F442460

General Info

Members Datasets Scaffolds Average Seq Length
431 256 862 337

Family's Representative Sequence

Representative Sequence 3300048905|Ga0496102_0365947|Ga0496102_0365947_143_1141
Length 296
Sequence MRNVLLAAAQNSWVDDLVSAVVQIKTHINPEGRTVEGLTIGYLMVEAYAAEVIDNNGRAVPANVVGYDHESGFGLLRTLEPLKLKPMALGKSSEVKEHDPVLIASHGGTAMVGAAYVVGKREFAGSWEYMLDEALFTAPPHPAWSGAALINREGKLVGVGSLIVGDAAGSGEKTPGNMFVPIDRLAPILGDLIANGHIAGGRPWLGVNTEELRGRLFVTRVSPGGPGEKAGLKRGDVIVGVNGDQPKSLADLYRKVWAQGPAGANIPLDVLQDNAVRRVDVKSINRLDHLKLKSTF

Samples

Sample ID Description Type Environment
1 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
4 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
130 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
135 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
136 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
137 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
140 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
141 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
142 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
143 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
155 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
156 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
157 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
158 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
167 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
173 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
177 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
178 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
186 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
193 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
194 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
214 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
215 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
239 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
240 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
248 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
249 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
250 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
251 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.82
Nodule 0
Rhizoplane 12.76
Rhizosphere 78.19
Stem 0
Stem Tuber 0
Unclassified 5.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496102_0365947 3300048905 Bacteria 1357
2 JGI24743J22301_10000134 3300001991 Bacteria 7428
3 JGI24750J21931_1009781 3300002070 Unclassified 1240
4 JGI24748J21848_1004319 3300002074 Unclassified 1630
5 JGI24744J21845_10023508 3300002077 Unclassified 1207
6 JGI24751J29686_10004776 3300002459 Bacteria 2753
7 JGI25153J46596_10017257 3300003215 Bacteria 2850
8 Ga0070690_100011774 3300005330 Bacteria 5128
9 Ga0070677_10028732 3300005333 Bacteria 2103
10 Ga0070666_10126086 3300005335 Bacteria 1777
11 Ga0068868_100006163 3300005338 Bacteria 8479
12 Ga0068868_100045901 3300005338 Bacteria 3419
13 Ga0070660_100043526 3300005339 Bacteria 3431
14 Ga0070689_100023589 3300005340 Bacteria 4607
15 Ga0070687_100010048 3300005343 Bacteria 4075
16 Ga0070687_100038525 3300005343 Bacteria 2397
17 Ga0070661_100090278 3300005344 Bacteria 2269
18 Ga0070668_100069379 3300005347 Bacteria 2742
19 Ga0070668_100093959 3300005347 Bacteria 2367
20 Ga0070669_100023749 3300005353 Bacteria 4393
21 Ga0070669_100315792 3300005353 Bacteria 1260
22 Ga0070675_100087501 3300005354 Bacteria 2605
23 Ga0070671_100051614 3300005355 Bacteria 3420
24 Ga0070671_100246642 3300005355 Bacteria 1517
25 Ga0070674_100020639 3300005356 Bacteria 4215
26 Ga0070674_100111116 3300005356 Bacteria 2012
27 Ga0070673_100008514 3300005364 Bacteria 6824
28 Ga0070673_100120940 3300005364 Bacteria 2184
29 Ga0070673_100266677 3300005364 Bacteria 1498
30 Ga0070673_100291025 3300005364 Bacteria 1435
31 Ga0070688_100004710 3300005365 Bacteria 7125
32 Ga0070659_100033303 3300005366 Bacteria 4001
33 Ga0070667_100006086 3300005367 Bacteria 10016
34 Ga0070709_10159905 3300005434 Unclassified 1565
35 Ga0070714_100123786 3300005435 Bacteria 2303
36 Ga0070713_100143033 3300005436 Bacteria 2120
37 Ga0070713_100184341 3300005436 Bacteria 1877
38 Ga0070710_10078232 3300005437 Bacteria 1924
39 Ga0070710_10109011 3300005437 Bacteria 1661
40 Ga0070701_10000544 3300005438 Bacteria 12999
41 Ga0070700_100049913 3300005441 Bacteria 2599
42 Ga0070708_100126569 3300005445 Bacteria 2362
43 Ga0070678_100108856 3300005456 Bacteria 2164
44 Ga0070662_100028650 3300005457 Bacteria 3877
45 Ga0070662_100305438 3300005457 Unclassified 1294
46 Ga0070685_10001171 3300005466 Bacteria 14029
47 Ga0070685_10046289 3300005466 Bacteria 2497
48 Ga0070707_100265473 3300005468 Bacteria 1669
49 Ga0070699_100134298 3300005518 Unclassified 2182
