metagRoot

F442527

General Info

Members	Datasets	Scaffolds	Average Seq Length
432	251	392	220

Family's Representative Sequence

Representative Sequence	3300005337\|Ga0070682_100251941\|Ga0070682_1002519412
Length	224
Sequence	MRTLFFDLDGTLIDSAVGITRCIAYSLERMGHPGLPADDYRGWIGPALRVSYGALFDDPADVERAVALYRERFEDVGWTEHTVYAGIGDAIETLHAAGCRLAVVTAKNEPHARRILDTLSFVHRFDDVIGATADGRLSHKPELIGEALARLGIAADVAPGLCTMIGDRDLDIAGAAHHGLRGIGVLWGFGDADELRAAGAHALAATPDALPALLLDDARAPRHS

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2524614729	Arenimonas oryziterrae YC6267, DSM 21050	Isolate	Rhizosphere
3	2547132130	Stenotrophomonas maltophilia RR-10	Isolate	Unclassified
4	2571042365	Lysobacter oryzae DSM 21044	Isolate	Rhizosphere
5	2576861471	Stenotrophomonas rhizophila DSM 14405	Isolate	Rhizosphere
6	2627854209	Arenimonas oryziterrae YC6267, DSM 21050	Isolate	Rhizosphere
7	2643221559	Lysobacter sp. Root559	Isolate	Unclassified
8	2643221573	Lysobacter sp. Root604	Isolate	Unclassified
9	2643221579	Pseudoxanthomonas sp. Root630	Isolate	Unclassified
10	2643221581	Pseudoxanthomonas sp. Root65	Isolate	Unclassified
11	2643221586	Lysobacter sp. Root667	Isolate	Unclassified
12	2643221612	Lysobacter sp. Root76	Isolate	Unclassified
13	2643221695	Lysobacter sp. Root494	Isolate	Unclassified
14	2643221720	Lysobacter sp. Root916	Isolate	Unclassified
15	2643221727	Lysobacter sp. Root96	Isolate	Unclassified
16	2643221728	Lysobacter sp. Root983	Isolate	Unclassified
17	2747842428	Stenotrophomonas sp. WCS2014-113	Isolate	Unclassified
18	2765235840	Stenotrophomonas maltophilia AA1	Isolate	Unclassified
19	2816332141	Stenotrophomonas muris 1190 (v2) (version 2)	Isolate	Unclassified
20	2842391507	Stenotrophomonas maltophilia SEMIA 4027	Isolate	Nodule
21	2842757796	Stenotrophomonas sp. R-72406	Isolate	Unclassified
22	2852649853	Stenotrophomonas sp. JAI102	Isolate	Rhizosphere
23	2857442823	Stenotrophomonas sp. R-74235	Isolate	Unclassified
24	2874220319	Stenotrophomonas maltophilia PS5	Isolate	Unclassified
25	2919089067	Stenotrophomonas sp. 1337	Isolate	Rhizosphere
26	2919134579	Stenotrophomonas geniculata 1733	Isolate	Rhizosphere
27	2923516293	Pseudoxanthomonas mexicana SLBN-89	Isolate	Rhizosphere
28	2928496128	Stenotrophomonas indicatrix 1163	Isolate	Unclassified
29	2931380184	Stenotrophomonas sp. DR822	Isolate	Rhizosphere
30	2937610967	Stenotrophomonas maltophilia EP20	Isolate	Unclassified
31	2939589442	Stenotrophomonas rhizophila 716	Isolate	Rhizosphere
32	2939622612	Stenotrophomonas sp. 2619	Isolate	Rhizosphere
33	2939626828	Stenotrophomonas sp. 2694	Isolate	Rhizosphere
34	2941475908	Stenotrophomonas rhizophila 2680	Isolate	Rhizosphere
35	2961047084	Stenotrophomonas maltophilia EP5	Isolate	Unclassified
36	2961064222	Stenotrophomonas maltophilia EP13	Isolate	Unclassified
37	2974307012	Stenotrophomonas sp. SORGH_AS_0282	Isolate	Unclassified
38	2977247770	Stenotrophomonas rhizophila SORGH_AS 457	Isolate	Unclassified
39	2984514374	Stenotrophomonas sp. SORGH_AS282	Isolate	Aerial Root
40	2987605356	Stenotrophomonas sp. ATCM1_4	Isolate	Unclassified
41	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
42	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
43	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
44	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
45	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
46	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
47	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
48	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
49	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
50	3300003794	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2	Metagenome	Endosphere
51	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
52	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
53	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
54	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
55	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
56	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
57	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
58	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
59	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
60	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
61	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
62	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
63	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
64	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
65	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
66	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
67	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
68	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
69	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
70	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
71	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
72	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
73	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
74	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
75	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
76	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
77	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
78	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
79	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
80	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
81	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
82	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
83	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
84	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
85	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
87	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
88	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
89	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
90	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
91	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
92	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
93	3300009984	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG	Metagenome	Rhizosphere
94	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
95	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
96	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
97	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
98	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
99	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
100	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
101	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
102	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
103	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
104	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
105	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
106	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
107	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
108	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
109	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
110	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
111	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
112	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
113	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
114	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
115	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
116	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
118	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
119	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
120	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
121	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
123	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
124	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
156	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
157	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
158	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
159	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
160	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
161	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
162	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
163	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
164	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
165	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
166	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
167	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
168	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
169	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
170	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
171	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
172	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
173	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
174	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
175	3300042015	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287	Metagenome	Rhizosphere
176	3300042115	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642	Metagenome	Rhizosphere
177	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
178	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
179	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
180	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
181	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
182	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
183	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
184	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
185	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
186	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
187	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
188	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
189	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
190	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
191	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
192	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
193	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
194	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
195	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
196	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
197	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
198	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
199	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
200	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
201	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
202	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
203	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
204	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
205	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
206	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
207	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
208	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
209	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
210	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
211	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
212	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
213	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
217	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
218	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
219	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
220	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
221	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
222	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
223	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
224	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
225	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
226	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
227	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
228	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
229	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
230	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
231	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
232	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
233	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
234	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
235	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
236	3300049683	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control	Metagenome	Rhizosphere
237	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
238	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
239	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
240	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
241	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
242	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
243	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
244	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
245	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
246	3300053128	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere	Metagenome	Endosphere
247	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
248	3300053734	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere	Metagenome	Endosphere
249	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
250	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
251	8003014200	Lysobacter changpingensis Cm-3-T8	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	90.74
Metatranscriptomes	0
Isolates	9.26

Biome Distribution

Category	Percentage (%)
Aerial Root	0.23
Bulb	0
Endosphere	17.59
Nodule	0.23
Rhizoplane	1.39
Rhizosphere	61.11
Stem	0
Stem Tuber	0
Unclassified	19.44

