F442528

General Info

Members Datasets Scaffolds Average Seq Length
432 228 864 322

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100118033|Ga0068868_1001180333
Length 347
Sequence VLPYVLKRLAWAVVVFIAVTFSTYVLFFVIPTNRPGNSNVQGRDITTSVNQATGIHGPVWHEYGVFLWRIVTVQSLGRSTTSREEVNAELKRAAPITASVIFGGAVFWMLVSIPIGILSALRPRSLLDRATMLFVLIGISVHPIWLGLILVYVFGHKLNMFPLGGYCDFFYAGKSEICGGPRQWAYHLILPWITFGMLFAALYVRMIRASVRETLDNDYVMTARAKGASELRVVRNHVLKNAFLPVITMLGMDISIAFGGSVFVETVFGLPGIGRLAVRSLQRQDLPPLMGIIVLVTLAILIFNLVVDLLYAWLDPRIGTSPRGLDEEDRAQLGKARAEPSAKPMRA

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
129 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
130 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
131 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
132 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
135 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
136 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
137 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
140 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
141 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
146 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
161 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
169 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
183 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
192 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
193 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.59
Metatranscriptomes 7.41
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.19
Rhizosphere 86.34
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100118033 3300005338 Bacteria 2162
2 Ga0006759J45824_1006222 3300003163 Bacteria 3363
3 Ga0032354_1061319 3300003693 Bacteria 1491
4 Ga0058861_10138811 3300004800 Bacteria 1990
5 Ga0058861_11987260 3300004800 Bacteria 1670
6 Ga0058860_12039236 3300004801 Bacteria 1104
7 Ga0058862_10245376 3300004803 Bacteria 1454
8 Ga0058862_10278802 3300004803 Bacteria 2091
9 Ga0070658_10179240 3300005327 Bacteria 1782
10 Ga0070683_100001510 3300005329 Bacteria 17967
11 Ga0070683_100066120 3300005329 Bacteria 3367
12 Ga0070683_100068968 3300005329 Bacteria 3295
13 Ga0070683_100113697 3300005329 Bacteria 2555
14 Ga0070683_100150029 3300005329 Bacteria 2210
15 Ga0070683_100309997 3300005329 Bacteria 1502
16 Ga0070690_100160284 3300005330 Bacteria 1541
17 Ga0070677_10033504 3300005333 Bacteria 1978
18 Ga0068869_100157437 3300005334 Bacteria 1766
19 Ga0070680_100064158 3300005336 Bacteria 3010
20 Ga0070680_100182165 3300005336 Bacteria 1769
21 Ga0070682_100020791 3300005337 Bacteria 3866
22 Ga0070682_100077609 3300005337 Bacteria 2141
23 Ga0068868_100309745 3300005338 Bacteria 1343
24 Ga0070660_100065772 3300005339 Bacteria 2822
25 Ga0070691_10114174 3300005341 Bacteria 1354
26 Ga0070668_100011671 3300005347 Bacteria 6540
27 Ga0070675_100077114 3300005354 Bacteria 2773
28 Ga0070674_100076799 3300005356 Bacteria 2376
29 Ga0070674_100225471 3300005356 Bacteria 1460
30 Ga0070673_100163627 3300005364 Bacteria 1894
31 Ga0070659_100141867 3300005366 Bacteria 1956
32 Ga0070709_10048186 3300005434 Bacteria 2658
33 Ga0070714_100032723 3300005435 Bacteria 4343
34 Ga0070714_100234512 3300005435 Bacteria 1692
35 Ga0070714_100277029 3300005435 Bacteria 1557
36 Ga0070713_100018394 3300005436 Bacteria 5311
37 Ga0070713_100034538 3300005436 Bacteria 4064
38 Ga0070710_10028290 3300005437 Bacteria 2997
39 Ga0070701_10123180 3300005438 Bacteria 1464
40 Ga0070705_100008917 3300005440 Bacteria 4973
41 Ga0070708_100007576 3300005445 Bacteria 8689
42 Ga0070708_100198426 3300005445 Bacteria 1878
43 Ga0070663_100027427 3300005455 Bacteria 3868
44 Ga0070663_100171551 3300005455 Bacteria 1677
45 Ga0070678_100112917 3300005456 Bacteria 2129
46 Ga0070678_100146433 3300005456 Bacteria 1897
47 Ga0070678_100204479 3300005456 Bacteria 1632
48 Ga0070678_100348959 3300005456 Bacteria 1272
49 Ga0070662_100026086 3300005457 Bacteria 4044
50 Ga0070685_10009626 3300005466 Bacteria 5000
51 Ga0070706_100010699 3300005467 Bacteria 8517
52 Ga0070707_100247172 3300005468 Bacteria 1736
53 Ga0070698_100012688 3300005471 Bacteria 8918
54 Ga0070679_100002123 3300005530 Bacteria 17863