50 Ga0070697_100205258 3300005536 Bacteria 1676
51 Ga0070686_100021561 3300005544 Bacteria 3833
52 Ga0070693_100049246 3300005547 Bacteria 2403
53 Ga0070665_100074831 3300005548 Bacteria 3392
54 Ga0068857_100059722 3300005577 Bacteria 3388
55 Ga0068856_100085309 3300005614 Bacteria 3137
56 Ga0068859_100034104 3300005617 Bacteria 5110
57 Ga0068864_100391962 3300005618 Unclassified 1318
58 Ga0068864_100450319 3300005618 Bacteria 1231
59 Ga0068866_10011316 3300005718 Bacteria 3857
60 Ga0068870_10005222 3300005840 Bacteria 5652
61 Ga0068863_100076239 3300005841 Bacteria 3172
62 Ga0068858_100016071 3300005842 Bacteria 7031
63 Ga0068858_100163100 3300005842 Bacteria 2099
64 Ga0068860_100120553 3300005843 Bacteria 2512
65 Ga0068860_100342572 3300005843 Bacteria 1470
66 Ga0068862_100009817 3300005844 Bacteria 7909
67 Ga0068862_100011484 3300005844 Bacteria 7311
68 Ga0081455_10005331 3300005937 Bacteria 14124
69 Ga0081455_10006671 3300005937 Bacteria 12336
70 Ga0081455_10010899 3300005937 Bacteria 9174
71 Ga0081538_10011656 3300005981 Bacteria 7108
72 Ga0081538_10097363 3300005981 Bacteria 1495
73 Ga0081540_1000234 3300005983 Bacteria 58203
74 Ga0081540_1002931 3300005983 Bacteria 13732
75 Ga0075365_10001017 3300006038 Bacteria 12044
76 Ga0075365_10005416 3300006038 Bacteria 6876
77 Ga0075365_10006487 3300006038 Bacteria 6441
78 Ga0075365_10007361 3300006038 Bacteria 6157
79 Ga0075365_10017005 3300006038 Bacteria 4441
80 Ga0075365_10046211 3300006038 Bacteria 2858
81 Ga0075368_10001006 3300006042 Bacteria 8820
82 Ga0075368_10008746 3300006042 Bacteria 3621
83 Ga0075364_10030953 3300006051 Bacteria 3437
84 Ga0075364_10152744 3300006051 Bacteria 1556
85 Ga0070715_10008794 3300006163 Bacteria 3533
86 Ga0070716_100067823 3300006173 Bacteria 2085
87 Ga0070712_100040265 3300006175 Bacteria 3203
88 Ga0070712_100198971 3300006175 Unclassified 1573
89 Ga0075367_10001020 3300006178 Bacteria 11516
90 Ga0075366_10010988 3300006195 Bacteria 5098
91 Ga0075366_10039101 3300006195 Bacteria 2803
92 Ga0075370_10123249 3300006353 Bacteria 1510
93 Ga0068871_100144068 3300006358 Unclassified 2027
94 Ga0075428_100001027 3300006844 Bacteria 29563
95 Ga0075428_100001811 3300006844 Bacteria 22863
96 Ga0075428_100018626 3300006844 Bacteria 7674
97 Ga0075428_100023291 3300006844 Bacteria 6852
98 Ga0075428_100027998 3300006844 Bacteria 6234
99 Ga0075428_100223973 3300006844 Bacteria 2031
100 Ga0075428_100275898 3300006844 Bacteria 1809
101 Ga0075428_100289784 3300006844 Bacteria 1761
102 Ga0075428_100445482 3300006844 Bacteria 1387
103 Ga0075430_100016889 3300006846 Bacteria 6217
104 Ga0075430_100060296 3300006846 Bacteria 3189
105 Ga0075430_100069213 3300006846 Bacteria 2961
106 Ga0075430_100127931 3300006846 Bacteria 2118
107 Ga0075430_100151831 3300006846 Bacteria 1929
108 Ga0075430_100177290 3300006846 Bacteria 1773
109 Ga0075431_100000017 3300006847 Bacteria 84171
110 Ga0075431_100015775 3300006847 Bacteria 7661
111 Ga0075431_100167839 3300006847 Bacteria 2256
112 Ga0075433_10193495 3300006852 Bacteria 1809
113 Ga0075434_100096058 3300006871 Bacteria 2969
114 Ga0075429_100029204 3300006880 Bacteria 4789
115 Ga0075429_100296462 3300006880 Bacteria 1416
116 Ga0068865_100016491 3300006881 Bacteria 4728
117 Ga0097620_100034104 3300006931 Bacteria 5110
118 Ga0075435_100105250 3300007076 Bacteria 2342
119 Ga0075435_100191623 3300007076 Unclassified 1730
120 Ga0075435_100368657 3300007076 Bacteria 1233
121 Ga0099794_10005354 3300007265 Bacteria 5137
122 Ga0111539_10000735 3300009094 Bacteria 42613
123 Ga0111539_10005279 3300009094 Bacteria 16728
124 Ga0111539_10008813 3300009094 Bacteria 12790
125 Ga0111539_10024707 3300009094 Bacteria 7370
126 Ga0111539_10044534 3300009094 Bacteria 5317
127 Ga0105245_10003514 3300009098 Bacteria 14022
128 Ga0105245_10089243 3300009098 Bacteria 2834
129 Ga0105247_10013728 3300009101 Bacteria 4858
130 Ga0105247_10128646 3300009101 Bacteria 1648
131 Ga0114129_10000025 3300009147 Bacteria 116480
132 Ga0114129_10010935 3300009147 Bacteria 12932
133 Ga0114129_10033614 3300009147 Bacteria 7245
134 Ga0114129_10033877 3300009147 Bacteria 7214
135 Ga0114129_10199019 3300009147 Bacteria 2715
136 Ga0114129_10289441 3300009147 Bacteria 2186
137 Ga0114129_10335296 3300009147 Bacteria 2007
138 Ga0114129_10577589 3300009147 Bacteria 1459
139 Ga0114129_10694246 3300009147 Unclassified 1309
140 Ga0114129_10732396 3300009147 Unclassified 1268
141 Ga0105243_10022050 3300009148 Bacteria 4839
142 Ga0105243_10118815 3300009148 Bacteria 2225
143 Ga0105242_10035437 3300009176 Bacteria 4002
144 Ga0105242_10123898 3300009176 Bacteria 2222
145 Ga0105248_10039516 3300009177 Bacteria 5285
146 Ga0105248_10449031 3300009177 Bacteria 1453
147 Ga0105237_10023351 3300009545 Bacteria 6338
148 Ga0105249_10017765 3300009553 Bacteria 6318
