F442388

General Info

Members Datasets Scaffolds Average Seq Length
431 219 193 422

Family's Representative Sequence

Representative Sequence 3300027462|Ga0210000_1004091|Ga0210000_10040912
Length 452
Sequence MAKKGVYLPCTPFIHLGVGRMKMKIDIIKDQVRKHDDTQGETLDLLNSTQFIIKEAVEKLGYSDAMYELLKEPLRIITVRIPVRMDDGSTKIFIGYRSQHNDAVGPTKGGVRFHPEVNEKEVKALSMWMSLKCGIFDLPYGGGKGGIVCDPRSMSSFELERLSRGYVRAISQIVGPTKDIPAPDVFTNPQIMAWMMDEYSRIQEFDSPGFITGKPIVLGGSQGRETATATGVTICIEEAAKRKGIPLRDARVIIQGFGNAGSYLAKFMQDAGAKVIGISDALGALYDPEGIDIDYLLERRDSFGTVTNLFKNVITNQELLEKECEILVPAAISNQITRENADRIKAKIVVEAANGPTTLEATNILTKRNILLVPDVLASSGGVTVSYFEWVQNNQGYYWSEEEVAQKLRSKIVESFERVFSTSQTYQVDMRLAAYMVGIRKMAEASQFRGWI

Samples

Sample ID Description Type Environment
1 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
2 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
3 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
4 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
5 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
6 2554235283 Bacillus safensis VK Isolate Rhizosphere
7 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
8 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
9 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
10 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
11 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
12 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
13 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
14 2643221729 Bacillus sp. Root11 Isolate Unclassified
15 2643221730 Bacillus sp. Root131 Isolate Unclassified
16 2643221731 Bacillus sp. Root147 Isolate Unclassified
17 2643221732 Bacillus sp. Root239 Isolate Unclassified
18 2643221735 Bacillus sp. Root920 Isolate Unclassified
19 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
20 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
21 2671180694 Paenibacillus sp. A3 Isolate Unclassified
22 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
23 2684622632 Bacillus cereus 905 Isolate Unclassified
24 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
25 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
26 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
27 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
28 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
29 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
30 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
31 2738541295 Bacillus sp. OK085 Isolate Unclassified
32 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
33 2738541358 Bacillus sp. OV752 Isolate Unclassified
34 2738543006 Bacillus sp. OK077 Isolate Unclassified
35 2738543010 Bacillus sp. YR335 Isolate Unclassified
36 2738543017 Bacillus sp. OV186 Isolate Unclassified
37 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
38 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
39 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
40 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
41 2808606364 Bacillus sp. SLBN-3 Isolate Unclassified
42 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
43 2811994870 Bacillus sp. JB4 Isolate Unclassified
44 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
45 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
46 2818991441 Niallia circulans 3243 Isolate Rhizosphere
47 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
48 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
49 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
50 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
51 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
52 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
53 2842682962 Bacillus sp. R-72492 Isolate Unclassified
54 2842882022 Bacillus sp. R-71893 Isolate Unclassified
55 2849139964 Bacillus sp. R-71875 Isolate Unclassified
56 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