55 Ga0070679_100008591 3300005530 Bacteria 9627
56 Ga0070679_100087776 3300005530 Bacteria 3097
57 Ga0070679_100392606 3300005530 Bacteria 1334
58 Ga0070684_100003704 3300005535 Bacteria 11534
59 Ga0070684_100137484 3300005535 Bacteria 2208
60 Ga0070684_100221143 3300005535 Bacteria 1728
61 Ga0070684_100279031 3300005535 Bacteria 1531
62 Ga0070684_100396015 3300005535 Bacteria 1273
63 Ga0070672_100017138 3300005543 Bacteria 5208
64 Ga0070672_100108901 3300005543 Bacteria 2256
65 Ga0070686_100026968 3300005544 Bacteria 3472
66 Ga0070696_100024115 3300005546 Bacteria 4135
67 Ga0070696_100169705 3300005546 Bacteria 1612
68 Ga0070693_100002806 3300005547 Bacteria 8015
69 Ga0070693_100003748 3300005547 Bacteria 7115
70 Ga0070693_100014993 3300005547 Bacteria 3984
71 Ga0070665_100160684 3300005548 Bacteria 2249
72 Ga0070704_100039300 3300005549 Bacteria 3247
73 Ga0068855_100049567 3300005563 Bacteria 4953
74 Ga0068857_100019940 3300005577 Bacteria 5893
75 Ga0068856_100048801 3300005614 Bacteria 4173
76 Ga0068856_100064950 3300005614 Bacteria 3606
77 Ga0068856_100160213 3300005614 Bacteria 2260
78 Ga0070702_100073000 3300005615 Bacteria 2032
79 Ga0070702_100212641 3300005615 Bacteria 1288
80 Ga0068861_100005908 3300005719 Bacteria 8318
81 Ga0068858_100113312 3300005842 Bacteria 2533
82 Ga0068860_100038237 3300005843 Bacteria 4591
83 Ga0081455_10012610 3300005937 Bacteria 8423
84 Ga0081455_10029827 3300005937 Bacteria 4968
85 Ga0081455_10130992 3300005937 Bacteria 1961
86 Ga0081455_10150164 3300005937 Bacteria 1797
87 Ga0081540_1002231 3300005983 Bacteria 15956
88 Ga0081539_10008907 3300005985 Bacteria 8562
89 Ga0070717_10029365 3300006028 Bacteria 4410
90 Ga0070717_10046187 3300006028 Bacteria 3563
91 Ga0075432_10001507 3300006058 Bacteria 7612
92 Ga0070715_10000550 3300006163 Bacteria 9866
93 Ga0070712_100064812 3300006175 Bacteria 2592
94 Ga0070712_100188190 3300006175 Bacteria 1613
95 Ga0097621_100012477 3300006237 Bacteria 6302
96 Ga0068871_100029943 3300006358 Bacteria 4281
97 Ga0068871_100156034 3300006358 Bacteria 1949
98 Ga0075428_100011702 3300006844 Bacteria 9767
99 Ga0075433_10355220 3300006852 Unclassified 1295
100 Ga0075434_100104000 3300006871 Bacteria 2849
101 Ga0075434_100120501 3300006871 Bacteria 2639
102 Ga0075434_100294429 3300006871 Bacteria 1643
103 Ga0068865_100036295 3300006881 Bacteria 3322
104 Ga0068865_100100920 3300006881 Bacteria 2112
105 Ga0068865_100205162 3300006881 Bacteria 1533
106 Ga0075436_100011892 3300006914 Bacteria 5972
107 Ga0075435_100022062 3300007076 Bacteria 4908
108 Ga0105245_10028115 3300009098 Bacteria 4956
109 Ga0105245_10048648 3300009098 Bacteria 3793
110 Ga0105245_10066102 3300009098 Bacteria 3272
111 Ga0105245_10073569 3300009098 Bacteria 3108
112 Ga0105245_10212084 3300009098 Bacteria 1864
113 Ga0105245_10376902 3300009098 Bacteria 1412
114 Ga0114129_10002400 3300009147 Bacteria 26030
115 Ga0114129_10098243 3300009147 Bacteria 4052
116 Ga0114129_10110849 3300009147 Bacteria 3788
117 Ga0114129_10230821 3300009147 Bacteria 2492
118 Ga0114129_10570453 3300009147 Bacteria 1469
119 Ga0105243_10005903 3300009148 Bacteria 9486
120 Ga0105243_10009914 3300009148 Bacteria 7244
121 Ga0105243_10085375 3300009148 Bacteria 2587
122 Ga0105243_10093903 3300009148 Bacteria 2476
123 Ga0105241_10006102 3300009174 Bacteria 8882
124 Ga0105241_10109820 3300009174 Bacteria 2206
125 Ga0105242_10014048 3300009176 Bacteria 6196
126 Ga0105242_10016601 3300009176 Bacteria 5726
127 Ga0105242_10084884 3300009176 Bacteria 2654
128 Ga0105248_10300820 3300009177 Bacteria 1806
129 Ga0105248_10378151 3300009177 Bacteria 1594
130 Ga0105238_10231983 3300009551 Bacteria 1822
131 Ga0105249_10043931 3300009553 Bacteria 4064
132 Ga0105249_10081112 3300009553 Bacteria 3015
133 Ga0105249_10087710 3300009553 Bacteria 2904
134 Ga0105239_10144598 3300010375 Bacteria 2651
135 Ga0105239_10169041 3300010375 Bacteria 2445
136 Ga0105246_10108556 3300011119 Bacteria 2034
137 Ga0105246_10239547 3300011119 Bacteria 1433
138 Ga0157342_1000645 3300012507 Bacteria 2244
139 Ga0157373_10123359 3300013100 Bacteria 1821
140 Ga0157369_10394211 3300013105 Bacteria 1436
141 Ga0157374_10564848 3300013296 Bacteria 1146