149 Ga0099796_10008826 3300010159 Bacteria 2702
150 Ga0105239_10080053 3300010375 Bacteria 3594
151 Ga0105239_10248594 3300010375 Bacteria 1997
152 Ga0105246_10108802 3300011119 Bacteria 2032
153 Ga0105246_10120795 3300011119 Bacteria 1941
154 Ga0157374_10012484 3300013296 Bacteria 7394
155 Ga0157374_10314988 3300013296 Bacteria 1550
156 Ga0157378_10050673 3300013297 Bacteria 3695
157 Ga0157378_10327393 3300013297 Bacteria 1490
158 Ga0163162_10095522 3300013306 Bacteria 3059
159 Ga0163162_10455634 3300013306 Bacteria 1411
160 Ga0157375_10773665 3300013308 Bacteria 1110
161 Ga0163163_10076849 3300014325 Bacteria 3335
162 Ga0157380_10011968 3300014326 Bacteria 6277
163 Ga0157380_10235172 3300014326 Bacteria 1648
164 Ga0157380_10281816 3300014326 Bacteria 1521
165 Ga0157377_10005862 3300014745 Bacteria 5811
166 Ga0157379_10083270 3300014968 Bacteria 2867
167 Ga0163161_10009501 3300017792 Bacteria 6729
168 Ga0209758_1001142 3300025297 Bacteria 34053
169 Ga0207682_10044183 3300025893 Bacteria 1826
170 Ga0207642_10000663 3300025899 Bacteria 10572
171 Ga0207710_10010160 3300025900 Bacteria 3960
172 Ga0207688_10000130 3300025901 Bacteria 31681
173 Ga0207680_10104718 3300025903 Bacteria 1824
174 Ga0207643_10001981 3300025908 Bacteria 11312
175 Ga0207693_10152167 3300025915 Bacteria 1820
176 Ga0207662_10007851 3300025918 Bacteria 5814
177 Ga0207662_10120208 3300025918 Bacteria 1647
178 Ga0207659_10034183 3300025926 Bacteria 3504
179 Ga0207659_10099576 3300025926 Bacteria 2189
180 Ga0207687_10005289 3300025927 Bacteria 8555
181 Ga0207687_10050603 3300025927 Bacteria 2892
182 Ga0207644_10080812 3300025931 Bacteria 2401
183 Ga0207706_10059109 3300025933 Bacteria 3376
184 Ga0207706_10276741 3300025933 Bacteria 1464
185 Ga0207709_10010956 3300025935 Bacteria 4997
186 Ga0207670_10027646 3300025936 Bacteria 3589
187 Ga0207665_10175455 3300025939 Bacteria 1550
188 Ga0207691_10011407 3300025940 Bacteria 8528
189 Ga0207711_10077462 3300025941 Bacteria 2898
190 Ga0207711_10530414 3300025941 Bacteria 1098
191 Ga0207689_10000756 3300025942 Bacteria 31021
192 Ga0207689_10241617 3300025942 Bacteria 1493
193 Ga0207679_10029360 3300025945 Bacteria 3827
194 Ga0207651_10007290 3300025960 Bacteria 5879
195 Ga0207651_10210123 3300025960 Bacteria 1566
196 Ga0207651_10249182 3300025960 Bacteria 1452
197 Ga0207668_10015491 3300025972 Bacteria 4738
198 Ga0207668_10059754 3300025972 Bacteria 2672
199 Ga0207668_10168986 3300025972 Bacteria 1713
200 Ga0207658_10025101 3300025986 Bacteria 4171
201 Ga0207677_10006114 3300026023 Bacteria 6574
202 Ga0207677_10009005 3300026023 Bacteria 5600
203 Ga0207703_10088324 3300026035 Bacteria 2601
204 Ga0207703_10192409 3300026035 Bacteria 1808
205 Ga0207678_10014386 3300026067 Bacteria 6957
206 Ga0207708_10004345 3300026075 Bacteria 10438
207 Ga0207641_10011439 3300026088 Bacteria 7284
208 Ga0207641_10048362 3300026088 Bacteria 3590
209 Ga0207676_10089028 3300026095 Bacteria 2528
210 Ga0207675_100008646 3300026118 Bacteria 9572
211 Ga0207675_100141151 3300026118 Bacteria 2288
212 Ga0207683_10014227 3300026121 Bacteria 6778
213 Ga0209813_10002457 3300027866 Bacteria 4242
214 Ga0207428_10001198 3300027907 Bacteria 27809
215 Ga0207428_10030563 3300027907 Bacteria 4453
216 Ga0207428_10195574 3300027907 Bacteria 1523
217 Ga0268265_10022622 3300028380 Bacteria 4419
218 Ga0268265_10086943 3300028380 Bacteria 2486
219 Ga0265339_10038511 3300031249 Bacteria 2667
220 Ga0265331_10107680 3300031250 Bacteria 1279
221 Ga0265316_10104875 3300031344 Bacteria 2145
222 Ga0265313_10038585 3300031595 Bacteria 2377
223 Ga0373926_0029467 3300035083 Bacteria 1929
224 Ga0373928_0021596 3300035084 Bacteria 1359
225 Ga0373934_0085385 3300035086 Unclassified 1270
226 Ga0373944_0016764 3300035089 Bacteria 2071
227 Ga0373923_0008125 3300035111 Bacteria 3725
228 Ga0373936_0000543 3300035113 Bacteria 12919
229 Ga0373936_0026551 3300035113 Bacteria 2268
230 Ga0373941_0008740 3300035115 Bacteria 2528
231 Ga0373953_0002974 3300035117 Bacteria 5184
232 Ga0373954_0001388 3300035118 Bacteria 9806
233 Ga0373956_0020897 3300035119 Bacteria 2790
234 Ga0373943_0009939 3300035170 Bacteria 4265
235 Ga0373946_0005078 3300035171 Bacteria 4740
236 Ga0373955_0001296 3300035172 Bacteria 10657
237 Ga0373955_0004020 3300035172 Bacteria 6491
238 Ga0373924_0002032 3300035410 Bacteria 6746
239 Ga0373931_0005827 3300035691 Bacteria 5731
240 Ga0373931_0269353 3300035691 Unclassified 1042
241 Ga0373935_0000053 3300035692 Bacteria 46838
242 Ga0373935_0080964 3300035692 Bacteria 2110
243 Ga0373927_0003990 3300035695 Bacteria 10440
244 Ga0373947_0000259 3300035725 Bacteria 29909
245 Ga0373947_0008990 3300035725 Bacteria 5743
246 Ga0373937_0000030 3300036401 Bacteria 122176
247 Ga0373937_0001504 3300036401 Bacteria 19577