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_2864321	2162886007	Bacteria	1072
2	SwRhRL2b_contig_3680283	2162886007	Bacteria	5461
3	rootH2_10004661	3300003320	Bacteria	6350
4	rootH1_10082164	3300003323	Bacteria	1547
5	Ga0055526_1001708	3300003771	Bacteria	15317
6	Ga0055537_1000336	3300003773	Bacteria	32133
7	Ga0055524_1032788	3300003775	Bacteria	1465
8	Ga0055524_1039951	3300003775	Bacteria	1204
9	Ga0055536_1003313	3300003781	Bacteria	8714
10	Ga0055536_1003634	3300003781	Bacteria	8222
11	Ga0055536_1009480	3300003781	Bacteria	4022
12	Ga0055536_1019284	3300003781	Bacteria	2152
13	Ga0055536_1019404	3300003781	Bacteria	2139
14	Ga0055536_1024479	3300003781	Bacteria	1747
15	Ga0055534_1000154	3300003784	Bacteria	51139
16	Ga0055528_1000909	3300003790	Bacteria	19989
17	Ga0055530_10001361	3300003791	Bacteria	18115
18	Ga0055530_10001793	3300003791	Bacteria	14907
19	Ga0055530_10005700	3300003791	Bacteria	5810
20	Ga0055531_10013921	3300003794	Bacteria	3668
21	Ga0055531_10020060	3300003794	Bacteria	2666
22	Ga0055531_10020471	3300003794	Bacteria	2614
23	Ga0055531_10025411	3300003794	Bacteria	2152
24	Ga0055531_10025768	3300003794	Bacteria	2123
25	Ga0055531_10038846	3300003794	Bacteria	1422
26	Ga0065165_1067818	3300005262	Bacteria	956
27	Ga0065704_10070834	3300005289	Bacteria	15592
28	Ga0065704_10084023	3300005289	Bacteria	3387
29	Ga0070683_100393914	3300005329	Bacteria	1321
30	Ga0070670_100451019	3300005331	Bacteria	1140
31	Ga0068869_100069246	3300005334	Bacteria	2608
32	Ga0068869_100086263	3300005334	Bacteria	2353
33	Ga0070682_100251941	3300005337	Bacteria	1273
34	Ga0068868_100024553	3300005338	Bacteria	4575
35	Ga0070661_100201873	3300005344	Bacteria	1519
36	Ga0070661_100391851	3300005344	Bacteria	1097
37	Ga0070668_100055993	3300005347	Bacteria	3044
38	Ga0070671_100025287	3300005355	Bacteria	4871
39	Ga0070667_100049721	3300005367	Bacteria	3531
40	Ga0070710_10406373	3300005437	Bacteria	914
41	Ga0070711_100026801	3300005439	Bacteria	3780
42	Ga0070663_100301901	3300005455	Bacteria	1282
43	Ga0070681_10066189	3300005458	Bacteria	3582
44	Ga0070679_100297125	3300005530	Bacteria	1566
45	Ga0068853_100212357	3300005539	Bacteria	1764
46	Ga0070672_100014094	3300005543	Bacteria	5658
47	Ga0070672_100913800	3300005543	Bacteria	776
48	Ga0070693_100002638	3300005547	Bacteria	8256
49	Ga0070665_100000636	3300005548	Bacteria	47736
50	Ga0070665_100184456	3300005548	Bacteria	2087
51	Ga0070665_100190865	3300005548	Bacteria	2050
52	Ga0068855_100966240	3300005563	Bacteria	896
53	Ga0070664_100014662	3300005564	Bacteria	6398
54	Ga0068857_100358936	3300005577	Bacteria	1350
55	Ga0068856_100074343	3300005614	Bacteria	3364
56	Ga0068852_100058003	3300005616	Bacteria	3351
57	Ga0068864_100385743	3300005618	Bacteria	1329
58	Ga0068861_100065902	3300005719	Bacteria	2791
59	Ga0068851_10055204	3300005834	Bacteria	2023
60	Ga0068863_100406990	3300005841	Bacteria	1331
61	Ga0068858_100561317	3300005842	Bacteria	1106
62	Ga0068860_100378842	3300005843	Bacteria	1396
63	Ga0068860_100497429	3300005843	Bacteria	1217
64	Ga0068862_100000674	3300005844	Bacteria	34963
65	Ga0068862_100321107	3300005844	Bacteria	1429
66	Ga0075364_10094515	3300006051	Bacteria	1987
67	Ga0075364_10397649	3300006051	Bacteria	940
68	Ga0075369_10037519	3300006186	Bacteria	2064
69	Ga0097621_100058397	3300006237	Bacteria	3156
70	Ga0068871_100040480	3300006358	Bacteria	3732
71	Ga0068871_100162042	3300006358	Bacteria	1913
72	Ga0068865_100026159	3300006881	Bacteria	3845
73	Ga0068865_100220480	3300006881	Bacteria	1483
74	Ga0105244_10021055	3300009036	Bacteria	3614
75	Ga0105240_10034398	3300009093	Bacteria	6536
76	Ga0105243_10019385	3300009148	Bacteria	5158
77	Ga0105248_10039297	3300009177	Bacteria	5299
78	Ga0105248_10067485	3300009177	Bacteria	4016
79	Ga0105237_10095642	3300009545	Bacteria	2960
80	Ga0105029_101228	3300009984	Bacteria	1556
81	Ga0105239_10015061	3300010375	Bacteria	8573
82	Ga0105239_10051177	3300010375	Bacteria	4528
83	Ga0157373_10210456	3300013100	Bacteria	1371
84	Ga0157373_10260091	3300013100	Bacteria	1228
85	Ga0157371_10007251	3300013102	Bacteria	9004
86	Ga0157371_10181481	3300013102	Bacteria	1505
87	Ga0157371_10466247	3300013102	Bacteria	930
88	Ga0157370_10085314	3300013104	Bacteria	2966
89	Ga0157370_10090594	3300013104	Bacteria	2871
90	Ga0157369_10756627	3300013105	Bacteria	999
91	Ga0157374_10105372	3300013296	Bacteria	2708
92	Ga0157378_11119509	3300013297	Bacteria	825
93	Ga0163162_10770040	3300013306	Bacteria	1081
94	Ga0157375_10593347	3300013308	Bacteria	1267
95	Ga0163163_10395863	3300014325	Bacteria	1439
96	Ga0182008_10004630	3300014497	Bacteria	8003
97	Ga0182008_10170073	3300014497	Bacteria	1100
98	Ga0157379_10083033	3300014968	Bacteria	2871
99	Ga0157376_10637708	3300014969	Bacteria	1064
100	Ga0182006_1042199	3300015261	Bacteria	1788
101	Ga0182006_1054384	3300015261	Bacteria	1532
102	Ga0182006_1065356	3300015261	Bacteria	1362
103	Ga0182006_1110358	3300015261	Bacteria	966
104	Ga0182007_10000219	3300015262	Bacteria	38463
105	Ga0182005_1000213	3300015265	Bacteria	38351
106	Ga0163161_10033648	3300017792	Bacteria	3663
107	Ga0163161_10042359	3300017792	Bacteria	3274
108	Ga0207425_1016098	3300025245	Bacteria	1665
109	Ga0209565_1000023	3300025263	Bacteria	388244
110	Ga0209673_1000629	3300025273	Bacteria	53733
111	Ga0209673_1003976	3300025273	Bacteria	8234
112	Ga0209675_1000016	3300025291	Bacteria	391965
113	Ga0209675_1003979	3300025291	Bacteria	6750
114	Ga0209675_1012606	3300025291	Bacteria	2709
115	Ga0209676_1000027	3300025292	Bacteria	560222
116	Ga0209676_1000037	3300025292	Bacteria	457562
117	Ga0209676_1000160	3300025292	Bacteria	161069
118	Ga0209676_1000280	3300025292	Bacteria	105988
119	Ga0209676_1000338	3300025292	Bacteria	89337
120	Ga0209676_1001753	3300025292	Bacteria	18501
121	Ga0209676_1002455	3300025292	Bacteria	13137
122	Ga0209676_1007176	3300025292	Bacteria	5315
123	Ga0209676_1016505	3300025292	Bacteria	2660
124	Ga0209025_1002279	3300025294	Bacteria	20933
125	Ga0209025_1011654	3300025294	Bacteria	5759
126	Ga0209564_1000194	3300025295	Bacteria	141518
127	Ga0209564_1012521	3300025295	Bacteria	3691
128	Ga0209758_1033736	3300025297	Bacteria	2050
129	Ga0209050_1000352	3300025298	Bacteria	88558
130	Ga0209050_1000372	3300025298	Bacteria	85772
131	Ga0209050_1000714	3300025298	Bacteria	48752
132	Ga0209050_1028562	3300025298	Bacteria	1807
133	Ga0209050_1049602	3300025298	Bacteria	1074
134	Ga0209256_1002088	3300025299	Bacteria	17522
135	Ga0209256_1002519	3300025299	Bacteria	14719
136	Ga0209256_1003285	3300025299	Bacteria	11540
137	Ga0209256_1005895	3300025299	Bacteria	6781
138	Ga0209256_1027999	3300025299	Bacteria	1597
139	Ga0209256_1034109	3300025299	Bacteria	1359
140	Ga0209256_1039876	3300025299	Bacteria	1204
141	Ga0207426_1019807	3300025302	Bacteria	2346
142	Ga0209051_1002595	3300025303	Bacteria	12720
143	Ga0209257_1000177	3300025304	Bacteria	161069
144	Ga0209257_1000198	3300025304	Bacteria	149013
145	Ga0209257_1000383	3300025304	Bacteria	88315
146	Ga0209257_1003158	3300025304	Bacteria	14680
147	Ga0209257_1008852	3300025304	Bacteria	5562
148	Ga0209257_1011685	3300025304	Bacteria	4187
149	Ga0209257_1013656	3300025304	Bacteria	3582
150	Ga0209257_1061645	3300025304	Bacteria	1017
151	Ga0207656_10047945	3300025321	Bacteria	1838
152	Ga0207680_10081559	3300025903	Bacteria	2034
153	Ga0207695_10043968	3300025913	Bacteria	4755
154	Ga0207671_10135959	3300025914	Bacteria	1890
155	Ga0207671_10423647	3300025914	Bacteria	1059