142 Ga0163162_10361046 3300013306 Bacteria 1586
143 Ga0157372_10279317 3300013307 Bacteria 1941
144 Ga0157372_10335147 3300013307 Bacteria 1762
145 Ga0163163_10071677 3300014325 Bacteria 3453
146 Ga0163163_10163524 3300014325 Bacteria 2271
147 Ga0157380_10011807 3300014326 Bacteria 6316
148 Ga0157377_10035053 3300014745 Bacteria 2750
149 Ga0157376_10036535 3300014969 Bacteria 3980
150 Ga0163161_10170931 3300017792 Bacteria 1662
151 Ga0206350_10199885 3300020080 Bacteria 1755
152 Ga0207692_10239405 3300025898 Bacteria 1083
153 Ga0207688_10017473 3300025901 Bacteria 3898
154 Ga0207688_10050186 3300025901 Bacteria 2335
155 Ga0207685_10001743 3300025905 Bacteria 4727
156 Ga0207699_10029940 3300025906 Bacteria 3041
157 Ga0207684_10061261 3300025910 Bacteria 3196
158 Ga0207707_10205871 3300025912 Bacteria 1715
159 Ga0207693_10053901 3300025915 Bacteria 3155
160 Ga0207663_10012486 3300025916 Bacteria 4593
161 Ga0207663_10030113 3300025916 Bacteria 3197
162 Ga0207660_10009492 3300025917 Bacteria 6298
163 Ga0207657_10120930 3300025919 Bacteria 2154
164 Ga0207652_10032380 3300025921 Bacteria 4395
165 Ga0207652_10293646 3300025921 Bacteria 1467
166 Ga0207694_10121151 3300025924 Bacteria 2089
167 Ga0207694_10181708 3300025924 Bacteria 1706
168 Ga0207659_10138843 3300025926 Bacteria 1884
169 Ga0207687_10151612 3300025927 Bacteria 1769
170 Ga0207687_10181346 3300025927 Bacteria 1632
171 Ga0207687_10412777 3300025927 Bacteria 1113
172 Ga0207700_10028974 3300025928 Bacteria 3902
173 Ga0207700_10029815 3300025928 Bacteria 3854
174 Ga0207700_10405623 3300025928 Bacteria 1195
175 Ga0207664_10014696 3300025929 Bacteria 5663
176 Ga0207664_10030682 3300025929 Bacteria 4107
177 Ga0207664_10131296 3300025929 Bacteria 2109
178 Ga0207664_10379643 3300025929 Bacteria 1254
179 Ga0207706_10044858 3300025933 Bacteria 3917
180 Ga0207686_10027346 3300025934 Bacteria 3339
181 Ga0207686_10199264 3300025934 Bacteria 1433
182 Ga0207709_10018701 3300025935 Bacteria 3886
183 Ga0207669_10098446 3300025937 Bacteria 1926
184 Ga0207704_10024404 3300025938 Bacteria 3279
185 Ga0207704_10063827 3300025938 Bacteria 2298
186 Ga0207665_10001170 3300025939 Bacteria 17632
187 Ga0207691_10074547 3300025940 Bacteria 3060
188 Ga0207711_10100253 3300025941 Bacteria 2561
189 Ga0207661_10000234 3300025944 Bacteria 36435
190 Ga0207661_10034670 3300025944 Bacteria 3928
191 Ga0207661_10051283 3300025944 Bacteria 3291
192 Ga0207661_10054910 3300025944 Bacteria 3192
193 Ga0207661_10102819 3300025944 Bacteria 2403
194 Ga0207679_10011009 3300025945 Bacteria 5837
195 Ga0207667_10167273 3300025949 Bacteria 2260
196 Ga0207712_10089933 3300025961 Bacteria 2258
197 Ga0207668_10111883 3300025972 Bacteria 2050
198 Ga0207677_10021194 3300026023 Bacteria 3965
199 Ga0207678_10076001 3300026067 Bacteria 2876
200 Ga0207708_10018074 3300026075 Bacteria 5305
201 Ga0207702_10008976 3300026078 Bacteria 8422
202 Ga0207702_10017150 3300026078 Bacteria 5990
203 Ga0207676_10064943 3300026095 Bacteria 2905
204 Ga0207674_10003353 3300026116 Bacteria 19653
205 Ga0207674_10040202 3300026116 Bacteria 4847
206 Ga0207674_10192282 3300026116 Bacteria 1991
207 Ga0207674_10321807 3300026116 Bacteria 1496
208 Ga0207675_100000962 3300026118 Bacteria 28741
209 Ga0207683_10006570 3300026121 Bacteria 9957
210 Ga0207683_10021262 3300026121 Bacteria 5552
211 Ga0207683_10037286 3300026121 Bacteria 4233
212 Ga0207683_10048934 3300026121 Bacteria 3699
213 Ga0207683_10112909 3300026121 Bacteria 2434
214 Ga0207683_10235259 3300026121 Bacteria 1671
215 Ga0207428_10002378 3300027907 Bacteria 18783
216 Ga0207428_10131834 3300027907 Bacteria 1912
217 Ga0265338_10109794 3300028800 Bacteria 2225
218 Ga0307409_100137707 3300031995 Bacteria 2098
219 Ga0307415_100183191 3300032126 Bacteria 1645
220 Ga0373930_0005123 3300034816 Bacteria 2165
221 Ga0373948_0023874 3300034817 Bacteria 1189
222 Ga0373948_0033687 3300034817 Bacteria 1044
223 Ga0373928_0005978 3300035084 Bacteria 2332
224 Ga0373940_0072125 3300035088 Bacteria 1007
225 Ga0373944_0000513 3300035089 Bacteria 9049
226 Ga0373955_0157738 3300035172 Bacteria 1338
227 Ga0373961_0051504 3300035241 Bacteria 1222
228 Ga0373962_0022614 3300035242 Bacteria 1668
229 Ga0373931_0003025 3300035691 Bacteria 7510