248 Ga0373925_0000002 3300037068 Bacteria 368879
249 Ga0395901_0202179 3300038443 Bacteria 2082
250 Ga0436361_0215031 3300039447 Bacteria 3296
251 Ga0436363_1470421 3300039450 Bacteria 3536
252 Ga0439453_0034500 3300041408 Bacteria 971
253 Ga0450923_021548 3300042125 Bacteria 1257
254 Ga0495617_010417 3300046452 Bacteria 3186
255 Ga0495592_0000046 3300046454 Bacteria 117345
256 Ga0495603_0041876 3300046455 Bacteria 2738
257 Ga0495629_0109823 3300046459 Bacteria 1923
258 Ga0495641_0032073 3300046461 Bacteria 2504
259 Ga0495651_0000822 3300046462 Bacteria 24113
260 Ga0495653_0000006 3300046463 Bacteria 363285
261 Ga0495582_0009777 3300046473 Bacteria 5283
262 Ga0495605_0061804 3300046474 Bacteria 1791
263 Ga0495639_0021663 3300046475 Bacteria 2815
264 Ga0495664_0000002 3300046477 Bacteria 625183
265 Ga0495584_0007918 3300046491 Bacteria 5527
266 Ga0495584_0027883 3300046491 Bacteria 2861
267 Ga0495585_0029021 3300046492 Bacteria 3152
268 Ga0495594_0043634 3300046499 Bacteria 2458
269 Ga0495596_0082971 3300046500 Bacteria 1244
270 Ga0495607_0107361 3300046501 Bacteria 1485
271 Ga0495608_0000006 3300046511 Bacteria 324334
272 Ga0495618_0000034 3300046514 Bacteria 104335
273 Ga0495628_0000002 3300046516 Bacteria 589399
274 Ga0495630_0000662 3300046517 Bacteria 24856
275 Ga0495631_0095328 3300046518 Unclassified 1281
276 Ga0495666_0008724 3300046526 Bacteria 5078
277 Ga0495652_0000004 3300046529 Bacteria 588877
278 Ga0495652_0082915 3300046529 Bacteria 2641
279 Ga0495640_0000007 3300046533 Bacteria 265481
280 Ga0495587_0000031 3300046536 Bacteria 126721
281 Ga0495598_0054624 3300046537 Unclassified 1213
282 Ga0495645_0000003 3300046543 Bacteria 570133
283 Ga0495633_0023669 3300046558 Bacteria 3041
284 Ga0495667_0000002 3300046559 Bacteria 437535
285 Ga0495656_0001123 3300046615 Bacteria 8705
286 Ga0495634_0003222 3300046642 Bacteria 13182
287 Ga0495635_0000022 3300046663 Bacteria 160907
288 Ga0495588_0009021 3300046674 Bacteria 4596
289 Ga0495657_0000276 3300046675 Bacteria 46295
290 Ga0495599_0000001 3300046678 Bacteria 537563
291 Ga0495623_0000094 3300046679 Bacteria 53328
292 Ga0495646_0000007 3300046680 Bacteria 236764
293 Ga0495658_0073046 3300046683 Bacteria 1996
294 Ga0495669_0051052 3300046684 Unclassified 1856
295 Ga0495613_0005203 3300046689 Bacteria 9769
296 Ga0495589_0010363 3300046794 Bacteria 4841
297 Ga0495589_0107634 3300046794 Bacteria 1347
298 Ga0495600_0000033 3300046809 Bacteria 83590
299 Ga0495581_0219075 3300047315 Bacteria 1113
300 Ga0495604_0000005 3300047317 Bacteria 424516
301 Ga0495674_0000003 3300047319 Bacteria 562126
302 Ga0495676_0042033 3300047321 Bacteria 3756
303 Ga0495680_0000091 3300047322 Bacteria 81622
304 Ga0495680_0163346 3300047322 Bacteria 1616
305 Ga0495675_0000064 3300047444 Bacteria 74132
306 Ga0495679_025630 3300047446 Bacteria 1969
307 Ga0495684_0000035 3300047471 Bacteria 107768
308 Ga0495684_0065184 3300047471 Bacteria 2769
309 Ga0495593_0008770 3300047673 Bacteria 5870
310 Ga0495593_0125249 3300047673 Bacteria 1306
311 Ga0495602_0000029 3300048088 Bacteria 142344
312 Ga0495626_0073717 3300048091 Bacteria 1529
313 Ga0496100_0000926 3300048903 Bacteria 14006
314 Ga0496100_0226139 3300048903 Bacteria 1375
315 Ga0496101_0004497 3300048904 Bacteria 8790
316 Ga0496101_0014976 3300048904 Bacteria 5218
317 Ga0496102_0014670 3300048905 Bacteria 6811
318 Ga0496102_0031818 3300048905 Bacteria 4735
319 Ga0496102_0153604 3300048905 Bacteria 2164
320 Ga0496103_0018698 3300048906 Bacteria 4157
321 Ga0496103_0031988 3300048906 Bacteria 3209
322 Ga0496104_0000125 3300048907 Bacteria 71005
323 Ga0496104_0000284 3300048907 Bacteria 44754
324 Ga0496104_0000562 3300048907 Bacteria 31660
325 Ga0496104_0008179 3300048907 Bacteria 9288
326 Ga0496104_0041009 3300048907 Bacteria 4339
327 Ga0496104_0071338 3300048907 Bacteria 3302
328 Ga0496105_0032991 3300048908 Bacteria 4250
329 Ga0496105_0090610 3300048908 Bacteria 2525
330 Ga0496105_0159266 3300048908 Bacteria 1853
331 Ga0496106_0004750 3300048909 Bacteria 10048
332 Ga0496106_0017136 3300048909 Bacteria 5363
333 Ga0496106_0079047 3300048909 Unclassified 2525
334 Ga0496107_0006507 3300048910 Bacteria 8033
335 Ga0496107_0010058 3300048910 Bacteria 6562
336 Ga0496107_0048175 3300048910 Bacteria 3069
337 Ga0496107_0205746 3300048910 Bacteria 1463
338 Ga0496108_0005748 3300048911 Bacteria 10044
339 Ga0496108_0029012 3300048911 Bacteria 4578
340 Ga0496108_0049571 3300048911 Bacteria 3512
341 Ga0496108_0235647 3300048911 Bacteria 1592
342 Ga0496109_0001052 3300048912 Bacteria 22806
343 Ga0496109_0003628 3300048912 Bacteria 12895
344 Ga0496109_0005207 3300048912 Bacteria 10863
345 Ga0496110_0001022 3300048913 Bacteria 19712
346 Ga0496110_0001389 3300048913 Bacteria 17461
347 Ga0496110_0006948 3300048913 Bacteria 9002