156	Ga0207663_10184484	3300025916	Bacteria	1493
157	Ga0207649_10343050	3300025920	Bacteria	1103
158	Ga0207649_10384652	3300025920	Bacteria	1046
159	Ga0207652_10248524	3300025921	Bacteria	1604
160	Ga0207687_10733098	3300025927	Bacteria	840
161	Ga0207644_10084764	3300025931	Bacteria	2349
162	Ga0207709_10001822	3300025935	Bacteria	14226
163	Ga0207704_10007452	3300025938	Bacteria	5171
164	Ga0207691_10117863	3300025940	Bacteria	2355
165	Ga0207711_10028389	3300025941	Bacteria	4708
166	Ga0207711_10362763	3300025941	Bacteria	1342
167	Ga0207689_10055467	3300025942	Bacteria	3261
168	Ga0207689_10140480	3300025942	Bacteria	1989
169	Ga0207689_10824621	3300025942	Bacteria	783
170	Ga0207661_10441318	3300025944	Bacteria	1185
171	Ga0207667_10290436	3300025949	Bacteria	1671
172	Ga0207667_10371074	3300025949	Bacteria	1458
173	Ga0207668_10048362	3300025972	Bacteria	2918
174	Ga0207668_10142247	3300025972	Bacteria	1846
175	Ga0207668_10178512	3300025972	Bacteria	1673
176	Ga0207668_10258996	3300025972	Bacteria	1416
177	Ga0207640_10653914	3300025981	Bacteria	896
178	Ga0207658_10098499	3300025986	Bacteria	2285
179	Ga0207658_10122410	3300025986	Bacteria	2076
180	Ga0207703_10163131	3300026035	Bacteria	1953
181	Ga0207639_10108106	3300026041	Bacteria	2261
182	Ga0207678_10251684	3300026067	Bacteria	1513
183	Ga0207702_10494607	3300026078	Bacteria	1191
184	Ga0207641_10215779	3300026088	Bacteria	1776
185	Ga0207641_10320702	3300026088	Bacteria	1469
186	Ga0207676_10118971	3300026095	Bacteria	2224
187	Ga0207674_10232196	3300026116	Bacteria	1792
188	Ga0207675_100011803	3300026118	Bacteria	8167
189	Ga0209371_1000007	3300027312	Bacteria	1050654
190	Ga0268266_10000001	3300028379	Bacteria	4040580
191	Ga0268266_10067489	3300028379	Bacteria	3096
192	Ga0268266_10196038	3300028379	Bacteria	1846
193	Ga0268266_10693445	3300028379	Bacteria	981
194	Ga0268265_10000539	3300028380	Bacteria	38528
195	Ga0268264_10042088	3300028381	Bacteria	3780
196	Ga0268264_10513824	3300028381	Bacteria	1170
197	Ga0268256_1000008	3300030500	Bacteria	1050654
198	Ga0316176_1218218	3300030732	Bacteria	1580
199	Ga0316183_1164125	3300030742	Bacteria	2863
200	Ga0307408_100209553	3300031548	Bacteria	1583
201	Ga0307516_10550796	3300031730	Bacteria	807
202	Ga0307405_10140020	3300031731	Bacteria	1685
203	Ga0307413_10505536	3300031824	Bacteria	971
204	Ga0307410_10166446	3300031852	Bacteria	1657
205	Ga0307412_10006427	3300031911	Bacteria	6642
206	Ga0307412_10023450	3300031911	Bacteria	3797
207	Ga0307412_10447272	3300031911	Bacteria	1063
208	Ga0307414_10013411	3300032004	Bacteria	4879
209	Ga0307414_10027750	3300032004	Bacteria	3663
210	Ga0307414_10109100	3300032004	Bacteria	2101
211	Ga0307414_10143900	3300032004	Bacteria	1870
212	Ga0307414_10165832	3300032004	Bacteria	1760
213	Ga0307414_10807606	3300032004	Bacteria	856
214	Ga0307411_10048935	3300032005	Bacteria	2743
215	Ga0307415_100200737	3300032126	Bacteria	1582
216	Ga0237816_01275	3300039145	Bacteria	2048
217	Ga0439436_0020711	3300041404	Bacteria	1958
218	Ga0439439_0006021	3300041406	Bacteria	2793
219	Ga0439465_0007288	3300041413	Bacteria	3512
220	Ga0439465_0009520	3300041413	Bacteria	3060
221	Ga0439465_0012266	3300041413	Bacteria	2681
222	Ga0439445_0017228	3300042004	Bacteria	1785
223	Ga0439445_0070756	3300042004	Bacteria	965
224	Ga0439432_006410	3300042006	Bacteria	4204
225	Ga0439432_032888	3300042006	Bacteria	1670
226	Ga0439432_046208	3300042006	Bacteria	1368
227	Ga0439449_0000181	3300042007	Bacteria	21923
228	Ga0439449_0012346	3300042007	Bacteria	3211
229	Ga0439449_0019074	3300042007	Bacteria	2572
230	Ga0439449_0026878	3300042007	Bacteria	2147
231	Ga0439457_025552	3300042014	Bacteria	1307
232	Ga0439462_0062089	3300042015	Bacteria	1011
233	Ga0439462_0116919	3300042015	Bacteria	740
234	Ga0450911_004368	3300042115	Bacteria	2325
235	Ga0451577_0006888	3300042876	Bacteria	11240
236	Ga0495627_023941	3300046453	Bacteria	1995
237	Ga0495627_048499	3300046453	Bacteria	1284
238	Ga0495629_0504482	3300046459	Unclassified	816
239	Ga0495638_0017337	3300046460	Bacteria	4804
240	Ga0495638_0145791	3300046460	Bacteria	1377
241	Ga0495638_0162486	3300046460	Bacteria	1287
242	Ga0495610_0005915	3300046512	Bacteria	8570
243	Ga0495616_0104697	3300046513	Bacteria	1322
244	Ga0495631_0028107	3300046518	Bacteria	2567
245	Ga0495643_0007512	3300046522	Bacteria	7011
246	Ga0495663_0007046	3300046525	Bacteria	3103
247	Ga0495663_0028150	3300046525	Bacteria	1652
248	Ga0495663_0032046	3300046525	Bacteria	1563
249	Ga0495663_0038913	3300046525	Bacteria	1439
250	Ga0495633_0045746	3300046558	Bacteria	2071
251	Ga0495633_0084904	3300046558	Bacteria	1472
252	Ga0495625_0103660	3300046660	Bacteria	1950
253	Ga0495659_0013299	3300046664	Bacteria	2680
254	Ga0495670_0037410	3300046691	Bacteria	2419
255	Ga0495660_0093163	3300046810	Bacteria	1562
256	Ga0495636_0000991	3300047318	Bacteria	10607
257	Ga0495672_0002314	3300047320	Bacteria	17680
258	Ga0495681_0178367	3300047470	Bacteria	874
259	Ga0495686_0008344	3300047472	Bacteria	7613
260	Ga0496100_0262195	3300048903	Bacteria	1282
261	Ga0496105_0031937	3300048908	Bacteria	4318
262	Ga0496106_0318533	3300048909	Bacteria	1248
263	Ga0496113_0295348	3300048916	Bacteria	1297
264	Ga0496113_0415882	3300048916	Bacteria	1080
265	Ga0496114_0045953	3300048917	Bacteria	3628
266	Ga0496116_0011774	3300048919	Bacteria	7202
267	Ga0496116_0030717	3300048919	Bacteria	3855
268	Ga0496116_0108991	3300048919	Bacteria	1633
269	Ga0496116_0137345	3300048919	Bacteria	1381
270	Ga0496116_0144617	3300048919	Bacteria	1331
271	Ga0496117_0010917	3300048920	Bacteria	8187
272	Ga0496117_0012519	3300048920	Bacteria	7468
273	Ga0496117_0082274	3300048920	Bacteria	2109
274	Ga0496117_0083755	3300048920	Bacteria	2083
275	Ga0496117_0095505	3300048920	Bacteria	1899
276	Ga0496117_0277875	3300048920	Bacteria	898
277	Ga0496117_0355759	3300048920	Bacteria	754
278	Ga0496118_0009914	3300048921	Bacteria	9519
279	Ga0496118_0014466	3300048921	Bacteria	7384
280	Ga0496118_0020674	3300048921	Bacteria	5828
281	Ga0496118_0085785	3300048921	Bacteria	2191
282	Ga0496118_0102900	3300048921	Bacteria	1923
283	Ga0496118_0115621	3300048921	Bacteria	1765
284	Ga0496118_0250992	3300048921	Bacteria	1005
285	Ga0496119_0002532	3300048922	Bacteria	19895
286	Ga0496119_0128239	3300048922	Bacteria	1385
287	Ga0496119_0172168	3300048922	Bacteria	1142
288	Ga0496120_0000970	3300048923	Bacteria	39064
289	Ga0496120_0054990	3300048923	Bacteria	2252
290	Ga0496120_0082099	3300048923	Bacteria	1742
291	Ga0496121_0016423	3300048924	Bacteria	7647
292	Ga0496121_0084849	3300048924	Bacteria	2495
293	Ga0496121_0086366	3300048924	Bacteria	2466
294	Ga0496121_0141141	3300048924	Bacteria	1787
295	Ga0496122_0007862	3300048925	Bacteria	11713
296	Ga0496122_0098632	3300048925	Bacteria	1961
297	Ga0496123_0000960	3300048926	Bacteria	44650
298	Ga0496123_0009534	3300048926	Bacteria	8730
299	Ga0496123_0050167	3300048926	Bacteria	2790
300	Ga0496123_0091397	3300048926	Bacteria	1805
301	Ga0496123_0132775	3300048926	Bacteria	1375
302	Ga0496123_0139621	3300048926	Bacteria	1327
303	Ga0496124_0018009	3300048927	Bacteria	6634
304	Ga0496124_0055819	3300048927	Bacteria	3335
305	Ga0496124_0092487	3300048927	Bacteria	2464
306	Ga0496124_0201828	3300048927	Bacteria	1511
307	Ga0496124_0231187	3300048927	Bacteria	1382
308	Ga0496124_0329060	3300048927	Bacteria	1090
309	Ga0496125_0015229	3300048928	Bacteria	7443
310	Ga0496125_0018146	3300048928	Bacteria	6687
