300049758 Bacteria 1574
399 Ga0501045_0009752 3300049824 Bacteria 6717
400 Ga0501045_0057725 3300049824 Bacteria 2841
401 Ga0501212_031354 3300049851 Unclassified 858
402 nmdc:mga05p37_55435_c1 3300050507 Bacteria 4878
403 nmdc:mga0qj67_44178_c1 3300050509 Bacteria 3510
404 nmdc:mga08y16_1137_c1 3300050511 Bacteria 26206
405 nmdc:mga0n895_16754_c1 3300050512 Bacteria 6735
406 nmdc:mga0n895_22681_c1 3300050512 Bacteria 5888
407 nmdc:mga0n895_39808_c1 3300050512 Bacteria 4564
408 nmdc:mga0n895_449112_c1 3300050512 Unclassified 1302
409 nmdc:mga0n895_604165_c1 3300050512 Bacteria 1099
410 nmdc:mga0rr50_14826_c1 3300050513 Bacteria 5128
411 nmdc:mga0rr50_366772_c1 3300050513 Unclassified 1213
412 nmdc:mga08x19_265817_c1 3300050514 Unclassified 1186
413 nmdc:mga08x19_34427_c1 3300050514 Bacteria 3201
414 nmdc:mga08x19_90877_c1 3300050514 Unclassified 2015
415 nmdc:mga0a205_139708_c1 3300050515 Bacteria 2323
416 nmdc:mga0a205_27800_c1 3300050515 Bacteria 5403
417 nmdc:mga0a205_290017_c1 3300050515 Bacteria 1511
418 nmdc:mga0a205_6562_c1 3300050515 Bacteria 10523
419 nmdc:mga0a205_827_c1 3300050515 Bacteria 25197
420 Ga0495601_0054888 3300053077 Unclassified 2521
421 Ga0501084_0024312 3300054114 Bacteria 5053
422 Ga0501084_0033672 3300054114 Bacteria 4286
423 Ga0530510_0308379 3300061734 Unclassified 1185
424 2791212276 2788500588 Bacteria 4584915
425 2819625889 2818991451 Bacteria 4697364
426 2852674067 2852673933 Bacteria 3347676
427 2904608219 2904606771 Bacteria 4684500
428 2919415601 2919414237 Bacteria 5429133
429 2928510672 2928510474 Bacteria 4815308
430 2936366626 2936361878 Bacteria 5632809
431 3001898485 3001892409 Bacteria 6328293
432 8055532970 8055531788 Bacteria 5249694
433 Ga0105248_10841581
434 MRS1b_contig_1773955
435 CNAas_1000531
436 JGI25406J46586_10045649
437 rootL2_10166353
438 Ga0065712_10000144
439 Ga0065715_10092089
440 Ga0065715_10107946
441 Ga0065715_10135525
442 Ga0065707_10098219
443 Ga0070676_10004323
444 Ga0070676_10025606
445 Ga0070676_10072484
446 Ga0070683_100142043
447 Ga0070690_100070055
448 Ga0070670_100023060
449 Ga0070670_100088040
450 Ga0068869_100021211
451 Ga0070666_10006151
452 Ga0068868_100212758
453 Ga0070692_10280974
454 Ga0070668_100124220
455 Ga0070668_100283013
456 Ga0070669_100027240
457 Ga0070675_100176786
458 Ga0070675_100189416
459 Ga0070671_100028346
460 Ga0070671_100061497
461 Ga0070671_100113887
462 Ga0070674_100082792
463 Ga0070674_100399543
464 Ga0070673_100432799
465 Ga0070688_100019669
466 Ga0070688_100036536
467 Ga0070667_100013504
468 Ga0070667_100029131
469 Ga0070667_100077237
470 Ga0070667_100077655
471 Ga0070667_100096807
472 Ga0070703_10003055
473 Ga0070709_10527880
474 Ga0070714_100163967
475 Ga0070711_100108452
476 Ga0070700_100034979