57 2857581216 Bacillus sp. R-71922 Isolate Unclassified
58 2857586860 Bacillus sp. R-71935 Isolate Unclassified
59 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
60 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
61 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
62 2860837431 Bacillus sp. WR11 Isolate Unclassified
63 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
64 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
65 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
66 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
67 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
68 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
69 2898907183 Brevibacillus sp. SYP-B805 Isolate Rhizosphere
70 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
71 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
72 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
73 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
74 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
75 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
76 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
77 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
78 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
79 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
80 2919720352 Priestia megaterium 4340 Isolate Unclassified
81 2919726948 Bacillus pumilus 4489 Isolate Unclassified
82 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
83 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
84 2929004312 Priestia megaterium 1104 Isolate Unclassified
85 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
86 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
87 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
88 2938917290 Bacillus sp. CR71 Isolate Unclassified
89 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
90 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
91 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
92 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
93 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
94 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
95 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
96 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
97 2965761152 Bacillus sp. COPE52 Isolate Unclassified
98 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
99 2969141011 Bacillus velezensis MH25 Isolate Unclassified
100 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
101 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
102 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
103 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
104 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
105 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
106 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
107 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
108 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
109 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
110 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
111 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
112 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
113 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
114 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
115 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
116 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
117 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
118 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
119 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
120 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
121 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
122 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
123 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