311	Ga0496125_0051806	3300048928	Bacteria	3381
312	Ga0496125_0053681	3300048928	Bacteria	3301
313	Ga0496125_0075762	3300048928	Bacteria	2601
314	Ga0496125_0123695	3300048928	Bacteria	1838
315	Ga0496125_0228623	3300048928	Bacteria	1191
316	Ga0496126_0009344	3300048929	Bacteria	10429
317	Ga0496126_0182149	3300048929	Bacteria	1784
318	Ga0496126_0231187	3300048929	Bacteria	1549
319	Ga0496126_0281879	3300048929	Bacteria	1376
320	Ga0496126_0382490	3300048929	Bacteria	1145
321	Ga0496126_0525090	3300048929	Bacteria	943
322	Ga0501290_002411	3300049513	Bacteria	2423
323	Ga0501031_0014366	3300049568	Bacteria	5147
324	Ga0501031_0151174	3300049568	Bacteria	1517
325	Ga0501032_0014193	3300049569	Bacteria	5643
326	Ga0501032_0015113	3300049569	Bacteria	5451
327	Ga0501033_0000648	3300049570	Bacteria	32231
328	Ga0501033_0304429	3300049570	Bacteria	1121
329	Ga0501034_0018523	3300049571	Bacteria	7137
330	Ga0501034_0040117	3300049571	Bacteria	4740
331	Ga0501034_0070658	3300049571	Bacteria	3502
332	Ga0501034_0098553	3300049571	Bacteria	2918
333	Ga0501036_0026681	3300049572	Bacteria	4879
334	Ga0501036_0085542	3300049572	Bacteria	2665
335	Ga0501037_0026922	3300049573	Bacteria	4247
336	Ga0501037_0053365	3300049573	Bacteria	2956
337	Ga0501038_0024149	3300049574	Bacteria	5426
338	Ga0501038_0044536	3300049574	Bacteria	3853
339	Ga0501038_0075132	3300049574	Bacteria	2857
340	Ga0501039_0034281	3300049575	Bacteria	3917
341	Ga0501041_0210259	3300049577	Bacteria	1220
342	Ga0501042_0005612	3300049578	Bacteria	8090
343	Ga0501043_0003714	3300049579	Bacteria	12545
344	Ga0501043_0022026	3300049579	Bacteria	4999
345	Ga0501043_0056462	3300049579	Bacteria	3084
346	Ga0501043_0263196	3300049579	Bacteria	1325
347	Ga0501046_0003407	3300049580	Bacteria	14596
348	Ga0501047_0070940	3300049581	Bacteria	3353
349	Ga0501047_0246706	3300049581	Bacteria	1635
350	Ga0501047_0426938	3300049581	Bacteria	1156
351	Ga0501048_0154859	3300049582	Bacteria	1621
352	Ga0501067_0006607	3300049583	Bacteria	6432
353	Ga0501068_0033770	3300049584	Bacteria	3048
354	Ga0501068_0096949	3300049584	Bacteria	1824
355	Ga0501069_0079070	3300049585	Bacteria	1850
356	Ga0501069_0386113	3300049585	Bacteria	827
357	Ga0501070_0124920	3300049586	Bacteria	2126
358	Ga0501071_0017233	3300049587	Bacteria	4978
359	Ga0501072_0007056	3300049588	Bacteria	8529
360	Ga0501073_0004601	3300049589	Bacteria	10370
361	Ga0501073_0072429	3300049589	Bacteria	2400
362	Ga0501073_0086365	3300049589	Bacteria	2182
363	Ga0501073_0270590	3300049589	Bacteria	1172
364	Ga0501074_0154425	3300049590	Bacteria	1640
365	Ga0501077_0334128	3300049593	Bacteria	966
366	Ga0501202_036842	3300049652	Bacteria	1043
367	Ga0501253_022735	3300049683	Bacteria	1120
368	Ga0501080_0017965	3300049742	Bacteria	6546
369	Ga0501080_0037828	3300049742	Bacteria	4505
370	Ga0501080_0220378	3300049742	Bacteria	1736
371	Ga0501080_0285940	3300049742	Bacteria	1498
372	Ga0501081_0066768	3300049743	Bacteria	2502
373	Ga0501083_0024394	3300049744	Bacteria	4189
374	Ga0501035_0049734	3300049822	Bacteria	3756
375	Ga0501035_0119353	3300049822	Bacteria	2306
376	Ga0501044_0062516	3300049823	Bacteria	3805
377	Ga0501044_0063996	3300049823	Bacteria	3756
378	Ga0501044_0123597	3300049823	Bacteria	2586
379	Ga0501044_0428930	3300049823	Bacteria	1231
380	Ga0501044_0565938	3300049823	Bacteria	1032
381	Ga0501045_0006425	3300049824	Bacteria	8140
382	nmdc:mga00v17_173543_c1	3300050491	Bacteria	1391
383	nmdc:mga00v17_284374_c1	3300050491	Bacteria	1074
384	nmdc:mga0k408_245504_c1	3300050493	Bacteria	1069
385	nmdc:mga04h51_108993_c1	3300050495	Bacteria	1018
386	Ga0500626_103246	3300053128	Bacteria	1240
387	Ga0500638_184847	3300053162	Bacteria	896
388	Ga0500565_003309	3300053734	Bacteria	1275
389	Ga0500661_005177	3300055283	Bacteria	2442
390	Ga0501082_0000234	3300060353	Bacteria	48354
391	Ga0501082_0009660	3300060353	Bacteria	8306
392	Ga0501082_0515396	3300060353	Bacteria	1045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300041404	Ga0439436_0020711	Ga0439436_0020711_790_1428	195
2	3300042006	Ga0439432_032888	Ga0439432_032888_727_1365	195
3	3300042007	Ga0439449_0026878	Ga0439449_0026878_64_702	195
4	3300031548	Ga0307408_100209553	Ga0307408_1002095532	200
5	3300031731	Ga0307405_10140020	Ga0307405_101400202	200
6	3300031911	Ga0307412_10006427	Ga0307412_100064273	200
7	3300032004	Ga0307414_10027750	Ga0307414_100277502	200
8	3300032005	Ga0307411_10048935	Ga0307411_100489352	200
9	3300049652	Ga0501202_036842	Ga0501202_036842_205_843	200
10	3300042015	Ga0439462_0062089	Ga0439462_0062089_365_982	204
11	3300048929	Ga0496126_0382490	Ga0496126_0382490_521_1135	204
12	3300049568	Ga0501031_0151174	Ga0501031_0151174_561_1184	207
13	iso_pu_bacteria	2524614729	2525556428	207
14	iso_pu_bacteria	2571042365	2572254436	207
15	iso_pu_bacteria	2627854209	2630649657	207
16	iso_pu_bacteria	2643221695	2644528308	207
17	iso_pu_bacteria	8003014200	8003016967	207
18	3300031730	Ga0307516_10550796	Ga0307516_105507962	208
19	3300049585	Ga0501069_0386113	Ga0501069_0386113_33_701	208
20	iso_pu_bacteria	2643221579	2643905269	209
21	iso_pu_bacteria	2643221581	2643914950	209
22	iso_pu_bacteria	2852649853	2852652333	209
23	iso_pu_bacteria	2923516293	2923517379	209
24	iso_pu_bacteria	2941475908	2941478949	209
25	iso_pu_bacteria	2987605356	2987608564	209
26	3300005543	Ga0070672_100014094	Ga0070672_1000140942	210
27	3300025940	Ga0207691_10117863	Ga0207691_101178632	210
28	3300003775	Ga0055524_1032788	Ga0055524_10327882	211
29	3300003781	Ga0055536_1003634	Ga0055536_10036344	211
30	3300003781	Ga0055536_1024479	Ga0055536_10244792	211
31	3300003791	Ga0055530_10005700	Ga0055530_100057002	211
32	3300003794	Ga0055531_10013921	Ga0055531_100139212	211
33	3300003794	Ga0055531_10020471	Ga0055531_100204712	211
34	3300003794	Ga0055531_10038846	Ga0055531_100388461	211
35	3300005337	Ga0070682_100251941	Ga0070682_1002519412	211
36	3300025273	Ga0209673_1003976	Ga0209673_10039762	211
37	3300025291	Ga0209675_1003979	Ga0209675_10039793	211
38	3300025291	Ga0209675_1012606	Ga0209675_10126061	211
39	3300025292	Ga0209676_1000280	Ga0209676_100028051	211
40	3300025292	Ga0209676_1001753	Ga0209676_100175315	211
41	3300025292	Ga0209676_1002455	Ga0209676_10024552	211
42	3300025292	Ga0209676_1007176	Ga0209676_10071763	211
43	3300025292	Ga0209676_1016505	Ga0209676_10165052	211
44	3300025294	Ga0209025_1002279	Ga0209025_10022794	211
45	3300025294	Ga0209025_1011654	Ga0209025_10116544	211
46	3300025295	Ga0209564_1012521	Ga0209564_10125212	211
47	3300025297	Ga0209758_1033736	Ga0209758_10337362	211
48	3300025298	Ga0209050_1000714	Ga0209050_100071414	211
49	3300025299	Ga0209256_1002088	Ga0209256_100208815	211
50	3300025299	Ga0209256_1002519	Ga0209256_10025199	211
51	3300025299	Ga0209256_1027999	Ga0209256_10279992	211
52	3300025302	Ga0207426_1019807	Ga0207426_10198072	211
53	3300025304	Ga0209257_1000198	Ga0209257_100019872	211
54	3300025304	Ga0209257_1003158	Ga0209257_10031589	211
55	3300025304	Ga0209257_1008852	Ga0209257_10088524	211
56	3300025304	Ga0209257_1013656	Ga0209257_10136562	211
57	3300031824	Ga0307413_10505536	Ga0307413_105055361	211
58	3300031852	Ga0307410_10166446	Ga0307410_101664462	211
59	3300031911	Ga0307412_10447272	Ga0307412_104472722	211
60	3300032004	Ga0307414_10165832	Ga0307414_101658322	211
61	3300032126	Ga0307415_100200737	Ga0307415_1002007372	211
62	3300041413	Ga0439465_0012266	Ga0439465_0012266_336_974	211
63	3300042004	Ga0439445_0070756	Ga0439445_0070756_82_720	211