477 Ga0070694_100028178
478 Ga0070694_100103994
479 Ga0070694_100290606
480 Ga0070708_100001683
481 Ga0070678_100039435
482 Ga0070678_100223153
483 Ga0070678_100421679
484 Ga0070678_100562121
485 Ga0070662_100062118
486 Ga0070662_100300029
487 Ga0070662_100507423
488 Ga0068867_100124548
489 Ga0068867_100130267
490 Ga0068867_100161996
491 Ga0070685_10025766
492 Ga0070685_10144046
493 Ga0070706_100009094
494 Ga0070706_100013803
495 Ga0070706_100061936
496 Ga0070698_100005151
497 Ga0070698_100020960
498 Ga0070698_100047703
499 Ga0070698_100061208
500 Ga0070699_100000814
501 Ga0070699_100029625
502 Ga0070699_100062478
503 Ga0070684_100477634
504 Ga0070697_100005327
505 Ga0070697_100034131
506 Ga0070697_100051978
507 Ga0070697_100122402
508 Ga0070697_100135344
509 Ga0070672_100068700
510 Ga0070672_100234115
511 Ga0070695_100043991
512 Ga0070695_100130576
513 Ga0070696_100001106
514 Ga0070696_100003247
515 Ga0070693_100010664
516 Ga0070693_100068650
517 Ga0070665_100130477
518 Ga0070704_100178847
519 Ga0070704_100552148
520 Ga0068857_100011245
521 Ga0068852_100113708
522 Ga0068852_100634571
523 Ga0068852_100756422
524 Ga0068859_100012901
525 Ga0068859_100013245
526 Ga0068859_100023271
527 Ga0068859_100058917
528 Ga0068859_100094203
529 Ga0068859_100330301
530 Ga0068859_101073341
531 Ga0068864_100013274
532 Ga0068864_100058554
533 Ga0068861_100004002
534 Ga0068861_100009014
535 Ga0068861_100081665
536 Ga0068861_100175196
537 Ga0068861_100324131
538 Ga0068870_10007958
539 Ga0068870_10233253
540 Ga0068863_100040866
541 Ga0068863_100113581
542 Ga0068858_100068744
543 Ga0068860_100015249
544 Ga0068860_100106142
545 Ga0068860_100161231
546 Ga0068860_100453346
547 Ga0068862_100025036
548 Ga0081539_10005833
549 Ga0097621_100010358
550 Ga0097621_100188650
551 Ga0068871_100031750
552 Ga0068871_100055828
553 Ga0075428_100137954
554 Ga0075428_100762181
555 Ga0075430_100062215
556 Ga0075431_100151241
557 Ga0075433_10042267
558 Ga0075433_10050194
559 Ga0075433_10088904
560 Ga0075433_10096471
561 Ga0075434_100003693
562 Ga0075434_100004484
563 Ga0075434_100040243
564 Ga0075434_100047384
565 Ga0075434_100099293
566 Ga0068865_100044681
567 Ga0068865_100364975
568 Ga0075436_100104224
569 Ga0075436_100191052
570 Ga0097620_100012898
571 Ga0097620_100013245
572 Ga0097620_100023273
573 Ga0097620_100058917
574 Ga0097620_100094202
575 Ga0097620_100330293
576 Ga0097620_101073325
577 Ga0075435_100001131
578 Ga0075435_100358166
579 Ga0111539_10159491
580 Ga0111539_10651085
581 Ga0114129_10003007
582 Ga0114129_10412286
583 Ga0105243_10000578
584 Ga0105243_10004438
585 Ga0105243_10028725
586 Ga0105241_10000121
587 Ga0105241_10043199
588 Ga0105241_10167375
589 Ga0105241_10187649
590 Ga0105242_10001346
591 Ga0105242_10030986
592 Ga0105242_10153857