230 Ga0373947_0153736 3300035725 Bacteria 1483
231 Ga0373925_0400249 3300037068 Bacteria 1120
232 Ga0395899_0000945 3300037312 Bacteria 27227
233 Ga0395899_0008425 3300037312 Bacteria 7940
234 Ga0395899_0024443 3300037312 Bacteria 4567
235 Ga0395899_0097188 3300037312 Bacteria 2129
236 Ga0395899_0149391 3300037312 Bacteria 1657
237 Ga0395899_0182095 3300037312 Bacteria 1474
238 Ga0395900_0002004 3300037418 Bacteria 22980
239 Ga0395900_0005240 3300037418 Bacteria 13603
240 Ga0395900_0007518 3300037418 Bacteria 11260
241 Ga0395900_0015483 3300037418 Bacteria 7774
242 Ga0395900_0016323 3300037418 Bacteria 7569
243 Ga0395900_0128657 3300037418 Bacteria 2596
244 Ga0395900_0190813 3300037418 Bacteria 2078
245 Ga0395898_0004108 3300037466 Bacteria 15959
246 Ga0395898_0005290 3300037466 Bacteria 13956
247 Ga0395898_0005707 3300037466 Bacteria 13412
248 Ga0395898_0014791 3300037466 Bacteria 8010
249 Ga0395898_0039277 3300037466 Bacteria 4685
250 Ga0395898_0040868 3300037466 Bacteria 4583
251 Ga0395898_0073077 3300037466 Bacteria 3312
252 Ga0395898_0078433 3300037466 Bacteria 3187
253 Ga0395898_0096424 3300037466 Bacteria 2841
254 Ga0395898_0098702 3300037466 Bacteria 2804
255 Ga0395898_0185479 3300037466 Bacteria 1988
256 Ga0395905_0001706 3300037471 Bacteria 25818
257 Ga0395905_0004416 3300037471 Bacteria 14628
258 Ga0395905_0025009 3300037471 Bacteria 5632
259 Ga0395905_0031104 3300037471 Bacteria 5026
260 Ga0395905_0116493 3300037471 Bacteria 2511
261 Ga0395905_0244007 3300037471 Bacteria 1678
262 Ga0395905_0284012 3300037471 Bacteria 1541
263 Ga0395905_0405284 3300037471 Bacteria 1259
264 Ga0395905_0471088 3300037471 Bacteria 1155
265 Ga0395901_0001467 3300038443 Bacteria 24537
266 Ga0395901_0003164 3300038443 Bacteria 16560
267 Ga0395901_0006646 3300038443 Bacteria 11685
268 Ga0395901_0008218 3300038443 Bacteria 10543
269 Ga0395901_0016209 3300038443 Bacteria 7590
270 Ga0395901_0019118 3300038443 Bacteria 7005
271 Ga0395901_0032733 3300038443 Bacteria 5363
272 Ga0395901_0037162 3300038443 Bacteria 5037
273 Ga0395901_0050076 3300038443 Bacteria 4341
274 Ga0395901_0071497 3300038443 Bacteria 3616
275 Ga0395901_0129314 3300038443 Bacteria 2654
276 Ga0395901_0231572 3300038443 Bacteria 1928
277 Ga0395901_0445768 3300038443 Bacteria 1324
278 Ga0395901_0647488 3300038443 Bacteria 1060
279 Ga0436363_0664339 3300039450 Bacteria 1644
280 Ga0439455_0007013 3300042012 Bacteria 2368
281 Ga0439464_0032018 3300042439 Bacteria 1477
282 Ga0466966_0003532 3300044684 Bacteria 10319
283 Ga0466963_0016408 3300044694 Bacteria 4606
284 Ga0466963_0074371 3300044694 Bacteria 2291
285 Ga0466971_0073617 3300044719 Bacteria 1553
286 Ga0466957_0180679 3300044842 Bacteria 1378
287 Ga0466959_0120356 3300045049 Bacteria 1867
288 Ga0466959_0127413 3300045049 Bacteria 1806
289 Ga0466959_0236856 3300045049 Bacteria 1262
290 Ga0451576_0022598 3300045051 Bacteria 6817
291 Ga0466967_0019319 3300045976 Bacteria 5475
292 Ga0466967_0113825 3300045976 Bacteria 2490
293 Ga0466967_0158114 3300045976 Bacteria 2125
294 Ga0466967_0250167 3300045976 Bacteria 1693
295 Ga0495603_0002142 3300046455 Bacteria 11618
296 Ga0495603_0072310 3300046455 Bacteria 2026
297 Ga0495603_0131131 3300046455 Bacteria 1459
298 Ga0495641_0001263 3300046461 Bacteria 21723
299 Ga0495651_0273856 3300046462 Bacteria 1143
300 Ga0495653_0079899 3300046463 Bacteria 2421
301 Ga0495580_0198124 3300046472 Bacteria 1384
302 Ga0495582_0217315 3300046473 Bacteria 1093
303 Ga0495605_0095418 3300046474 Bacteria 1373
304 Ga0495639_0057378 3300046475 Bacteria 1779
305 Ga0495584_0108873 3300046491 Bacteria 1401
306 Ga0495585_0042431 3300046492 Bacteria 2548
307 Ga0495594_0066701 3300046499 Bacteria 1997
308 Ga0495594_0107240 3300046499 Bacteria 1573
309 Ga0495608_0133419 3300046511 Bacteria 1588
310 Ga0495618_0154466 3300046514 Bacteria 1465
311 Ga0495630_0014121 3300046517 Bacteria 5814
312 Ga0495630_0228072 3300046517 Bacteria 1423
313 Ga0495663_0034601 3300046525 Bacteria 1514
314 Ga0495652_0059305 3300046529 Bacteria 3238
315 Ga0495586_0084477 3300046535 Bacteria 1747
316 Ga0495667_0168993 3300046559 Bacteria 1405
317 Ga0495656_0042792 3300046615 Bacteria 1898
318 Ga0495635_0030561 3300046663 Bacteria 3743