64	3300042006	Ga0439432_006410	Ga0439432_006410_239_877	211
65	3300042007	Ga0439449_0012346	Ga0439449_0012346_344_982	211
66	3300042007	Ga0439449_0019074	Ga0439449_0019074_1331_1969	211
67	3300042014	Ga0439457_025552	Ga0439457_025552_169_807	211
68	3300042876	Ga0451577_0006888	Ga0451577_0006888_6129_6770	211
69	3300046460	Ga0495638_0145791	Ga0495638_0145791_671_1309	211
70	3300046664	Ga0495659_0013299	Ga0495659_0013299_101_739	211
71	3300046691	Ga0495670_0037410	Ga0495670_0037410_562_1200	211
72	3300047318	Ga0495636_0000991	Ga0495636_0000991_4556_5194	211
73	3300049579	Ga0501043_0003714	Ga0501043_0003714_963_1601	211
74	3300049683	Ga0501253_022735	Ga0501253_022735_11_649	211
75	iso_pu_bacteria	2643221573	2643880893	211
76	iso_pu_bacteria	2643221720	2644661462	211
77	iso_pu_bacteria	2643221728	2644699543	211
78	iso_pu_bacteria	2842757796	2842759171	211
79	3300003794	Ga0055531_10020060	Ga0055531_100200602	212
80	3300005334	Ga0068869_100069246	Ga0068869_1000692463	212
81	3300009177	Ga0105248_10039297	Ga0105248_100392972	212
82	3300009545	Ga0105237_10095642	Ga0105237_100956422	212
83	3300010375	Ga0105239_10015061	Ga0105239_100150612	212
84	3300013296	Ga0157374_10105372	Ga0157374_101053722	212
85	3300013308	Ga0157375_10593347	Ga0157375_105933472	212
86	3300015261	Ga0182006_1110358	Ga0182006_11103582	212
87	3300025245	Ga0207425_1016098	Ga0207425_10160981	212
88	3300025304	Ga0209257_1011685	Ga0209257_10116852	212
89	3300025941	Ga0207711_10028389	Ga0207711_100283892	212
90	3300025942	Ga0207689_10140480	Ga0207689_101404802	212
91	3300042006	Ga0439432_046208	Ga0439432_046208_87_725	212
92	3300046460	Ga0495638_0162486	Ga0495638_0162486_412_1050	212
93	3300046522	Ga0495643_0007512	Ga0495643_0007512_5489_6127	212
94	3300046660	Ga0495625_0103660	Ga0495625_0103660_426_1064	212
95	3300047320	Ga0495672_0002314	Ga0495672_0002314_15011_15649	212
96	3300047472	Ga0495686_0008344	Ga0495686_0008344_1007_1645	212
97	3300048927	Ga0496124_0055819	Ga0496124_0055819_854_1492	212
98	3300050495	nmdc:mga04h51_108993_c1	nmdc:mga04h51_108993_c1_89_727	212
99	2162886007	SwRhRL2b_contig_3680283	SwRhRL2b_0001.00005180	213
100	3300003781	Ga0055536_1003313	Ga0055536_10033132	213
101	3300005289	Ga0065704_10070834	Ga0065704_1007083412	213
102	3300005289	Ga0065704_10084023	Ga0065704_100840232	213
103	3300005347	Ga0070668_100055993	Ga0070668_1000559933	213
104	3300006051	Ga0075364_10094515	Ga0075364_100945152	213
105	3300009984	Ga0105029_101228	Ga0105029_1012282	213
106	3300013102	Ga0157371_10007251	Ga0157371_100072515	213
107	3300015261	Ga0182006_1042199	Ga0182006_10421992	213
108	3300015262	Ga0182007_10000219	Ga0182007_100002193	213
109	3300015265	Ga0182005_1000213	Ga0182005_100021330	213
110	3300025292	Ga0209676_1000027	Ga0209676_1000027356	213
111	3300025972	Ga0207668_10142247	Ga0207668_101422472	213
112	3300032004	Ga0307414_10807606	Ga0307414_108076062	213
113	3300039145	Ga0237816_01275	Ga0237816_01275_1370_2014	213
114	3300041406	Ga0439439_0006021	Ga0439439_0006021_1609_2259	213
115	3300041413	Ga0439465_0007288	Ga0439465_0007288_874_1518	213
116	3300041413	Ga0439465_0009520	Ga0439465_0009520_1102_1746	213
117	3300042004	Ga0439445_0017228	Ga0439445_0017228_477_1127	213
118	3300042007	Ga0439449_0000181	Ga0439449_0000181_497_1141	213
119	3300042015	Ga0439462_0116919	Ga0439462_0116919_58_699	213
120	3300046525	Ga0495663_0007046	Ga0495663_0007046_570_1214	213
121	3300048908	Ga0496105_0031937	Ga0496105_0031937_3037_3678	213
122	3300048917	Ga0496114_0045953	Ga0496114_0045953_776_1417	213
123	3300048919	Ga0496116_0011774	Ga0496116_0011774_5737_6378	213
124	3300048919	Ga0496116_0108991	Ga0496116_0108991_496_1137	213
125	3300048920	Ga0496117_0355759	Ga0496117_0355759_69_710	213
126	3300048921	Ga0496118_0102900	Ga0496118_0102900_901_1542	213
127	3300048921	Ga0496118_0250992	Ga0496118_0250992_204_845	213
128	3300048922	Ga0496119_0002532	Ga0496119_0002532_18403_19044	213
129	3300048923	Ga0496120_0000970	Ga0496120_0000970_2506_3147	213
130	3300048924	Ga0496121_0084849	Ga0496121_0084849_774_1415	213
131	3300048924	Ga0496121_0141141	Ga0496121_0141141_44_685	213
132	3300048925	Ga0496122_0007862	Ga0496122_0007862_8791_9435	213
133	3300048925	Ga0496122_0098632	Ga0496122_0098632_500_1141	213
134	3300048926	Ga0496123_0000960	Ga0496123_0000960_41687_42331	213
135	3300048926	Ga0496123_0139621	Ga0496123_0139621_391_1032	213
136	3300048927	Ga0496124_0092487	Ga0496124_0092487_1028_1669	213
137	3300048928	Ga0496125_0018146	Ga0496125_0018146_5780_6421	213
138	3300048928	Ga0496125_0053681	Ga0496125_0053681_2394_3035	213
139	3300048928	Ga0496125_0075762	Ga0496125_0075762_1144_1785	213
140	3300048929	Ga0496126_0009344	Ga0496126_0009344_9099_9740	213
141	3300049571	Ga0501034_0070658	Ga0501034_0070658_1814_2458	213
142	3300049571	Ga0501034_0098553	Ga0501034_0098553_1491_2132	213
143	3300050491	nmdc:mga00v17_284374_c1	nmdc:mga00v17_284374_c1_201_842	213
144	iso_pu_bacteria	2547132130	2547503426	213
145	iso_pu_bacteria	2576861471	2578457202	213
146	iso_pu_bacteria	2643221559	2643816732	213
147	iso_pu_bacteria	2643221586	2643938588	213
148	iso_pu_bacteria	2643221612	2644077665	213
149	iso_pu_bacteria	2643221727	2644694020	213
150	iso_pu_bacteria	2816332141	2816518679	213
151	iso_pu_bacteria	2842391507	2842395531	213
152	iso_pu_bacteria	2919134579	2919137447	213
153	iso_pu_bacteria	2939622612	2939624323	213
154	iso_pu_bacteria	2961064222	2961066592	213
155	3300005344	Ga0070661_100391851	Ga0070661_1003918512	214
156	3300005548	Ga0070665_100000636	Ga0070665_10000063613	214
157	3300025920	Ga0207649_10343050	Ga0207649_103430502	214
158	3300025986	Ga0207658_10122410	Ga0207658_101224102	214
159	3300028379	Ga0268266_10000001	Ga0268266_10000001789	214
160	3300049574	Ga0501038_0075132	Ga0501038_0075132_1620_2267	214
161	3300049581	Ga0501047_0246706	Ga0501047_0246706_542_1189	214
162	3300049742	Ga0501080_0220378	Ga0501080_0220378_1025_1672	214
163	3300049823	Ga0501044_0428930	Ga0501044_0428930_97_744	214
164	3300003781	Ga0055536_1019404	Ga0055536_10194042	215
165	3300003794	Ga0055531_10025768	Ga0055531_100257681	215
166	3300005262	Ga0065165_1067818	Ga0065165_10678181	215
167	3300005543	Ga0070672_100913800	Ga0070672_1009138001	215
168	3300005548	Ga0070665_100184456	Ga0070665_1001844563	215
169	3300005844	Ga0068862_100321107	Ga0068862_1003211072	215
170	3300015261	Ga0182006_1054384	Ga0182006_10543842	215
171	3300025292	Ga0209676_1000338	Ga0209676_100033824	215
172	3300025298	Ga0209050_1049602	Ga0209050_10496022	215
173	3300025299	Ga0209256_1003285	Ga0209256_100328511	215
174	3300025299	Ga0209256_1005895	Ga0209256_10058955	215
175	3300025304	Ga0209257_1000383	Ga0209257_100038328	215
176	3300028379	Ga0268266_10693445	Ga0268266_106934452	215
177	3300049579	Ga0501043_0056462	Ga0501043_0056462_1264_1923	215
178	3300049590	Ga0501074_0154425	Ga0501074_0154425_857_1549	215
179	3300049823	Ga0501044_0123597	Ga0501044_0123597_577_1236	215
180	3300050493	nmdc:mga0k408_245504_c1	nmdc:mga0k408_245504_c1_49_699	215
181	3300053162	Ga0500638_184847	Ga0500638_184847_219_884	215
182	3300055283	Ga0500661_005177	Ga0500661_005177_1211_1876	215
183	3300005329	Ga0070683_100393914	Ga0070683_1003939142	216
184	3300005334	Ga0068869_100086263	Ga0068869_1000862632	216
185	3300005338	Ga0068868_100024553	Ga0068868_1000245535	216
186	3300005344	Ga0070661_100201873	Ga0070661_1002018732	216
187	3300005355	Ga0070671_100025287	Ga0070671_1000252875	216