348 Ga0496110_0020467 3300048913 Bacteria 5587
349 Ga0496110_0024233 3300048913 Bacteria 5169
350 Ga0496110_0084991 3300048913 Bacteria 2825
351 Ga0496111_0001694 3300048914 Bacteria 12851
352 Ga0496111_0004100 3300048914 Bacteria 9147
353 Ga0496111_0009894 3300048914 Bacteria 6372
354 Ga0496111_0031542 3300048914 Bacteria 3776
355 Ga0496111_0271967 3300048914 Bacteria 1257
356 Ga0496112_0002700 3300048915 Bacteria 14347
357 Ga0496112_0035684 3300048915 Bacteria 4846
358 Ga0496112_0285329 3300048915 Bacteria 1597
359 Ga0496113_0003069 3300048916 Bacteria 9911
360 Ga0496113_0015367 3300048916 Bacteria 5259
361 Ga0496113_0103802 3300048916 Bacteria 2205
362 Ga0496114_0009376 3300048917 Bacteria 7771
363 Ga0496114_0025384 3300048917 Bacteria 4842
364 Ga0496114_0121525 3300048917 Bacteria 2246
365 Ga0496115_0010942 3300048918 Bacteria 6792
366 Ga0496115_0021471 3300048918 Bacteria 4990
367 Ga0501039_0074201 3300049575 Bacteria 2644
368 Ga0501069_0021385 3300049585 Bacteria 3510
369 Ga0501072_0002322 3300049588 Bacteria 14269
370 Ga0501072_0088522 3300049588 Bacteria 2457
371 Ga0501076_0066808 3300049592 Bacteria 2871
372 Ga0501076_0130715 3300049592 Unclassified 2036
373 Ga0501079_0137220 3300049741 Bacteria 1905
374 Ga0501080_0148397 3300049742 Bacteria 2168
375 Ga0501081_0438954 3300049743 Unclassified 969
376 Ga0501045_0301314 3300049824 Bacteria 1193
377 nmdc:mga03683_33540_c1 3300050489 Bacteria 2072
378 nmdc:mga03n38_15637_c1 3300050490 Bacteria 2933
379 nmdc:mga00v17_114111_c1 3300050491 Bacteria 1716
380 nmdc:mga00v17_91496_c1 3300050491 Bacteria 1911
381 nmdc:mga0yw44_28679_c1 3300050492 Bacteria 3205
382 nmdc:mga0yw44_30158_c1 3300050492 Bacteria 3139
383 nmdc:mga0yw44_55628_c1 3300050492 Bacteria 2408
384 nmdc:mga0yw44_580_c1 3300050492 Bacteria 13256
385 nmdc:mga0yw44_9528_c1 3300050492 Bacteria 4918
386 nmdc:mga06z11_7045_c1 3300050494 Bacteria 4610
387 nmdc:mga06z11_72_c1 3300050494 Bacteria 42329
388 nmdc:mga06z11_8819_c1 3300050494 Bacteria 4224
389 nmdc:mga06z11_96710_c1 3300050494 Unclassified 1613
390 nmdc:mga04h51_2108_c1 3300050495 Bacteria 4668
391 nmdc:mga04h51_22045_c1 3300050495 Bacteria 1923
392 nmdc:mga04h51_437_c1 3300050495 Bacteria 10012
393 nmdc:mga07m45_142841_c1 3300050496 Bacteria 1386
394 nmdc:mga07m45_44931_c1 3300050496 Bacteria 2480
395 nmdc:mga07m45_95707_c1 3300050496 Bacteria 1703
396 nmdc:mga05p37_11744_c1 3300050507 Bacteria 10440
397 nmdc:mga05p37_188877_c1 3300050507 Bacteria 2503
398 nmdc:mga05p37_198588_c1 3300050507 Unclassified 2431
399 nmdc:mga05p37_248095_c1 3300050507 Bacteria 2137
400 nmdc:mga05p37_28067_c1 3300050507 Bacteria 6858
401 nmdc:mga05p37_641321_c1 3300050507 Unclassified 1191
402 nmdc:mga05p37_95_c1 3300050507 Bacteria 79379
403 nmdc:mga0qj67_162950_c1 3300050509 Bacteria 1810
404 nmdc:mga0qj67_17835_c1 3300050509 Bacteria 5401
405 nmdc:mga0qj67_6024_c2 3300050509 Bacteria 7436
406 nmdc:mga06r32_244354_c1 3300050510 Bacteria 1782
407 nmdc:mga06r32_3453_c1 3300050510 Bacteria 14113
408 nmdc:mga06r32_46659_c1 3300050510 Bacteria 4134
409 nmdc:mga06r32_69491_c1 3300050510 Bacteria 3404
410 nmdc:mga08y16_327554_c1 3300050511 Bacteria 1576
411 nmdc:mga08y16_3513_c1 3300050511 Bacteria 16273
412 nmdc:mga08y16_48_c1 3300050511 Bacteria 111306
413 nmdc:mga08y16_57472_c1 3300050511 Bacteria 4065
414 nmdc:mga0n895_107849_c1 3300050512 Bacteria 2799
415 nmdc:mga0n895_24758_c1 3300050512 Bacteria 5660
416 nmdc:mga0rr50_139461_c1 3300050513 Bacteria 1949
417 nmdc:mga0a205_102892_c1 3300050515 Bacteria 2754
418 nmdc:mga0a205_245647_c1 3300050515 Bacteria 1670
419 nmdc:mga0sz30_15986_c1 3300050516 Bacteria 2972
420 Ga0495601_0000008 3300053077 Bacteria 362152
421 Ga0495601_0094560 3300053077 Bacteria 1926
422 Ga0495612_0000026 3300053078 Bacteria 111627
423 Ga0495612_0071418 3300053078 Bacteria 1448
424 Ga0495595_0000024 3300053084 Bacteria 108008
425 Ga0495619_0000002 3300053085 Bacteria 530226
426 Ga0495619_0340481 3300053085 Unclassified 1038
427 Ga0500593_000668 3300053117 Bacteria 13064
428 Ga0501084_0194477 3300054114 Bacteria 1711
429 Ga0501082_0072832 3300060353 Bacteria 2959
430 Ga0530510_0106269 3300061734 Bacteria 2054
431 Ga0530510_0289822 3300061734 Bacteria 1224
432 Ga0496102_0365947
433 JGI24743J22301_10000134
434 JGI24750J21931_1009781
435 JGI24748J21848_1004319
436 JGI24744J21845_10023508
437 JGI24751J29686_10004776
438 JGI25153J46596_10017257
439 Ga0070690_100011774
440 Ga0070677_10028732
441 Ga0070666_10126086
442 Ga0068868_100006163
443 Ga0068868_100045901
444 Ga0070660_100043526
445 Ga0070689_100023589
446 Ga0070687_100010048
447 Ga0070687_100038525
448 Ga0070661_100090278
449 Ga0070668_100069379
450 Ga0070668_100093959
451 Ga0070669_100023749
452 Ga0070669_100315792
453 Ga0070675_100087501