124 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
125 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
126 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
127 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
128 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
129 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
130 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
131 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
132 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
133 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
134 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
135 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
136 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
137 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
138 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
139 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
140 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
146 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
149 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
165 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
168 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
169 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
170 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
171 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
172 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
173 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
194 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
195 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
196 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
197 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
203 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
204 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
205 8022653035 Bacillus sp. Rc4 Isolate Unclassified
206 8022792930 Bacillus sp. Xin Isolate Rhizosphere
207 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
208 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
209 8022948649 Bacillus endophyticus FH5 Isolate Rhizosphere
210 8023438354 Bacillus sp. BH2 Isolate Unclassified
211 8023444577 Bacillus sp. BH32 Isolate Unclassified
212 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
213 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
214 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
215 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
216 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
217 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
218 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
219 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 42.92
Metatranscriptomes 2.55
Isolates 54.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.76
Nodule 0
Rhizoplane 12.3
Rhizosphere 40.14
Stem 0
Stem Tuber 0
Unclassified 34.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1002835 3300002987 Bacteria 6371
2 JGI25159J45721_1011906 3300002987 Bacteria 2104
3 JGI25151J46595_10000006 3300003187 Bacteria 419711
4 JGI25151J46595_10001503 3300003187 Bacteria 15649
5 JGI25151J46595_10003005 3300003187 Bacteria 9580
6 JGI25151J46595_10004470 3300003187 Bacteria 7396
7 JGI25151J46595_10008483 3300003187 Bacteria 4939
8 JGI25151J46595_10011011 3300003187 Bacteria 4176
9 JGI25151J46595_10014009 3300003187 Bacteria 3590
10 JGI25151J46595_10020856 3300003187 Bacteria 2754
11 JGI25151J46595_10031477 3300003187 Bacteria 2072
12 JGI25151J46595_10037479 3300003187 Bacteria 1818
13 rootH1_10016587 3300003316 Bacteria 9471
14 rootH1_10073906 3300003316 Bacteria 1767
15 rootL2_10014752 3300003322 Bacteria 32038
16 rootL2_10049823 3300003322 Bacteria 5707
17 Ga0006562J51391_1000764 3300003578 Bacteria 5101
18 Ga0006562J51391_1001638 3300003578 Bacteria 18540