319 Ga0495588_0017939 3300046674 Bacteria 3446
320 Ga0495588_0039142 3300046674 Bacteria 2414
321 Ga0495588_0151009 3300046674 Bacteria 1228
322 Ga0495657_0110290 3300046675 Bacteria 1744
323 Ga0495647_0030148 3300046681 Bacteria 2011
324 Ga0495658_0088049 3300046683 Bacteria 1834
325 Ga0495658_0149115 3300046683 Bacteria 1435
326 Ga0495613_0173991 3300046689 Bacteria 1527
327 Ga0495613_0236858 3300046689 Bacteria 1277
328 Ga0495604_0145686 3300047317 Bacteria 1688
329 Ga0495674_0113204 3300047319 Bacteria 2298
330 Ga0495674_0405121 3300047319 Bacteria 1101
331 Ga0495676_0023074 3300047321 Bacteria 5405
332 Ga0495676_0038403 3300047321 Bacteria 3976
333 Ga0495676_0076322 3300047321 Bacteria 2559
334 Ga0495684_0375431 3300047471 Bacteria 1004
335 Ga0496100_0039912 3300048903 Bacteria 2983
336 Ga0496100_0114315 3300048903 Bacteria 1880
337 Ga0496100_0133790 3300048903 Bacteria 1749
338 Ga0496100_0223501 3300048903 Bacteria 1383
339 Ga0496101_0019863 3300048904 Bacteria 4594
340 Ga0496101_0197176 3300048904 Bacteria 1556
341 Ga0496101_0272838 3300048904 Bacteria 1321
342 Ga0496101_0323941 3300048904 Bacteria 1209
343 Ga0496102_0030062 3300048905 Bacteria 4861
344 Ga0496102_0094476 3300048905 Bacteria 2770
345 Ga0496102_0412945 3300048905 Bacteria 1268
346 Ga0496103_0003231 3300048906 Bacteria 10002
347 Ga0496103_0019849 3300048906 Bacteria 4035
348 Ga0496104_0002455 3300048907 Bacteria 15969
349 Ga0496104_0002572 3300048907 Bacteria 15644
350 Ga0496104_0011658 3300048907 Bacteria 7881
351 Ga0496104_0038214 3300048907 Bacteria 4491
352 Ga0496104_0250364 3300048907 Bacteria 1684
353 Ga0496105_0004509 3300048908 Bacteria 10484
354 Ga0496105_0006973 3300048908 Bacteria 8707
355 Ga0496105_0029912 3300048908 Bacteria 4459
356 Ga0496105_0058975 3300048908 Bacteria 3167
357 Ga0496105_0104424 3300048908 Bacteria 2340
358 Ga0496105_0382129 3300048908 Bacteria 1120
359 Ga0496106_0009055 3300048909 Bacteria 7359
360 Ga0496106_0072761 3300048909 Bacteria 2629
361 Ga0496106_0202460 3300048909 Bacteria 1580
362 Ga0496107_0023961 3300048910 Bacteria 4315
363 Ga0496107_0189761 3300048910 Bacteria 1527
364 Ga0496108_0009601 3300048911 Bacteria 7842
365 Ga0496108_0045840 3300048911 Bacteria 3651
366 Ga0496108_0165599 3300048911 Bacteria 1911
367 Ga0496108_0196661 3300048911 Bacteria 1749
368 Ga0496108_0299608 3300048911 Bacteria 1400
369 Ga0496109_0000274 3300048912 Bacteria 49298
370 Ga0496109_0026911 3300048912 Bacteria 5130
371 Ga0496109_0028815 3300048912 Bacteria 4970
372 Ga0496109_0158347 3300048912 Bacteria 2121
373 Ga0496109_0508219 3300048912 Bacteria 1137
374 Ga0496110_0001327 3300048913 Bacteria 17778
375 Ga0496110_0046141 3300048913 Bacteria 3811
376 Ga0496110_0177312 3300048913 Bacteria 1935
377 Ga0496110_0244385 3300048913 Bacteria 1633
378 Ga0496111_0009503 3300048914 Bacteria 6495
379 Ga0496111_0029548 3300048914 Bacteria 3893
380 Ga0496112_0013091 3300048915 Bacteria 7653
381 Ga0496112_0031100 3300048915 Bacteria 5173
382 Ga0496112_0040550 3300048915 Bacteria 4553
383 Ga0496113_0027130 3300048916 Bacteria 4101
384 Ga0496113_0132115 3300048916 Bacteria 1960
385 Ga0496113_0405981 3300048916 Bacteria 1094
386 Ga0496114_0005189 3300048917 Bacteria 10166
387 Ga0496114_0006123 3300048917 Bacteria 9465
388 Ga0496114_0027946 3300048917 Bacteria 4625
389 Ga0496114_0041667 3300048917 Bacteria 3806
390 Ga0496114_0194647 3300048917 Bacteria 1774
391 Ga0496115_0011875 3300048918 Bacteria 6541
392 Ga0501069_0017145 3300049585 Bacteria 3894
393 nmdc:mga05p37_135839_c1 3300050507 Bacteria 3016
394 nmdc:mga05p37_68933_c1 3300050507 Bacteria 4350
395 nmdc:mga08y16_296767_c1 3300050511 Bacteria 1666
396 nmdc:mga08y16_63924_c1 3300050511 Bacteria 3844
397 nmdc:mga08y16_86270_c1 3300050511 Bacteria 3271
398 nmdc:mga0n895_14697_c1 3300050512 Bacteria 7119
399 nmdc:mga0rr50_35581_c1 3300050513 Bacteria 3578
400 nmdc:mga0rr50_56715_c1 3300050513 Bacteria 2928
401 nmdc:mga08x19_80526_c1 3300050514 Bacteria 2137
402 nmdc:mga0a205_127526_c1 3300050515 Bacteria 2444
403 nmdc:mga0a205_478988_c1 3300050515 Bacteria 1103
404 nmdc:mga0a205_71792_c1 3300050515 Bacteria 3343
405 Ga0495612_0035550 3300053078 Bacteria 2020