454 Ga0070671_100051614
455 Ga0070671_100246642
456 Ga0070674_100020639
457 Ga0070674_100111116
458 Ga0070673_100008514
459 Ga0070673_100120940
460 Ga0070673_100266677
461 Ga0070673_100291025
462 Ga0070688_100004710
463 Ga0070659_100033303
464 Ga0070667_100006086
465 Ga0070709_10159905
466 Ga0070714_100123786
467 Ga0070713_100143033
468 Ga0070713_100184341
469 Ga0070710_10078232
470 Ga0070710_10109011
471 Ga0070701_10000544
472 Ga0070700_100049913
473 Ga0070708_100126569
474 Ga0070678_100108856
475 Ga0070662_100028650
476 Ga0070662_100305438
477 Ga0070685_10001171
478 Ga0070685_10046289
479 Ga0070707_100265473
480 Ga0070699_100134298
481 Ga0070697_100205258
482 Ga0070686_100021561
483 Ga0070693_100049246
484 Ga0070665_100074831
485 Ga0068857_100059722
486 Ga0068856_100085309
487 Ga0068859_100034104
488 Ga0068864_100391962
489 Ga0068864_100450319
490 Ga0068866_10011316
491 Ga0068870_10005222
492 Ga0068863_100076239
493 Ga0068858_100016071
494 Ga0068858_100163100
495 Ga0068860_100120553
496 Ga0068860_100342572
497 Ga0068862_100009817
498 Ga0068862_100011484
499 Ga0081455_10005331
500 Ga0081455_10006671
501 Ga0081455_10010899
502 Ga0081538_10011656
503 Ga0081538_10097363
504 Ga0081540_1000234
505 Ga0081540_1002931
506 Ga0075365_10001017
507 Ga0075365_10005416
508 Ga0075365_10006487
509 Ga0075365_10007361
510 Ga0075365_10017005
511 Ga0075365_10046211
512 Ga0075368_10001006
513 Ga0075368_10008746
514 Ga0075364_10030953
515 Ga0075364_10152744
516 Ga0070715_10008794
517 Ga0070716_100067823
518 Ga0070712_100040265
519 Ga0070712_100198971
520 Ga0075367_10001020
521 Ga0075366_10010988
522 Ga0075366_10039101
523 Ga0075370_10123249
524 Ga0068871_100144068
525 Ga0075428_100001027
526 Ga0075428_100001811
527 Ga0075428_100018626
528 Ga0075428_100023291
529 Ga0075428_100027998
530 Ga0075428_100223973
531 Ga0075428_100275898
532 Ga0075428_100289784
533 Ga0075428_100445482
534 Ga0075430_100016889
535 Ga0075430_100060296
536 Ga0075430_100069213
537 Ga0075430_100127931
538 Ga0075430_100151831
539 Ga0075430_100177290
540 Ga0075431_100000017
541 Ga0075431_100015775
542 Ga0075431_100167839
543 Ga0075433_10193495
544 Ga0075434_100096058
545 Ga0075429_100029204
546 Ga0075429_100296462
547 Ga0068865_100016491
548 Ga0097620_100034104
549 Ga0075435_100105250
550 Ga0075435_100191623
551 Ga0075435_100368657
552 Ga0099794_10005354
553 Ga0111539_10000735
554 Ga0111539_10005279
555 Ga0111539_10008813
556 Ga0111539_10024707
557 Ga0111539_10044534
558 Ga0105245_10003514
559 Ga0105245_10089243
560 Ga0105247_10013728
561 Ga0105247_10128646
562 Ga0114129_10000025
563 Ga0114129_10010935
564 Ga0114129_10033614
565 Ga0114129_10033877
566 Ga0114129_10199019
567 Ga0114129_10289441
568 Ga0114129_10335296
569 Ga0114129_10577589
570 Ga0114129_10694246
571 Ga0114129_10732396
572 Ga0105243_10022050
573 Ga0105243_10118815
574 Ga0105242_10035437
575 Ga0105242_10123898
576 Ga0105248_10039516
577 Ga0105248_10449031
578 Ga0105237_10023351
579 Ga0105249_10017765
580 Ga0099796_10008826
581 Ga0105239_10080053
582 Ga0105239_10248594
583 Ga0105246_10108802
584 Ga0105246_10120795
585 Ga0157374_10012484
586 Ga0157374_10314988
587 Ga0157378_10050673
588 Ga0157378_10327393
589 Ga0163162_10095522
590 Ga0163162_10455634
591 Ga0157375_10773665
592 Ga0163163_10076849
593 Ga0157380_10011968
594 Ga0157380_10235172
595 Ga0157380_10281816
596 Ga0157377_10005862
597 Ga0157379_10083270
598 Ga0163161_10009501
599 Ga0209758_1001142
600 Ga0207682_10044183
601 Ga0207642_10000663
602 Ga0207710_10010160
603 Ga0207688_10000130
604 Ga0207680_10104718
605 Ga0207643_10001981
606 Ga0207693_10152167
607 Ga0207662_10007851
608 Ga0207662_10120208
609 Ga0207659_10034183
610 Ga0207659_10099576
611 Ga0207687_10005289
612 Ga0207687_10050603
613 Ga0207644_10080812
614 Ga0207706_10059109
615 Ga0207706_10276741
616 Ga0207709_10010956
617 Ga0207670_10027646
618 Ga0207665_10175455
619 Ga0207691_10011407
620 Ga0207711_10077462
621 Ga0207711_10530414
622 Ga0207689_10000756
623 Ga0207689_10241617
624 Ga0207679_10029360
625 Ga0207651_10007290
626 Ga0207651_10210123
627 Ga0207651_10249182
628 Ga0207668_10015491
629 Ga0207668_10059754
630 Ga0207668_10168986
631 Ga0207658_10025101
632 Ga0207677_10006114
633 Ga0207677_10009005
634 Ga0207703_10088324
635 Ga0207703_10192409
636 Ga0207678_10014386
637 Ga0207708_10004345
638 Ga0207641_10011439
639 Ga0207641_10048362
640 Ga0207676_10089028
641 Ga0207675_100008646
642 Ga0207675_100141151
643 Ga0207683_10014227
644 Ga0209813_10002457
645 Ga0207428_10001198
646 Ga0207428_10030563
647 Ga0207428_10195574
648 Ga0268265_10022622
649 Ga0268265_10086943
650 Ga0265339_10038511
651 Ga0265331_10107680
652 Ga0265316_10104875
653 Ga0265313_10038585
654 Ga0373926_0029467
655 Ga0373928_0021596
656 Ga0373934_0085385
657 Ga0373944_0016764