188	3300005437	Ga0070710_10406373	Ga0070710_104063732	216
189	3300005439	Ga0070711_100026801	Ga0070711_1000268014	216
190	3300005455	Ga0070663_100301901	Ga0070663_1003019012	216
191	3300005458	Ga0070681_10066189	Ga0070681_100661895	216
192	3300005530	Ga0070679_100297125	Ga0070679_1002971252	216
193	3300005539	Ga0068853_100212357	Ga0068853_1002123573	216
194	3300005547	Ga0070693_100002638	Ga0070693_1000026385	216
195	3300005548	Ga0070665_100190865	Ga0070665_1001908652	216
196	3300005563	Ga0068855_100966240	Ga0068855_1009662402	216
197	3300005564	Ga0070664_100014662	Ga0070664_1000146628	216
198	3300005577	Ga0068857_100358936	Ga0068857_1003589362	216
199	3300005614	Ga0068856_100074343	Ga0068856_1000743434	216
200	3300005616	Ga0068852_100058003	Ga0068852_1000580033	216
201	3300005618	Ga0068864_100385743	Ga0068864_1003857432	216
202	3300005834	Ga0068851_10055204	Ga0068851_100552043	216
203	3300005841	Ga0068863_100406990	Ga0068863_1004069901	216
204	3300005842	Ga0068858_100561317	Ga0068858_1005613172	216
205	3300006237	Ga0097621_100058397	Ga0097621_1000583973	216
206	3300006358	Ga0068871_100040480	Ga0068871_1000404802	216
207	3300006358	Ga0068871_100162042	Ga0068871_1001620422	216
208	3300006881	Ga0068865_100026159	Ga0068865_1000261593	216
209	3300009177	Ga0105248_10067485	Ga0105248_100674853	216
210	3300010375	Ga0105239_10051177	Ga0105239_100511776	216
211	3300013105	Ga0157369_10756627	Ga0157369_107566272	216
212	3300013297	Ga0157378_11119509	Ga0157378_111195092	216
213	3300014325	Ga0163163_10395863	Ga0163163_103958632	216
214	3300014968	Ga0157379_10083033	Ga0157379_100830333	216
215	3300025321	Ga0207656_10047945	Ga0207656_100479452	216
216	3300025914	Ga0207671_10135959	Ga0207671_101359592	216
217	3300025914	Ga0207671_10423647	Ga0207671_104236472	216
218	3300025916	Ga0207663_10184484	Ga0207663_101844842	216
219	3300025920	Ga0207649_10384652	Ga0207649_103846521	216
220	3300025921	Ga0207652_10248524	Ga0207652_102485242	216
221	3300025927	Ga0207687_10733098	Ga0207687_107330981	216
222	3300025931	Ga0207644_10084764	Ga0207644_100847642	216
223	3300025938	Ga0207704_10007452	Ga0207704_100074526	216
224	3300025941	Ga0207711_10362763	Ga0207711_103627632	216
225	3300025942	Ga0207689_10055467	Ga0207689_100554673	216
226	3300025944	Ga0207661_10441318	Ga0207661_104413182	216
227	3300025949	Ga0207667_10371074	Ga0207667_103710742	216
228	3300026035	Ga0207703_10163131	Ga0207703_101631312	216
229	3300026041	Ga0207639_10108106	Ga0207639_101081062	216
230	3300026067	Ga0207678_10251684	Ga0207678_102516842	216
231	3300026078	Ga0207702_10494607	Ga0207702_104946072	216
232	3300026088	Ga0207641_10215779	Ga0207641_102157792	216
233	3300026095	Ga0207676_10118971	Ga0207676_101189712	216
234	3300026116	Ga0207674_10232196	Ga0207674_102321963	216
235	3300046459	Ga0495629_0504482	Ga0495629_0504482_45_698	216
236	3300048929	Ga0496126_0525090	Ga0496126_0525090_155_808	216
237	3300003320	rootH2_10004661	rootH2_100046617	217
238	3300003323	rootH1_10082164	rootH1_100821641	217
239	3300006186	Ga0075369_10037519	Ga0075369_100375192	217
240	3300009036	Ga0105244_10021055	Ga0105244_100210552	217
241	3300009148	Ga0105243_10019385	Ga0105243_100193854	217
242	3300013100	Ga0157373_10260091	Ga0157373_102600912	217
243	3300013104	Ga0157370_10085314	Ga0157370_100853142	217
244	3300013306	Ga0163162_10770040	Ga0163162_107700402	217
245	3300014497	Ga0182008_10004630	Ga0182008_100046302	217
246	3300017792	Ga0163161_10033648	Ga0163161_100336482	217
247	3300025935	Ga0207709_10001822	Ga0207709_100018229	217
248	3300030732	Ga0316176_1218218	Ga0316176_12182182	217
249	3300032004	Ga0307414_10143900	Ga0307414_101439002	217
250	3300046453	Ga0495627_048499	Ga0495627_048499_227_892	217
251	3300046460	Ga0495638_0017337	Ga0495638_0017337_1882_2547	217
252	3300046513	Ga0495616_0104697	Ga0495616_0104697_294_959	217
253	3300046525	Ga0495663_0032046	Ga0495663_0032046_765_1430	217
254	3300047470	Ga0495681_0178367	Ga0495681_0178367_69_734	217
255	3300048916	Ga0496113_0295348	Ga0496113_0295348_449_1114	217
256	3300048919	Ga0496116_0137345	Ga0496116_0137345_492_1145	217
257	3300048920	Ga0496117_0010917	Ga0496117_0010917_6496_7161	217
258	3300048920	Ga0496117_0277875	Ga0496117_0277875_52_717	217
259	3300048921	Ga0496118_0009914	Ga0496118_0009914_2390_3055	217
260	3300048921	Ga0496118_0115621	Ga0496118_0115621_894_1559	217
261	3300048922	Ga0496119_0128239	Ga0496119_0128239_511_1164	217
262	3300048923	Ga0496120_0082099	Ga0496120_0082099_512_1165	217
263	3300048924	Ga0496121_0016423	Ga0496121_0016423_713_1378	217
264	3300048926	Ga0496123_0009534	Ga0496123_0009534_6392_7057	217
265	3300048926	Ga0496123_0050167	Ga0496123_0050167_414_1079	217
266	3300048926	Ga0496123_0132775	Ga0496123_0132775_513_1166	217
267	3300048927	Ga0496124_0018009	Ga0496124_0018009_361_1026	217
268	3300048928	Ga0496125_0051806	Ga0496125_0051806_1688_2353	217
269	3300048928	Ga0496125_0123695	Ga0496125_0123695_510_1163	217
270	3300048929	Ga0496126_0231187	Ga0496126_0231187_424_1089	217
271	3300049581	Ga0501047_0426938	Ga0501047_0426938_119_829	217
272	3300049589	Ga0501073_0072429	Ga0501073_0072429_185_844	217
273	3300049589	Ga0501073_0270590	Ga0501073_0270590_193_879	217
274	3300049742	Ga0501080_0285940	Ga0501080_0285940_66_776	217
275	3300053128	Ga0500626_103246	Ga0500626_103246_203_868	217
276	3300053734	Ga0500565_003309	Ga0500565_003309_32_697	217
277	3300060353	Ga0501082_0000234	Ga0501082_0000234_24401_25111	217
278	3300005331	Ga0070670_100451019	Ga0070670_1004510192	218
279	3300005367	Ga0070667_100049721	Ga0070667_1000497213	218
280	3300005719	Ga0068861_100065902	Ga0068861_1000659022	218
281	3300005843	Ga0068860_100378842	Ga0068860_1003788422	218
282	3300005843	Ga0068860_100497429	Ga0068860_1004974292	218
283	3300005844	Ga0068862_100000674	Ga0068862_10000067428	218
284	3300006051	Ga0075364_10397649	Ga0075364_103976491	218
285	3300006881	Ga0068865_100220480	Ga0068865_1002204802	218
286	3300009093	Ga0105240_10034398	Ga0105240_100343981	218
287	3300014969	Ga0157376_10637708	Ga0157376_106377082	218
288	3300017792	Ga0163161_10042359	Ga0163161_100423593	218
289	3300025903	Ga0207680_10081559	Ga0207680_100815593	218
290	3300025913	Ga0207695_10043968	Ga0207695_100439683	218
291	3300025942	Ga0207689_10824621	Ga0207689_108246211	218
292	3300025949	Ga0207667_10290436	Ga0207667_102904362	218
293	3300025972	Ga0207668_10178512	Ga0207668_101785122	218
294	3300025972	Ga0207668_10258996	Ga0207668_102589962	218
295	3300025986	Ga0207658_10098499	Ga0207658_100984991	218
296	3300026088	Ga0207641_10320702	Ga0207641_103207022	218
297	3300026118	Ga0207675_100011803	Ga0207675_1000118038	218
298	3300027312	Ga0209371_1000007	Ga0209371_1000007756	218
299	3300028379	Ga0268266_10067489	Ga0268266_100674892	218
300	3300028380	Ga0268265_10000539	Ga0268265_1000053928	218
301	3300028381	Ga0268264_10042088	Ga0268264_100420883	218
302	3300028381	Ga0268264_10513824	Ga0268264_105138242	218
303	3300030500	Ga0268256_1000008	Ga0268256_1000008195	218
304	3300046453	Ga0495627_023941	Ga0495627_023941_282_950	218
305	3300048919	Ga0496116_0144617	Ga0496116_0144617_577_1245	218
306	3300048920	Ga0496117_0082274	Ga0496117_0082274_487_1155	218
307	3300048921	Ga0496118_0020674	Ga0496118_0020674_641_1309	218
308	3300048927	Ga0496124_0231187	Ga0496124_0231187_481_1149	218
309	3300048927	Ga0496124_0329060	Ga0496124_0329060_234_902	218
310	3300048929	Ga0496126_0281879	Ga0496126_0281879_431_1099	218