19 Ga0006562J51391_1002322 3300003578 Bacteria 1420
20 Ga0006562J51391_1007192 3300003578 Bacteria 1344
21 Ga0006562J51391_1013112 3300003578 Bacteria 2430
22 Ga0006562J51391_1015130 3300003578 Bacteria 3409
23 Ga0055538_1000167 3300003751 Bacteria 42805
24 Ga0055532_1000024 3300003758 Bacteria 244166
25 Ga0055532_1000079 3300003758 Bacteria 121008
26 Ga0055528_1003593 3300003790 Bacteria 7723
27 Ga0070671_100027902 3300005355 Bacteria 4648
28 Ga0070699_100015026 3300005518 Bacteria 6653
29 Ga0105251_10021982 3300009011 Bacteria 3320
30 Ga0105244_10006357 3300009036 Bacteria 7673
31 Ga0105244_10011396 3300009036 Bacteria 5335
32 Ga0105250_10003916 3300009092 Bacteria 6954
33 Ga0105250_10005181 3300009092 Bacteria 5881
34 Ga0105250_10006272 3300009092 Bacteria 5214
35 Ga0105245_10060345 3300009098 Bacteria 3415
36 Ga0105247_10028387 3300009101 Bacteria 3386
37 Ga0105243_10001131 3300009148 Bacteria 24184
38 Ga0105242_10001620 3300009176 Bacteria 17736
39 Ga0105246_10017881 3300011119 Bacteria 4511
40 Ga0105246_10079418 3300011119 Bacteria 2333
41 Ga0157374_10015570 3300013296 Bacteria 6673
42 Ga0157378_10011320 3300013297 Bacteria 7806
43 Ga0157378_10143513 3300013297 Bacteria 2219
44 Ga0157377_10023395 3300014745 Bacteria 3274
45 Ga0157377_10080852 3300014745 Bacteria 1899
46 Ga0209784_100061 3300025224 Bacteria 164590
47 Ga0209147_100014 3300025229 Bacteria 597841
48 Ga0209147_100020 3300025229 Bacteria 474055
49 Ga0209147_100301 3300025229 Bacteria 40707
50 Ga0209147_101118 3300025229 Bacteria 11104
51 Ga0209147_103082 3300025229 Bacteria 3488
52 Ga0209673_1002559 3300025273 Bacteria 12389
53 Ga0209673_1003357 3300025273 Bacteria 9551
54 Ga0209130_1000390 3300025284 Bacteria 48415
55 Ga0209130_1001340 3300025284 Bacteria 16657
56 Ga0209130_1001398 3300025284 Bacteria 16128
57 Ga0209130_1001670 3300025284 Bacteria 13528
58 Ga0209676_1000274 3300025292 Bacteria 107505
59 Ga0209676_1000808 3300025292 Bacteria 40975
60 Ga0209676_1000940 3300025292 Bacteria 35862
61 Ga0209025_1000001 3300025294 Bacteria 1888151
62 Ga0209025_1000041 3300025294 Bacteria 373694
63 Ga0209025_1000043 3300025294 Bacteria 350458
64 Ga0209025_1000258 3300025294 Bacteria 124837
65 Ga0209025_1000457 3300025294 Bacteria 79829
66 Ga0209025_1000851 3300025294 Bacteria 48307
67 Ga0209025_1000939 3300025294 Bacteria 44365
68 Ga0209025_1001121 3300025294 Bacteria 38358
69 Ga0209025_1002359 3300025294 Bacteria 20286
70 Ga0209025_1002492 3300025294 Bacteria 19368
71 Ga0209025_1002733 3300025294 Bacteria 17868
72 Ga0209025_1003649 3300025294 Bacteria 14266
73 Ga0209025_1004262 3300025294 Bacteria 12574
74 Ga0209025_1006279 3300025294 Bacteria 9295
75 Ga0209025_1006597 3300025294 Bacteria 8945
76 Ga0209025_1007551 3300025294 Bacteria 8068
77 Ga0209025_1011409 3300025294 Bacteria 5859
78 Ga0209025_1012296 3300025294 Bacteria 5508
79 Ga0209025_1016806 3300025294 Bacteria 4280
80 Ga0209025_1039398 3300025294 Bacteria 2061
81 Ga0207426_1005888 3300025302 Bacteria 5456
82 Ga0207696_1001757 3300025711 Bacteria 11208
83 Ga0207696_1003470 3300025711 Bacteria 7167
84 Ga0207696_1004131 3300025711 Bacteria 6347
85 Ga0207696_1005203 3300025711 Bacteria 5443
86 Ga0207655_1000139 3300025728 Bacteria 139835
87 Ga0207655_1004612 3300025728 Bacteria 9693
88 Ga0207655_1042808 3300025728 Bacteria 1923
89 Ga0207713_1001305 3300025735 Bacteria 20472
90 Ga0207713_1005799 3300025735 Bacteria 7643
91 Ga0207709_10004833 3300025935 Bacteria 7722
92 Ga0210000_1004091 3300027462 Bacteria 2107
93 Ga0237817_10045 3300030083 Bacteria 42887
94 Ga0237817_10271 3300030083 Bacteria 12103
95 Ga0307408_100095700 3300031548 Bacteria 2251
96 Ga0307412_10055797 3300031911 Bacteria 2630
97 Ga0307409_100011909 3300031995 Bacteria 5511
98 Ga0307409_100023207 3300031995 Bacteria 4293
99 Ga0307416_100018146 3300032002 Bacteria 4949
100 Ga0307416_100114910 3300032002 Bacteria 2382