658 Ga0373923_0008125
659 Ga0373936_0000543
660 Ga0373936_0026551
661 Ga0373941_0008740
662 Ga0373953_0002974
663 Ga0373954_0001388
664 Ga0373956_0020897
665 Ga0373943_0009939
666 Ga0373946_0005078
667 Ga0373955_0001296
668 Ga0373955_0004020
669 Ga0373924_0002032
670 Ga0373931_0005827
671 Ga0373931_0269353
672 Ga0373935_0000053
673 Ga0373935_0080964
674 Ga0373927_0003990
675 Ga0373947_0000259
676 Ga0373947_0008990
677 Ga0373937_0000030
678 Ga0373937_0001504
679 Ga0373925_0000002
680 Ga0395901_0202179
681 Ga0436361_0215031
682 Ga0436363_1470421
683 Ga0439453_0034500
684 Ga0450923_021548
685 Ga0495617_010417
686 Ga0495592_0000046
687 Ga0495603_0041876
688 Ga0495629_0109823
689 Ga0495641_0032073
690 Ga0495651_0000822
691 Ga0495653_0000006
692 Ga0495582_0009777
693 Ga0495605_0061804
694 Ga0495639_0021663
695 Ga0495664_0000002
696 Ga0495584_0007918
697 Ga0495584_0027883
698 Ga0495585_0029021
699 Ga0495594_0043634
700 Ga0495596_0082971
701 Ga0495607_0107361
702 Ga0495608_0000006
703 Ga0495618_0000034
704 Ga0495628_0000002
705 Ga0495630_0000662
706 Ga0495631_0095328
707 Ga0495666_0008724
708 Ga0495652_0000004
709 Ga0495652_0082915
710 Ga0495640_0000007
711 Ga0495587_0000031
712 Ga0495598_0054624
713 Ga0495645_0000003
714 Ga0495633_0023669
715 Ga0495667_0000002
716 Ga0495656_0001123
717 Ga0495634_0003222
718 Ga0495635_0000022
719 Ga0495588_0009021
720 Ga0495657_0000276
721 Ga0495599_0000001
722 Ga0495623_0000094
723 Ga0495646_0000007
724 Ga0495658_0073046
725 Ga0495669_0051052
726 Ga0495613_0005203
727 Ga0495589_0010363
728 Ga0495589_0107634
729 Ga0495600_0000033
730 Ga0495581_0219075
731 Ga0495604_0000005
732 Ga0495674_0000003
733 Ga0495676_0042033
734 Ga0495680_0000091
735 Ga0495680_0163346
736 Ga0495675_0000064
737 Ga0495679_025630
738 Ga0495684_0000035
739 Ga0495684_0065184
740 Ga0495593_0008770
741 Ga0495593_0125249
742 Ga0495602_0000029
743 Ga0495626_0073717
744 Ga0496100_0000926
745 Ga0496100_0226139
746 Ga0496101_0004497
747 Ga0496101_0014976
748 Ga0496102_0014670
749 Ga0496102_0031818
750 Ga0496102_0153604
751 Ga0496103_0018698
752 Ga0496103_0031988
753 Ga0496104_0000125
754 Ga0496104_0000284
755 Ga0496104_0000562
756 Ga0496104_0008179
757 Ga0496104_0041009
758 Ga0496104_0071338
759 Ga0496105_0032991
760 Ga0496105_0090610
761 Ga0496105_0159266
762 Ga0496106_0004750
763 Ga0496106_0017136
764 Ga0496106_0079047
765 Ga0496107_0006507
766 Ga0496107_0010058
767 Ga0496107_0048175
768 Ga0496107_0205746
769 Ga0496108_0005748
770 Ga0496108_0029012
771 Ga0496108_0049571
772 Ga0496108_0235647
773 Ga0496109_0001052
774 Ga0496109_0003628
775 Ga0496109_0005207
776 Ga0496110_0001022
777 Ga0496110_0001389
778 Ga0496110_0006948
779 Ga0496110_0020467
780 Ga0496110_0024233
781 Ga0496110_0084991
782 Ga0496111_0001694
783 Ga0496111_0004100
784 Ga0496111_0009894
785 Ga0496111_0031542
786 Ga0496111_0271967
787 Ga0496112_0002700
788 Ga0496112_0035684
789 Ga0496112_0285329
790 Ga0496113_0003069
791 Ga0496113_0015367
792 Ga0496113_0103802
793 Ga0496114_0009376
794 Ga0496114_0025384
795 Ga0496114_0121525
796 Ga0496115_0010942
797 Ga0496115_0021471
798 Ga0501039_0074201
799 Ga0501069_0021385
800 Ga0501072_0002322
801 Ga0501072_0088522
802 Ga0501076_0066808
803 Ga0501076_0130715
804 Ga0501079_0137220
805 Ga0501080_0148397
806 Ga0501081_0438954
807 Ga0501045_0301314
808 nmdc:mga03683_33540_c1
809 nmdc:mga03n38_15637_c1
810 nmdc:mga00v17_114111_c1
811 nmdc:mga00v17_91496_c1
812 nmdc:mga0yw44_28679_c1
813 nmdc:mga0yw44_30158_c1
814 nmdc:mga0yw44_55628_c1
815 nmdc:mga0yw44_580_c1
816 nmdc:mga0yw44_9528_c1
817 nmdc:mga06z11_7045_c1
818 nmdc:mga06z11_72_c1
819 nmdc:mga06z11_8819_c1
820 nmdc:mga06z11_96710_c1
821 nmdc:mga04h51_2108_c1
822 nmdc:mga04h51_22045_c1
823 nmdc:mga04h51_437_c1
824 nmdc:mga07m45_142841_c1
825 nmdc:mga07m45_44931_c1
826 nmdc:mga07m45_95707_c1
827 nmdc:mga05p37_11744_c1
828 nmdc:mga05p37_188877_c1
829 nmdc:mga05p37_198588_c1
830 nmdc:mga05p37_248095_c1
831 nmdc:mga05p37_28067_c1
832 nmdc:mga05p37_641321_c1
833 nmdc:mga05p37_95_c1
834 nmdc:mga0qj67_162950_c1
835 nmdc:mga0qj67_17835_c1
836 nmdc:mga0qj67_6024_c2
837 nmdc:mga06r32_244354_c1
838 nmdc:mga06r32_3453_c1
839 nmdc:mga06r32_46659_c1
840 nmdc:mga06r32_69491_c1
841 nmdc:mga08y16_327554_c1
842 nmdc:mga08y16_3513_c1
843 nmdc:mga08y16_48_c1
844 nmdc:mga08y16_57472_c1
845 nmdc:mga0n895_107849_c1
846 nmdc:mga0n895_24758_c1
847 nmdc:mga0rr50_139461_c1
848 nmdc:mga0a205_102892_c1
849 nmdc:mga0a205_245647_c1
850 nmdc:mga0sz30_15986_c1
851 Ga0495601_0000008
852 Ga0495601_0094560
853 Ga0495612_0000026
854 Ga0495612_0071418
855 Ga0495595_0000024
856 Ga0495619_0000002
857 Ga0495619_0340481
858 Ga0500593_000668
859 Ga0501084_0194477
860 Ga0501082_0072832
861 Ga0530510_0106269
862 Ga0530510_0289822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13180