593 Ga0105242_10297155
594 Ga0105248_10014574
595 Ga0105248_10042884
596 Ga0105248_10099271
597 Ga0105237_10420939
598 Ga0105238_10019542
599 Ga0105238_10032179
600 Ga0105249_10032050
601 Ga0105239_10183918
602 Ga0105239_10191949
603 Ga0105246_10006819
604 Ga0105246_10066240
605 Ga0157369_10026371
606 Ga0157374_10007880
607 Ga0157374_10189377
608 Ga0157374_10855077
609 Ga0157378_10000001
610 Ga0157378_10050360
611 Ga0157378_10052652
612 Ga0163162_10015863
613 Ga0163162_10268542
614 Ga0163162_10529593
615 Ga0157372_10000541
616 Ga0157372_10038818
617 Ga0157372_10469007
618 Ga0157375_10023336
619 Ga0157375_10083575
620 Ga0157375_10201264
621 Ga0157375_10212079
622 Ga0157375_10398430
623 Ga0163163_10000243
624 Ga0163163_10049238
625 Ga0163163_10295906
626 Ga0163163_10529738
627 Ga0157380_10015139
628 Ga0157380_10053831
629 Ga0157379_10002528
630 Ga0157376_10040972
631 Ga0163161_10002937
632 Ga0209676_1010512
633 Ga0209676_1012095
634 Ga0209676_1022990
635 Ga0209676_1028676
636 Ga0209025_1016221
637 Ga0207697_10051572
638 Ga0207682_10001496
639 Ga0207680_10000506
640 Ga0207647_10057202
641 Ga0207699_10188389
642 Ga0207645_10238938
643 Ga0207684_10029961
644 Ga0207684_10048824
645 Ga0207684_10063916
646 Ga0207654_10000023
647 Ga0207663_10087231
648 Ga0207662_10017501
649 Ga0207646_10174952
650 Ga0207694_10001323
651 Ga0207650_10339685
652 Ga0207644_10085886
653 Ga0207644_10429670
654 Ga0207706_10008430
655 Ga0207706_10014714
656 Ga0207686_10001357
657 Ga0207686_10098817
658 Ga0207709_10004107
659 Ga0207709_10004124
660 Ga0207709_10026467
661 Ga0207670_10393414
662 Ga0207669_10252532
663 Ga0207704_10198290
664 Ga0207704_10246359
665 Ga0207665_10178160
666 Ga0207665_10464261
667 Ga0207691_10002530
668 Ga0207691_10008471
669 Ga0207691_10076514
670 Ga0207691_10210351
671 Ga0207691_10229812
672 Ga0207711_10024095
673 Ga0207711_10027374
674 Ga0207711_10486712
675 Ga0207689_10004543
676 Ga0207689_10262658
677 Ga0207679_10136169
678 Ga0207651_10016248
679 Ga0207651_10389890
680 Ga0207668_10123780
681 Ga0207668_10550329
682 Ga0207658_10022329
683 Ga0207658_10167241
684 Ga0207658_10222778
685 Ga0207677_10051438
686 Ga0207677_10090895
687 Ga0207703_10004367
688 Ga0207703_10386204
689 Ga0207639_10003114
690 Ga0207708_10053658
691 Ga0207641_10014709
692 Ga0207641_10327147
693 Ga0207641_10338375
694 Ga0207648_10008065
695 Ga0207648_10044901
696 Ga0207648_10603136
697 Ga0207676_10011601
698 Ga0207676_10093628
699 Ga0207676_10166063
700 Ga0207676_10195480
701 Ga0207676_10263664
702 Ga0207676_10645174
703 Ga0207674_10016201
704 Ga0207675_100001203
705 Ga0207675_100005917
706 Ga0207675_100007834
707 Ga0207675_100842202
708 Ga0207683_10000392
709 Ga0207683_10003275
710 Ga0207683_10259597
711 Ga0207698_10013351
712 Ga0207698_10572851