101 Ga0307416_100148416 3300032002 Bacteria 2146
102 Ga0395899_0039193 3300037312 Bacteria 3548
103 Ga0395900_0041096 3300037418 Bacteria 4768
104 Ga0395900_0043160 3300037418 Bacteria 4647
105 Ga0395900_0133225 3300037418 Bacteria 2546
106 Ga0395900_0297412 3300037418 Bacteria 1601
107 Ga0395898_0015269 3300037466 Bacteria 7879
108 Ga0395898_0263859 3300037466 Bacteria 1643
109 Ga0395898_0307403 3300037466 Bacteria 1512
110 Ga0395905_0106539 3300037471 Bacteria 2632
111 Ga0395901_0044817 3300038443 Bacteria 4588
112 Ga0395901_0083772 3300038443 Bacteria 3333
113 Ga0395901_0091515 3300038443 Bacteria 3184
114 Ga0237819_00041 3300038705 Bacteria 45359
115 Ga0439439_0004489 3300041406 Bacteria 3151
116 Ga0439449_0006050 3300042007 Bacteria 4624
117 Ga0439462_0035221 3300042015 Bacteria 1330
118 Ga0466967_0024891 3300045976 Bacteria 4928
119 Ga0495603_0041027 3300046455 Bacteria 2768
120 Ga0495584_0066161 3300046491 Bacteria 1818
121 Ga0495585_0008228 3300046492 Bacteria 6331
122 Ga0495660_0024777 3300046810 Bacteria 3415
123 Ga0495626_0053584 3300048091 Bacteria 1856
124 Ga0496100_0003063 3300048903 Bacteria 8638
125 Ga0496100_0137774 3300048903 Bacteria 1726
126 Ga0496101_0003933 3300048904 Bacteria 9284
127 Ga0496101_0005314 3300048904 Bacteria 8199
128 Ga0496102_0018569 3300048905 Bacteria 6114
129 Ga0496102_0035859 3300048905 Bacteria 4467
130 Ga0496102_0036544 3300048905 Bacteria 4425
131 Ga0496102_0037813 3300048905 Bacteria 4354
132 Ga0496102_0108434 3300048905 Bacteria 2587
133 Ga0496103_0004032 3300048906 Bacteria 8922
134 Ga0496103_0005212 3300048906 Bacteria 7811
135 Ga0496103_0039065 3300048906 Bacteria 2915
136 Ga0496103_0168288 3300048906 Bacteria 1407
137 Ga0496104_0000392 3300048907 Bacteria 38243
138 Ga0496104_0007521 3300048907 Bacteria 9628
139 Ga0496105_0000161 3300048908 Bacteria 44611
140 Ga0496105_0001185 3300048908 Bacteria 18141
141 Ga0496106_0000531 3300048909 Bacteria 27055
142 Ga0496106_0002706 3300048909 Bacteria 13149
143 Ga0496107_0000662 3300048910 Bacteria 19483
144 Ga0496107_0001826 3300048910 Bacteria 13434
145 Ga0496107_0032044 3300048910 Bacteria 3755
146 Ga0496108_0002589 3300048911 Bacteria 14492
147 Ga0496108_0006128 3300048911 Bacteria 9731
148 Ga0496109_0002688 3300048912 Bacteria 14910
149 Ga0496109_0003003 3300048912 Bacteria 14096
150 Ga0496109_0046762 3300048912 Bacteria 3932
151 Ga0496110_0001513 3300048913 Bacteria 16864
152 Ga0496110_0008329 3300048913 Bacteria 8342
153 Ga0496110_0012804 3300048913 Bacteria 6908
154 Ga0496110_0015955 3300048913 Bacteria 6264
155 Ga0496110_0017190 3300048913 Bacteria 6047
156 Ga0496110_0131687 3300048913 Bacteria 2259
157 Ga0496111_0000453 3300048914 Bacteria 20871
158 Ga0496111_0002071 3300048914 Bacteria 11951
159 Ga0496111_0003913 3300048914 Bacteria 9334
160 Ga0496111_0011673 3300048914 Bacteria 5928
161 Ga0496111_0020805 3300048914 Bacteria 4574
162 Ga0496111_0096749 3300048914 Bacteria 2167
163 Ga0496112_0001416 3300048915 Bacteria 18345
164 Ga0496112_0003385 3300048915 Bacteria 13169
165 Ga0496112_0018463 3300048915 Bacteria 6568
166 Ga0496112_0064468 3300048915 Bacteria 3615
167 Ga0496112_0081905 3300048915 Bacteria 3192
168 Ga0496112_0096639 3300048915 Bacteria 2924
169 Ga0496113_0009952 3300048916 Bacteria 6265
170 Ga0496113_0013096 3300048916 Bacteria 5602
171 Ga0496113_0039926 3300048916 Bacteria 3456
172 Ga0496115_0188179 3300048918 Bacteria 1706
173 Ga0496115_0219301 3300048918 Bacteria 1570
174 Ga0496116_0018574 3300048919 Bacteria 5352
175 Ga0496116_0020571 3300048919 Bacteria 5009
176 Ga0496116_0063545 3300048919 Bacteria 2378
177 Ga0496117_0011347 3300048920 Bacteria 7987
178 Ga0496118_0099976 3300048921 Bacteria 1963
179 Ga0496119_0001898 3300048922 Bacteria 24001
180 Ga0496119_0008211 3300048922 Bacteria 9232
181 Ga0496122_0015185 3300048925 Bacteria 7378