PDZ_2

PDZ domain

203

283

0.97

PF13365

Trypsin_2

Trypsin-like peptidase domain

19

159

0.85

PF17820

PDZ_6

PDZ domain

217

272

0.85

PF00595

PDZ

PDZ domain

197

271

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4c2h-assembly1.cif.gz_B crystal structure of the ctpb(v118y) mutant 0.8837 269 352
7xfu-assembly1.cif.gz_B mucp pdz2 domain with peptide gpavla 0.8754 284 349
4c2g-assembly1.cif.gz_A-2 crystal structure of ctpb(s309a) in complex with a peptide having a val-pro-ala c-terminus 0.8727 268 351
4c2d-assembly1.cif.gz_B crystal structure of the protease ctpb in an active state 0.8631 266 350
3id3-assembly1.cif.gz_B crystal structure of rsep pdz2 i304a domain 0.862 284 353
ID Description Score Start End Superfamily
af_Q4D678_1000_1086_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9315 273 353 2.30.42.10
1ky9A01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9133 70 157 2.40.10.10
3mh4B01 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.9097 68 156 2.40.10.10
af_E9QI54_87_183_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.9052 266 323 2.30.42.10
af_P0C0V0_287_387_2.30.42.10 Mainly Beta;Roll;Pdz3 Domain;PDZ domain 0.8992 269 352 2.30.42.10
ID Description Score Start End GO Terms
AF-A0A536Z9N9-F1-model_v4 Serine protease 0.9656 91 222 GO:0006508
GO:0008233
AF-A0A1H6BSU9-F1-model_v4 Serine protease, S1-C subfamily, contains C-terminal PDZ domain 0.9622 67 358 GO:0004252
GO:0006508
AF-A0A435VK63-F1-model_v4 deleted 0.9573 253 358
AF-A0A1J5P7Z4-F1-model_v4 Serine endoprotease 0.9455 246 358 GO:0006508
GO:0008233
AF-A0A1H6BSU9-F1-model_v4 Serine protease, S1-C subfamily, contains C-terminal PDZ domain 0.9247 67 358 GO:0004252
GO:0006508

Map