406 Ga0495595_0082212 3300053084 Bacteria 1536
407 Ga0495619_0017521 3300053085 Bacteria 4536
408 Ga0587066_009615 3300059490 Bacteria 1374
409 Ga0587066_012319 3300059490 Bacteria 1274
410 Ga0587070_006064 3300059491 Unclassified 1613
411 Ga0587073_0001156 3300059492 Bacteria 2936
412 Ga0587073_0001187 3300059492 Bacteria 2918
413 Ga0587077_000974 3300059493 Bacteria 2856
414 Ga0587080_002974 3300059503 Bacteria 2063
415 Ga0587082_003090 3300059504 Bacteria 1962
416 Ga0587082_005046 3300059504 Bacteria 1695
417 Ga0587083_0001195 3300059505 Bacteria 2821
418 Ga0587085_000408 3300059506 Bacteria 3115
419 Ga0587125_007401 3300059607 Bacteria 1063
420 Ga0587128_002089 3300059630 Bacteria 2026
421 Ga0587067_001072 3300059640 Bacteria 2813
422 Ga0587069_000244 3300059642 Bacteria 3676
423 Ga0587072_001107 3300059643 Bacteria 3177
424 Ga0587075_013121 3300059644 Bacteria 1135
425 Ga0587078_005698 3300059646 Bacteria 1337
426 Ga0587079_000394 3300059647 Bacteria 3720
427 Ga0587079_003127 3300059647 Bacteria 2125
428 Ga0587079_023554 3300059647 Bacteria 1128
429 Ga0587107_013942 3300059652 Bacteria 1027
430 Ga0587071_012804 3300060344 Bacteria 1436
431 Ga0587111_0031038 3300060346 Bacteria 1091
432 Ga0530510_0102010 3300061734 Bacteria 2098
433 Ga0068868_100118033
434 Ga0006759J45824_1006222
435 Ga0032354_1061319
436 Ga0058861_10138811
437 Ga0058861_11987260
438 Ga0058860_12039236
439 Ga0058862_10245376
440 Ga0058862_10278802
441 Ga0070658_10179240
442 Ga0070683_100001510
443 Ga0070683_100066120
444 Ga0070683_100068968
445 Ga0070683_100113697
446 Ga0070683_100150029
447 Ga0070683_100309997
448 Ga0070690_100160284
449 Ga0070677_10033504
450 Ga0068869_100157437
451 Ga0070680_100064158
452 Ga0070680_100182165
453 Ga0070682_100020791
454 Ga0070682_100077609
455 Ga0068868_100309745
456 Ga0070660_100065772
457 Ga0070691_10114174
458 Ga0070668_100011671
459 Ga0070675_100077114
460 Ga0070674_100076799
461 Ga0070674_100225471
462 Ga0070673_100163627
463 Ga0070659_100141867
464 Ga0070709_10048186
465 Ga0070714_100032723
466 Ga0070714_100234512
467 Ga0070714_100277029
468 Ga0070713_100018394
469 Ga0070713_100034538
470 Ga0070710_10028290
471 Ga0070701_10123180
472 Ga0070705_100008917
473 Ga0070708_100007576
474 Ga0070708_100198426
475 Ga0070663_100027427
476 Ga0070663_100171551
477 Ga0070678_100112917
478 Ga0070678_100146433
479 Ga0070678_100204479
480 Ga0070678_100348959
481 Ga0070662_100026086
482 Ga0070685_10009626
483 Ga0070706_100010699
484 Ga0070707_100247172
485 Ga0070698_100012688
486 Ga0070679_100002123
487 Ga0070679_100008591
488 Ga0070679_100087776
489 Ga0070679_100392606
490 Ga0070684_100003704
491 Ga0070684_100137484
492 Ga0070684_100221143
493 Ga0070684_100279031
494 Ga0070684_100396015
495 Ga0070672_100017138
496 Ga0070672_100108901
497 Ga0070686_100026968
498 Ga0070696_100024115
499 Ga0070696_100169705
500 Ga0070693_100002806
501 Ga0070693_100003748
502 Ga0070693_100014993
503 Ga0070665_100160684
504 Ga0070704_100039300
505 Ga0068855_100049567
506 Ga0068857_100019940
507 Ga0068856_100048801
508 Ga0068856_100064950
509 Ga0068856_100160213
510 Ga0070702_100073000
511 Ga0070702_100212641
512 Ga0068861_100005908
513 Ga0068858_100113312
514 Ga0068860_100038237
515 Ga0081455_10012610
516 Ga0081455_10029827
517 Ga0081455_10130992
518 Ga0081455_10150164
519 Ga0081540_1002231
520 Ga0081539_10008907
521 Ga0070717_10029365
522 Ga0070717_10046187
523 Ga0075432_10001507
524 Ga0070715_10000550
525 Ga0070712_100064812
526 Ga0070712_100188190
527 Ga0097621_100012477
528 Ga0068871_100029943
529 Ga0068871_100156034
530 Ga0075428_100011702
531 Ga0075433_10355220
532 Ga0075434_100104000
533 Ga0075434_100120501
534 Ga0075434_100294429
535 Ga0068865_100036295
536 Ga0068865_100100920
537 Ga0068865_100205162
538 Ga0075436_100011892
539 Ga0075435_100022062
540 Ga0105245_10028115
541 Ga0105245_10048648
542 Ga0105245_10066102
543 Ga0105245_10073569
544 Ga0105245_10212084
545 Ga0105245_10376902
546 Ga0114129_10002400
547 Ga0114129_10098243
548 Ga0114129_10110849
549 Ga0114129_10230821
550 Ga0114129_10570453
551 Ga0105243_10005903
552 Ga0105243_10009914
553 Ga0105243_10085375
554 Ga0105243_10093903
555 Ga0105241_10006102
556 Ga0105241_10109820
557 Ga0105242_10014048