182 Ga0496122_0107580 3300048925 Bacteria 1842
183 Ga0496124_0130187 3300048927 Bacteria 2000
184 Ga0496125_0003126 3300048928 Bacteria 20574
185 Ga0496126_0004921 3300048929 Bacteria 15589
186 Ga0496126_0127344 3300048929 Bacteria 2203
187 Ga0501341_01029 3300049131 Bacteria 1325
188 Ga0501305_001474 3300049161 Bacteria 2312
189 Ga0501312_007918 3300049528 Bacteria 1366
190 Ga0501315_004499 3300049531 Bacteria 1462
191 Ga0501336_001730 3300049552 Bacteria 1339
192 Ga0501217_002039 3300049661 Bacteria 3908
193 Ga0501217_011587 3300049661 Bacteria 1953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005518 Ga0070699_100015026 Ga0070699_1000150266 366
2 3300037466 Ga0395898_0307403 Ga0395898_0307403_32_1138 366
3 3300014745 Ga0157377_10080852 Ga0157377_100808523 377
4 iso_pu_bacteria 2540341094 2540607231 389
5 iso_pu_bacteria 2837183177 2837183516 407
6 3300037312 Ga0395899_0039193 Ga0395899_0039193_960_2192 408
7 3300037418 Ga0395900_0043160 Ga0395900_0043160_3107_4339 408
8 3300037418 Ga0395900_0133225 Ga0395900_0133225_1070_2302 408
9 3300037418 Ga0395900_0297412 Ga0395900_0297412_342_1574 408
10 3300037471 Ga0395905_0106539 Ga0395905_0106539_510_1742 408
11 3300038443 Ga0395901_0083772 Ga0395901_0083772_1179_2411 408
12 3300038443 Ga0395901_0091515 Ga0395901_0091515_227_1459 408
13 iso_pu_bacteria 2977254563 2977256046 409
14 iso_pu_bacteria 2512564039 2512732502 410
15 iso_pu_bacteria 2738541299 2738838005 410
16 iso_pu_bacteria 2788500588 2791214993 410
17 iso_pu_bacteria 2808606364 2808869935 410
18 iso_pu_bacteria 2818991451 2819629777 410
19 iso_pu_bacteria 2857604169 2857604709 410
20 iso_pu_bacteria 2857609550 2857609557 410
21 iso_pu_bacteria 2889295896 2889297199 410
22 iso_pu_bacteria 2904606771 2904610175 410
23 iso_pu_bacteria 2939593269 2939598013 410
24 iso_pu_bacteria 2981284811 2981285677 410
25 iso_pu_bacteria 2981289755 2981290624 410
26 iso_pu_bacteria 2981980479 2981980753 410
27 iso_pu_bacteria 2981985349 2981985631 410
28 iso_pu_bacteria 3001267043 3001268958 410
29 iso_pu_bacteria 3006973921 3006976437 410
30 iso_pu_bacteria 3006988479 3006993047 410
31 iso_pu_bacteria 8055531788 8055536092 410
32 iso_pu_bacteria 8057977335 8057978921 411
33 iso_pu_bacteria 2888578766 2888581141 412
34 iso_pu_bacteria 2889049205 2889050180 412
35 iso_pu_bacteria 2904113452 2904118263 412
36 iso_pu_bacteria 8057733483 8057739534 412
37 3300003316 rootH1_10073906 rootH1_100739061 413
38 3300003751 Ga0055538_1000167 Ga0055538_10001672 414
39 3300025224 Ga0209784_100061 Ga0209784_100061172 414
40 3300025292 Ga0209676_1000808 Ga0209676_100080835 414
41 3300025294 Ga0209025_1006279 Ga0209025_10062792 414
42 3300025294 Ga0209025_1006597 Ga0209025_10065976 414
43 3300003187 JGI25151J46595_10031477 JGI25151J46595_100314771 415
44 3300025229 Ga0209147_101118 Ga0209147_10111811 415
45 3300025294 Ga0209025_1003649 Ga0209025_10036495 415
46 3300037418 Ga0395900_0041096 Ga0395900_0041096_1396_2643 415
47 3300037466 Ga0395898_0015269 Ga0395898_0015269_3052_4299 415
48 3300038443 Ga0395901_0044817 Ga0395901_0044817_1647_2894 415
49 3300048919 Ga0496116_0063545 Ga0496116_0063545_793_2046 415
50 iso_pu_bacteria 2579778775 2580935380 415
51 iso_pu_bacteria 2619619294 2621272989 415
52 iso_pu_bacteria 2857586860 2857590341 415
53 iso_pu_bacteria 2857604169 2857605956 415
54 iso_pu_bacteria 3001892409 3001895342 415
55 3300041406 Ga0439439_0004489 Ga0439439_0004489_614_1864 416
56 3300042015 Ga0439462_0035221 Ga0439462_0035221_55_1305 416
57 iso_pu_bacteria 2585428059 2587742945 416
58 iso_pu_bacteria 2671180694 2673817252 416
59 3300003578 Ga0006562J51391_1013112 Ga0006562J51391_10131121 417
60 iso_pu_bacteria 2671180330 2672337539 417
61 iso_pu_bacteria 2808606364 2808869248 417
62 iso_pu_bacteria 2816332186 2816862052 417
63 iso_pu_bacteria 2842682962 2842686663 417