311	3300049513	Ga0501290_002411	Ga0501290_002411_251_925	218
312	3300049568	Ga0501031_0014366	Ga0501031_0014366_1187_1891	218
313	3300049569	Ga0501032_0014193	Ga0501032_0014193_3257_3961	218
314	3300049569	Ga0501032_0015113	Ga0501032_0015113_3451_4155	218
315	3300049570	Ga0501033_0000648	Ga0501033_0000648_24769_25473	218
316	3300049570	Ga0501033_0304429	Ga0501033_0304429_102_806	218
317	3300049571	Ga0501034_0018523	Ga0501034_0018523_3335_4039	218
318	3300049571	Ga0501034_0040117	Ga0501034_0040117_1928_2632	218
319	3300049572	Ga0501036_0026681	Ga0501036_0026681_2989_3693	218
320	3300049572	Ga0501036_0085542	Ga0501036_0085542_236_940	218
321	3300049573	Ga0501037_0026922	Ga0501037_0026922_1573_2277	218
322	3300049573	Ga0501037_0053365	Ga0501037_0053365_1187_1891	218
323	3300049574	Ga0501038_0024149	Ga0501038_0024149_858_1562	218
324	3300049574	Ga0501038_0044536	Ga0501038_0044536_161_865	218
325	3300049575	Ga0501039_0034281	Ga0501039_0034281_1942_2646	218
326	3300049577	Ga0501041_0210259	Ga0501041_0210259_66_770	218
327	3300049578	Ga0501042_0005612	Ga0501042_0005612_6947_7651	218
328	3300049579	Ga0501043_0022026	Ga0501043_0022026_450_1154	218
329	3300049579	Ga0501043_0263196	Ga0501043_0263196_161_865	218
330	3300049580	Ga0501046_0003407	Ga0501046_0003407_245_949	218
331	3300049581	Ga0501047_0070940	Ga0501047_0070940_1407_2111	218
332	3300049582	Ga0501048_0154859	Ga0501048_0154859_75_779	218
333	3300049583	Ga0501067_0006607	Ga0501067_0006607_112_816	218
334	3300049584	Ga0501068_0033770	Ga0501068_0033770_1158_1862	218
335	3300049584	Ga0501068_0096949	Ga0501068_0096949_541_1245	218
336	3300049585	Ga0501069_0079070	Ga0501069_0079070_35_739	218
337	3300049586	Ga0501070_0124920	Ga0501070_0124920_1279_1983	218
338	3300049587	Ga0501071_0017233	Ga0501071_0017233_3510_4214	218
339	3300049588	Ga0501072_0007056	Ga0501072_0007056_781_1485	218
340	3300049589	Ga0501073_0004601	Ga0501073_0004601_3964_4668	218
341	3300049589	Ga0501073_0086365	Ga0501073_0086365_56_745	218
342	3300049593	Ga0501077_0334128	Ga0501077_0334128_155_859	218
343	3300049742	Ga0501080_0017965	Ga0501080_0017965_1357_2061	218
344	3300049742	Ga0501080_0037828	Ga0501080_0037828_813_1517	218
345	3300049743	Ga0501081_0066768	Ga0501081_0066768_112_816	218
346	3300049744	Ga0501083_0024394	Ga0501083_0024394_133_837	218
347	3300049822	Ga0501035_0049734	Ga0501035_0049734_2951_3655	218
348	3300049822	Ga0501035_0119353	Ga0501035_0119353_1459_2163	218
349	3300049823	Ga0501044_0062516	Ga0501044_0062516_228_932	218
350	3300049823	Ga0501044_0063996	Ga0501044_0063996_102_806	218
351	3300049823	Ga0501044_0565938	Ga0501044_0565938_257_961	218
352	3300049824	Ga0501045_0006425	Ga0501045_0006425_120_824	218
353	3300060353	Ga0501082_0009660	Ga0501082_0009660_6230_6934	218
354	3300060353	Ga0501082_0515396	Ga0501082_0515396_326_1030	218
355	iso_pu_bacteria	2747842428	2747948323	218
356	iso_pu_bacteria	2765235840	2765580295	218
357	iso_pu_bacteria	2857442823	2857445161	218
358	iso_pu_bacteria	2874220319	2874222967	218
359	iso_pu_bacteria	2919089067	2919092809	218
360	iso_pu_bacteria	2928496128	2928499212	218
361	iso_pu_bacteria	2931380184	2931383573	218
362	iso_pu_bacteria	2937610967	2937614935	218
363	iso_pu_bacteria	2939626828	2939630243	218
364	iso_pu_bacteria	2961047084	2961049732	218
365	iso_pu_bacteria	2939589442	2939589612	220
366	iso_pu_bacteria	2974307012	2974307833	220
367	iso_pu_bacteria	2977247770	2977248552	220
368	iso_pu_bacteria	2984514374	2984516961	220
369	2162886007	SwRhRL2b_contig_2864321	SwRhRL2b_0778.00003010	222
370	3300003771	Ga0055526_1001708	Ga0055526_10017086	222
371	3300003773	Ga0055537_1000336	Ga0055537_100033618	222
372	3300003775	Ga0055524_1039951	Ga0055524_10399511	222
373	3300003781	Ga0055536_1009480	Ga0055536_10094803	222
374	3300003781	Ga0055536_1019284	Ga0055536_10192842	222
375	3300003784	Ga0055534_1000154	Ga0055534_100015434	222
376	3300003790	Ga0055528_1000909	Ga0055528_100090911	222
377	3300003791	Ga0055530_10001361	Ga0055530_1000136111	222
378	3300003791	Ga0055530_10001793	Ga0055530_100017933	222
379	3300003794	Ga0055531_10025411	Ga0055531_100254112	222
380	3300013100	Ga0157373_10210456	Ga0157373_102104561	222
381	3300013102	Ga0157371_10181481	Ga0157371_101814812	222
382	3300013102	Ga0157371_10466247	Ga0157371_104662472	222
383	3300013104	Ga0157370_10090594	Ga0157370_100905942	222
384	3300014497	Ga0182008_10170073	Ga0182008_101700732	222
385	3300015261	Ga0182006_1065356	Ga0182006_10653562	222
386	3300025263	Ga0209565_1000023	Ga0209565_100002394	222
387	3300025273	Ga0209673_1000629	Ga0209673_100062933	222
388	3300025291	Ga0209675_1000016	Ga0209675_1000016200	222
389	3300025292	Ga0209676_1000037	Ga0209676_1000037180	222
390	3300025292	Ga0209676_1000160	Ga0209676_1000160111	222
391	3300025295	Ga0209564_1000194	Ga0209564_100019411	222
392	3300025298	Ga0209050_1000352	Ga0209050_100035232	222
393	3300025298	Ga0209050_1000372	Ga0209050_100037218	222
394	3300025298	Ga0209050_1028562	Ga0209050_10285622	222
395	3300025299	Ga0209256_1034109	Ga0209256_10341092	222
396	3300025299	Ga0209256_1039876	Ga0209256_10398762	222
397	3300025303	Ga0209051_1002595	Ga0209051_100259510	222
398	3300025304	Ga0209257_1000177	Ga0209257_100017732	222
399	3300025304	Ga0209257_1061645	Ga0209257_10616452	222
400	3300025972	Ga0207668_10048362	Ga0207668_100483622	222
401	3300025981	Ga0207640_10653914	Ga0207640_106539142	222
402	3300028379	Ga0268266_10196038	Ga0268266_101960382	222
403	3300030742	Ga0316183_1164125	Ga0316183_11641253	222
404	3300031911	Ga0307412_10023450	Ga0307412_100234503	222
405	3300032004	Ga0307414_10013411	Ga0307414_100134112	222
406	3300032004	Ga0307414_10109100	Ga0307414_101091002	222
407	3300042115	Ga0450911_004368	Ga0450911_004368_1063_1731	222
408	3300046512	Ga0495610_0005915	Ga0495610_0005915_5643_6326	222
409	3300046518	Ga0495631_0028107	Ga0495631_0028107_913_1596	222
410	3300046525	Ga0495663_0028150	Ga0495663_0028150_336_1022	222
411	3300046525	Ga0495663_0038913	Ga0495663_0038913_247_915	222
412	3300046558	Ga0495633_0045746	Ga0495633_0045746_797_1483	222
413	3300046558	Ga0495633_0084904	Ga0495633_0084904_264_932	222
414	3300046810	Ga0495660_0093163	Ga0495660_0093163_401_1090	222
415	3300048903	Ga0496100_0262195	Ga0496100_0262195_131_799	222
416	3300048909	Ga0496106_0318533	Ga0496106_0318533_246_914	222
417	3300048916	Ga0496113_0415882	Ga0496113_0415882_157_825	222
418	3300048919	Ga0496116_0030717	Ga0496116_0030717_1058_1726	222
419	3300048920	Ga0496117_0012519	Ga0496117_0012519_859_1548	222
420	3300048920	Ga0496117_0083755	Ga0496117_0083755_642_1310	222
421	3300048920	Ga0496117_0095505	Ga0496117_0095505_307_987	222
422	3300048921	Ga0496118_0014466	Ga0496118_0014466_5924_6613	222
423	3300048921	Ga0496118_0085785	Ga0496118_0085785_471_1151	222
424	3300048922	Ga0496119_0172168	Ga0496119_0172168_414_1082	222
425	3300048923	Ga0496120_0054990	Ga0496120_0054990_555_1223	222
426	3300048924	Ga0496121_0086366	Ga0496121_0086366_1054_1722	222
427	3300048926	Ga0496123_0091397	Ga0496123_0091397_644_1330	222
428	3300048927	Ga0496124_0201828	Ga0496124_0201828_506_1195	222
429	3300048928	Ga0496125_0015229	Ga0496125_0015229_185_871	222
430	3300048928	Ga0496125_0228623	Ga0496125_0228623_262_930	222
431	3300048929	Ga0496126_0182149	Ga0496126_0182149_378_1058	222
432	3300050491	nmdc:mga00v17_173543_c1	nmdc:mga00v17_173543_c1_449_1129	222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