558 Ga0105242_10016601
559 Ga0105242_10084884
560 Ga0105248_10300820
561 Ga0105248_10378151
562 Ga0105238_10231983
563 Ga0105249_10043931
564 Ga0105249_10081112
565 Ga0105249_10087710
566 Ga0105239_10144598
567 Ga0105239_10169041
568 Ga0105246_10108556
569 Ga0105246_10239547
570 Ga0157342_1000645
571 Ga0157373_10123359
572 Ga0157369_10394211
573 Ga0157374_10564848
574 Ga0163162_10361046
575 Ga0157372_10279317
576 Ga0157372_10335147
577 Ga0163163_10071677
578 Ga0163163_10163524
579 Ga0157380_10011807
580 Ga0157377_10035053
581 Ga0157376_10036535
582 Ga0163161_10170931
583 Ga0206350_10199885
584 Ga0207692_10239405
585 Ga0207688_10017473
586 Ga0207688_10050186
587 Ga0207685_10001743
588 Ga0207699_10029940
589 Ga0207684_10061261
590 Ga0207707_10205871
591 Ga0207693_10053901
592 Ga0207663_10012486
593 Ga0207663_10030113
594 Ga0207660_10009492
595 Ga0207657_10120930
596 Ga0207652_10032380
597 Ga0207652_10293646
598 Ga0207694_10121151
599 Ga0207694_10181708
600 Ga0207659_10138843
601 Ga0207687_10151612
602 Ga0207687_10181346
603 Ga0207687_10412777
604 Ga0207700_10028974
605 Ga0207700_10029815
606 Ga0207700_10405623
607 Ga0207664_10014696
608 Ga0207664_10030682
609 Ga0207664_10131296
610 Ga0207664_10379643
611 Ga0207706_10044858
612 Ga0207686_10027346
613 Ga0207686_10199264
614 Ga0207709_10018701
615 Ga0207669_10098446
616 Ga0207704_10024404
617 Ga0207704_10063827
618 Ga0207665_10001170
619 Ga0207691_10074547
620 Ga0207711_10100253
621 Ga0207661_10000234
622 Ga0207661_10034670
623 Ga0207661_10051283
624 Ga0207661_10054910
625 Ga0207661_10102819
626 Ga0207679_10011009
627 Ga0207667_10167273
628 Ga0207712_10089933
629 Ga0207668_10111883
630 Ga0207677_10021194
631 Ga0207678_10076001
632 Ga0207708_10018074
633 Ga0207702_10008976
634 Ga0207702_10017150
635 Ga0207676_10064943
636 Ga0207674_10003353
637 Ga0207674_10040202
638 Ga0207674_10192282
639 Ga0207674_10321807
640 Ga0207675_100000962
641 Ga0207683_10006570
642 Ga0207683_10021262
643 Ga0207683_10037286
644 Ga0207683_10048934
645 Ga0207683_10112909
646 Ga0207683_10235259
647 Ga0207428_10002378
648 Ga0207428_10131834
649 Ga0265338_10109794
650 Ga0307409_100137707
651 Ga0307415_100183191
652 Ga0373930_0005123
653 Ga0373948_0023874
654 Ga0373948_0033687
655 Ga0373928_0005978
656 Ga0373940_0072125
657 Ga0373944_0000513
658 Ga0373955_0157738
659 Ga0373961_0051504
660 Ga0373962_0022614
661 Ga0373931_0003025
662 Ga0373947_0153736
663 Ga0373925_0400249
664 Ga0395899_0000945
665 Ga0395899_0008425
666 Ga0395899_0024443
667 Ga0395899_0097188
668 Ga0395899_0149391
669 Ga0395899_0182095
670 Ga0395900_0002004
671 Ga0395900_0005240
672 Ga0395900_0007518
673 Ga0395900_0015483
674 Ga0395900_0016323
675 Ga0395900_0128657
676 Ga0395900_0190813
677 Ga0395898_0004108
678 Ga0395898_0005290
679 Ga0395898_0005707
680 Ga0395898_0014791
681 Ga0395898_0039277
682 Ga0395898_0040868
683 Ga0395898_0073077
684 Ga0395898_0078433
685 Ga0395898_0096424
686 Ga0395898_0098702
687 Ga0395898_0185479
688 Ga0395905_0001706
689 Ga0395905_0004416
690 Ga0395905_0025009
691 Ga0395905_0031104
692 Ga0395905_0116493
693 Ga0395905_0244007
694 Ga0395905_0284012
695 Ga0395905_0405284
696 Ga0395905_0471088
697 Ga0395901_0001467
698 Ga0395901_0003164
699 Ga0395901_0006646
700 Ga0395901_0008218
701 Ga0395901_0016209
702 Ga0395901_0019118
703 Ga0395901_0032733
704 Ga0395901_0037162
705 Ga0395901_0050076
706 Ga0395901_0071497
707 Ga0395901_0129314
708 Ga0395901_0231572
709 Ga0395901_0445768
710 Ga0395901_0647488
711 Ga0436363_0664339
712 Ga0439455_0007013
713 Ga0439464_0032018
714 Ga0466966_0003532
715 Ga0466963_0016408
716 Ga0466963_0074371
717 Ga0466971_0073617
718 Ga0466957_0180679
719 Ga0466959_0120356
720 Ga0466959_0127413
721 Ga0466959_0236856
722 Ga0451576_0022598
723 Ga0466967_0019319
724 Ga0466967_0113825
725 Ga0466967_0158114
726 Ga0466967_0250167
727 Ga0495603_0002142
728 Ga0495603_0072310
729 Ga0495603_0131131
730 Ga0495641_0001263
731 Ga0495651_0273856
732 Ga0495653_0079899
733 Ga0495580_0198124
734 Ga0495582_0217315
735 Ga0495605_0095418
736 Ga0495639_0057378
737 Ga0495584_0108873
738 Ga0495585_0042431
739 Ga0495594_0066701
740 Ga0495594_0107240
741 Ga0495608_0133419
742 Ga0495618_0154466
743 Ga0495630_0014121