713 Ga0207428_10001341
714 Ga0268266_10084986
715 Ga0268265_10082410
716 Ga0268265_10166607
717 Ga0268265_10417475
718 Ga0268264_10039483
719 Ga0268264_10047846
720 Ga0268264_10090652
721 Ga0268264_10099565
722 Ga0268264_10359867
723 Ga0268264_10517897
724 Ga0265319_1003462
725 Ga0265318_10008144
726 Ga0265338_10044791
727 Ga0265332_10017806
728 Ga0265328_10010620
729 Ga0265320_10004596
730 Ga0265325_10005611
731 Ga0265325_10006923
732 Ga0265325_10015716
733 Ga0265340_10001555
734 Ga0265339_10000026
735 Ga0265339_10027426
736 Ga0265331_10012918
737 Ga0265331_10032614
738 Ga0265316_10012326
739 Ga0265316_10062698
740 Ga0265313_10006567
741 Ga0265313_10062080
742 Ga0265314_10065045
743 Ga0265314_10206008
744 Ga0265342_10000788
745 Ga0307410_10000268
746 Ga0307410_10085836
747 Ga0307406_10146808
748 Ga0307407_10009092
749 Ga0307409_100001661
750 Ga0307416_100063449
751 Ga0307416_100139912
752 Ga0307416_100357391
753 Ga0307414_10002197
754 Ga0307411_10352128
755 Ga0307415_100000642
756 Ga0373951_0002452
757 Ga0373931_0007415
758 Ga0373937_0003006
759 Ga0439460_0115932
760 Ga0451577_0110631
761 Ga0453683_0015434
762 Ga0453683_0203259
763 Ga0453683_0432617
764 Ga0453684_0030955
765 Ga0466959_0046246
766 Ga0451576_0067558
767 Ga0495629_0065373
768 Ga0495651_0180846
769 Ga0495630_0148217
770 Ga0495652_0024977
771 Ga0495665_0040307
772 Ga0495587_0205744
773 Ga0495598_0108136
774 Ga0495645_0004403
775 Ga0495633_0082716
776 Ga0495635_0075027
777 Ga0495659_0026567
778 Ga0495623_0110502
779 Ga0495669_0074517
780 Ga0495669_0095291
781 Ga0495613_0179070
782 Ga0495600_0067213
783 Ga0495581_0024387
784 Ga0495604_0253875
785 Ga0495636_0094183
786 Ga0495674_0521701
787 Ga0495684_0037261
788 Ga0495684_0069095
789 Ga0495602_0127048
790 Ga0496100_0041582
791 Ga0496101_0074596
792 Ga0496102_0205897
793 Ga0496104_0011381
794 Ga0496105_0187225
795 Ga0496107_0052104
796 Ga0496107_0098766
797 Ga0496108_0006002
798 Ga0496109_0001102
799 Ga0496111_0051291
800 Ga0496112_0000255
801 Ga0496113_0005819
802 Ga0496113_0224844
803 Ga0496115_0008820
804 Ga0496115_0186304
805 Ga0501298_003006
806 Ga0501038_0231689
807 Ga0501039_0397938
808 Ga0501040_0053141
809 Ga0501040_0056092
810 Ga0501041_0050333
811 Ga0501041_0187109
812 Ga0501046_0075425
813 Ga0501075_0168704
814 Ga0501076_0043815
815 Ga0501077_0032675
816 Ga0501077_0084822
817 Ga0501198_004059
818 Ga0501202_001588
819 Ga0501206_012523
820 Ga0501207_036754
821 Ga0501233_041325
822 Ga0501235_010522
823 Ga0501243_005050
824 Ga0501259_050146
825 Ga0501261_007793
826 Ga0501261_009160
827 Ga0501221_009701
828 Ga0501221_072396
829 Ga0501079_0006130
830 Ga0501241_011991
831 Ga0501045_0009752
832 Ga0501045_0057725
833 Ga0501212_031354
834 nmdc:mga05p37_55435_c1
835 nmdc:mga0qj67_44178_c1