4

185

0.9 PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

1

179

0.87 PF13242

Hydrolase_like

HAD-hyrolase-like

138

215

0.82 PF12710

HAD

haloacid dehalogenase-like hydrolase

4

176

0.71 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3mc1-assembly1.cif.gz_A	crystal structure of a predicted phosphatase from clostridium acetobutylicum	0.9534	11	221
3mc1-assembly1.cif.gz_A	crystal structure of a predicted phosphatase from clostridium acetobutylicum	0.9279	11	221
2ah5-assembly1.cif.gz_A	hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae	0.9277	12	222
3d6j-assembly1.cif.gz_A	crystal structure of putative haloacid dehalogenase-like hydrolase from bacteroides fragilis	0.9249	11	217
2ah5-assembly1.cif.gz_A	hydrolase, haloacid dehalogenase-like family protein sp0104 from streptococcus pneumoniae	0.9114	12	222

ID	Description	Score	Start	End	Superfamily
2ah5A02	Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2	0.9271	28	91	1.10.150.240
2ah5A01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.9168	12	222	3.40.50.1000
2hi0B01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.9077	11	221	3.40.50.1000
3mc1B01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.9064	13	220	3.40.50.1000
3sd7A02	Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Putative phosphatase; domain 2	0.9009	27	88	1.10.150.240

ID	Description	Score	Start	End	GO Terms
AF-M5CQ85-F1-model_v4	deleted	1.001	94	222
AF-A0A091ASR9-F1-model_v4	HAD family hydrolase	0.9982	13	217	GO:0004713 GO:0005829
AF-A0A562LF68-F1-model_v4	Phosphoglycolate phosphatase	0.9954	13	221	GO:0004713 GO:0005829
AF-A0A4V1TII4-F1-model_v4	deleted	0.9951	93	222
AF-A0A7H1ARL0-F1-model_v4	HAD-IA family hydrolase	0.9949	14	222	GO:0004713 GO:0005829 GO:0016787

Feature Viewer

pLDDT	pTM	Quality
94.33	0.9	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F442527

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

4

185

0.9

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

1

179

0.87

PF13242

Hydrolase_like

HAD-hyrolase-like

138

215

0.82

PF12710

HAD

haloacid dehalogenase-like hydrolase

4

176

0.71

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map