744 Ga0495630_0228072
745 Ga0495663_0034601
746 Ga0495652_0059305
747 Ga0495586_0084477
748 Ga0495667_0168993
749 Ga0495656_0042792
750 Ga0495635_0030561
751 Ga0495588_0017939
752 Ga0495588_0039142
753 Ga0495588_0151009
754 Ga0495657_0110290
755 Ga0495647_0030148
756 Ga0495658_0088049
757 Ga0495658_0149115
758 Ga0495613_0173991
759 Ga0495613_0236858
760 Ga0495604_0145686
761 Ga0495674_0113204
762 Ga0495674_0405121
763 Ga0495676_0023074
764 Ga0495676_0038403
765 Ga0495676_0076322
766 Ga0495684_0375431
767 Ga0496100_0039912
768 Ga0496100_0114315
769 Ga0496100_0133790
770 Ga0496100_0223501
771 Ga0496101_0019863
772 Ga0496101_0197176
773 Ga0496101_0272838
774 Ga0496101_0323941
775 Ga0496102_0030062
776 Ga0496102_0094476
777 Ga0496102_0412945
778 Ga0496103_0003231
779 Ga0496103_0019849
780 Ga0496104_0002455
781 Ga0496104_0002572
782 Ga0496104_0011658
783 Ga0496104_0038214
784 Ga0496104_0250364
785 Ga0496105_0004509
786 Ga0496105_0006973
787 Ga0496105_0029912
788 Ga0496105_0058975
789 Ga0496105_0104424
790 Ga0496105_0382129
791 Ga0496106_0009055
792 Ga0496106_0072761
793 Ga0496106_0202460
794 Ga0496107_0023961
795 Ga0496107_0189761
796 Ga0496108_0009601
797 Ga0496108_0045840
798 Ga0496108_0165599
799 Ga0496108_0196661
800 Ga0496108_0299608
801 Ga0496109_0000274
802 Ga0496109_0026911
803 Ga0496109_0028815
804 Ga0496109_0158347
805 Ga0496109_0508219
806 Ga0496110_0001327
807 Ga0496110_0046141
808 Ga0496110_0177312
809 Ga0496110_0244385
810 Ga0496111_0009503
811 Ga0496111_0029548
812 Ga0496112_0013091
813 Ga0496112_0031100
814 Ga0496112_0040550
815 Ga0496113_0027130
816 Ga0496113_0132115
817 Ga0496113_0405981
818 Ga0496114_0005189
819 Ga0496114_0006123
820 Ga0496114_0027946
821 Ga0496114_0041667
822 Ga0496114_0194647
823 Ga0496115_0011875
824 Ga0501069_0017145
825 nmdc:mga05p37_135839_c1
826 nmdc:mga05p37_68933_c1
827 nmdc:mga08y16_296767_c1
828 nmdc:mga08y16_63924_c1
829 nmdc:mga08y16_86270_c1
830 nmdc:mga0n895_14697_c1
831 nmdc:mga0rr50_35581_c1
832 nmdc:mga0rr50_56715_c1
833 nmdc:mga08x19_80526_c1
834 nmdc:mga0a205_127526_c1
835 nmdc:mga0a205_478988_c1
836 nmdc:mga0a205_71792_c1
837 Ga0495612_0035550
838 Ga0495595_0082212
839 Ga0495619_0017521
840 Ga0587066_009615
841 Ga0587066_012319
842 Ga0587070_006064
843 Ga0587073_0001156
844 Ga0587073_0001187
845 Ga0587077_000974
846 Ga0587080_002974
847 Ga0587082_003090
848 Ga0587082_005046
849 Ga0587083_0001195
850 Ga0587085_000408
851 Ga0587125_007401
852 Ga0587128_002089
853 Ga0587067_001072
854 Ga0587069_000244
855 Ga0587072_001107
856 Ga0587075_013121
857 Ga0587078_005698
858 Ga0587079_000394
859 Ga0587079_003127
860 Ga0587079_023554
861 Ga0587107_013942
862 Ga0587071_012804
863 Ga0587111_0031038
864 Ga0530510_0102010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

112

320

0.99

PF19300

BPD_transp_1_N

Binding-prot-dependent transport system membrane comp, N-term

1

101

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8312 85 312
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.822 86 312
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8204 83 308
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.8042 83 312
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7998 85 312
ID Description Score Start End Superfamily
af_Q2G1F7_265_478_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9218 82 309 1.10.3720.10
af_P33591_90_303_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9211 84 312 1.10.3720.10
af_Q2FYQ5_85_305_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9196 75 314 1.10.3720.10
af_I6YGV9_86_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9164 82 312 1.10.3720.10
af_Q2FZR7_83_297_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9161 80 309 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A256KG80-F1-model_v4 deleted 0.9451 71 315
AF-A0A2R6DFN7-F1-model_v4 ABC transporter permease 0.939 71 315 GO:0005886
GO:0055085
AF-A0A7C2RQ25-F1-model_v4 ABC transporter permease 0.9382 84 315 GO:0005886
GO:0055085
AF-Q2K254-F1-model_v4 Probable oligopeptide ABC transporter, permease protein 0.9366 57 315 GO:0005886
GO:0055085
AF-A0A7R6YWR1-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9357 86 315 GO:0005886
GO:0055085

Map