836 nmdc:mga08y16_1137_c1
837 nmdc:mga0n895_16754_c1
838 nmdc:mga0n895_22681_c1
839 nmdc:mga0n895_39808_c1
840 nmdc:mga0n895_449112_c1
841 nmdc:mga0n895_604165_c1
842 nmdc:mga0rr50_14826_c1
843 nmdc:mga0rr50_366772_c1
844 nmdc:mga08x19_265817_c1
845 nmdc:mga08x19_34427_c1
846 nmdc:mga08x19_90877_c1
847 nmdc:mga0a205_139708_c1
848 nmdc:mga0a205_27800_c1
849 nmdc:mga0a205_290017_c1
850 nmdc:mga0a205_6562_c1
851 nmdc:mga0a205_827_c1
852 Ga0495601_0054888
853 Ga0501084_0024312
854 Ga0501084_0033672
855 Ga0530510_0308379
856 2791212276
857 2819625889
858 2852674067
859 2904608219
860 2919415601
861 2928510672
862 2936366626
863 3001898485
864 8055532970

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02274

ADI

Arginine deiminase

94

258

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1h70-assembly1.cif.gz_A ddah from pseudomonas aeruginosa. c249s mutant complexed with citrulline 0.9773 3 259
3bpb-assembly2.cif.gz_B crystal structure of the dimethylarginine dimethylaminohydrolase h162g adduct with s-methyl-l-thiocitrulline 0.9738 4 259
1h70-assembly1.cif.gz_A ddah from pseudomonas aeruginosa. c249s mutant complexed with citrulline 0.9736 3 259
3bpb-assembly2.cif.gz_B crystal structure of the dimethylarginine dimethylaminohydrolase h162g adduct with s-methyl-l-thiocitrulline 0.9701 4 259
3rhy-assembly2.cif.gz_B crystal structure of the dimethylarginine dimethylaminohydrolase adduct with 4-chloro-2-hydroxymethylpyridine 0.964 4 259
ID Description Score Start End Superfamily
3bpbA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9742 4 259 3.75.10.10
3bpbA00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.9704 4 259 3.75.10.10
af_E9AG92_3_283_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8895 7 259 3.75.10.10
2jajB00 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8835 4 259 3.75.10.10
af_A5PN62_6_283_3.75.10.10 Alpha Beta;5-stranded Propeller;L-arginine/glycine Amidinotransferase; Chain A;L-arginine/glycine Amidinotransferase; Chain A 0.8723 1 259 3.75.10.10
ID Description Score Start End GO Terms
AF-A0A838RYF2-F1-model_v4 N(G),N(G)-dimethylarginine dimethylaminohydrolase 0.997 4 259 GO:0000052
GO:0006525
GO:0016403
GO:0016597
GO:0045429
AF-A0A838RYF2-F1-model_v4 N(G),N(G)-dimethylarginine dimethylaminohydrolase 0.9932 4 259 GO:0000052
GO:0006525
GO:0016403
GO:0016597
GO:0045429
AF-A0A7V9FI58-F1-model_v4 N(G),N(G)-dimethylarginine dimethylaminohydrolase 0.9926 3 132 GO:0000052
GO:0006525
GO:0016403
GO:0016597
GO:0045429
AF-A0A6N7MHA4-F1-model_v4 Dimethylargininase 0.9921 4 137 GO:0000052
GO:0006525
GO:0016403
GO:0016597
GO:0045429
AF-A0A538TTE5-F1-model_v4 N(G),N(G)-dimethylarginine dimethylaminohydrolase 0.9917 2 259 GO:0000052
GO:0006525
GO:0016403
GO:0016597
GO:0045429

Map