64 iso_pu_bacteria 2849139964 2849141613 417
65 iso_pu_bacteria 2857581216 2857583948 417
66 iso_pu_bacteria 2964375228 2964377150 417
67 iso_pu_bacteria 2671180330 2672336633 418
68 iso_pu_bacteria 2816332186 2816862917 418
69 iso_pu_bacteria 2842682962 2842682967 418
70 iso_pu_bacteria 2849139964 2849144578 418
71 iso_pu_bacteria 2857465823 2857469246 418
72 iso_pu_bacteria 2857581216 2857582652 418
73 iso_pu_bacteria 2857591370 2857595372 418
74 iso_pu_bacteria 2857604169 2857609322 418
75 iso_pu_bacteria 2965761152 2965762578 418
76 iso_pu_bacteria 2979083700 2979085009 418
77 3300003187 JGI25151J46595_10011011 JGI25151J46595_100110112 419
78 3300003316 rootH1_10016587 rootH1_100165876 419
79 3300003322 rootL2_10049823 rootL2_100498236 419
80 3300013297 Ga0157378_10143513 Ga0157378_101435131 419
81 3300025273 Ga0209673_1002559 Ga0209673_10025592 419
82 3300025294 Ga0209025_1002733 Ga0209025_100273311 419
83 3300025302 Ga0207426_1005888 Ga0207426_10058883 419
84 3300025711 Ga0207696_1005203 Ga0207696_10052032 419
85 3300025728 Ga0207655_1000139 Ga0207655_1000139175 419
86 3300046491 Ga0495584_0066161 Ga0495584_0066161_125_1417 419
87 3300048904 Ga0496101_0005314 Ga0496101_0005314_854_2146 419
88 3300048905 Ga0496102_0036544 Ga0496102_0036544_2280_3572 419
89 3300048906 Ga0496103_0039065 Ga0496103_0039065_460_1752 419
90 3300048907 Ga0496104_0007521 Ga0496104_0007521_1796_3088 419
91 3300048908 Ga0496105_0000161 Ga0496105_0000161_27651_28943 419
92 3300048909 Ga0496106_0002706 Ga0496106_0002706_1437_2729 419
93 3300048910 Ga0496107_0000662 Ga0496107_0000662_6192_7484 419
94 3300048911 Ga0496108_0002589 Ga0496108_0002589_11548_12840 419
95 3300048912 Ga0496109_0003003 Ga0496109_0003003_2047_3339 419
96 3300048913 Ga0496110_0012804 Ga0496110_0012804_4453_5745 419
97 3300048914 Ga0496111_0000453 Ga0496111_0000453_19120_20412 419
98 3300048915 Ga0496112_0003385 Ga0496112_0003385_4408_5700 419
99 3300048916 Ga0496113_0039926 Ga0496113_0039926_1705_2997 419
100 3300048918 Ga0496115_0188179 Ga0496115_0188179_221_1513 419
101 3300048919 Ga0496116_0020571 Ga0496116_0020571_1061_2353 419
102 3300048921 Ga0496118_0099976 Ga0496118_0099976_51_1343 419
103 3300048922 Ga0496119_0008211 Ga0496119_0008211_214_1506 419
104 3300048927 Ga0496124_0130187 Ga0496124_0130187_86_1378 419
105 3300048928 Ga0496125_0003126 Ga0496125_0003126_13395_14687 419
106 3300048929 Ga0496126_0127344 Ga0496126_0127344_547_1839 419
107 iso_pu_bacteria 2576861424 2578337084 419
108 iso_pu_bacteria 2738543010 2739230476 419
109 iso_pu_bacteria 2808606399 2809053844 419
110 iso_pu_bacteria 2860837431 2860841522 419
111 iso_pu_bacteria 2962290636 2962294761 419
112 iso_pu_bacteria 2969136845 2969140683 419
113 iso_pu_bacteria 2969765954 2969768490 419
114 iso_pu_bacteria 2969770375 2969770840 419
115 iso_pu_bacteria 2971511577 2971516549 419
116 iso_pu_bacteria 2980176882 2980182131 419
117 iso_pu_bacteria 2980492589 2980496527 419
118 iso_pu_bacteria 2990275345 2990276893 419
119 iso_pu_bacteria 8022653035 8022655551 419
120 iso_pu_bacteria 8054280661 8054281443 419
121 iso_pu_bacteria 2511231119 2511700067 420
122 iso_pu_bacteria 2545555800 2545556753 420
123 iso_pu_bacteria 2554235283 2555467471 420
124 iso_pu_bacteria 2576861599 2578931003 420
125 iso_pu_bacteria 2630968484 2631984335 420
126 iso_pu_bacteria 2643221735 2644740645 420
127 iso_pu_bacteria 2648501850 2651532054 420
128 iso_pu_bacteria 2671180844 2674419172 420
129 iso_pu_bacteria 2684623153 2686997297 420
130 iso_pu_bacteria 2687453109 2687498604 420
131 iso_pu_bacteria 2695420354 2695628045 420
132 iso_pu_bacteria 2716884898 2717916243 420
133 iso_pu_bacteria 2738541358 2739156380 420
134 iso_pu_bacteria 2738543006 2739210680 420
135 iso_pu_bacteria 2808606399 2809057065 420
136 iso_pu_bacteria 2811994870 2812316489 420
137 iso_pu_bacteria 2816332295 2817480535 420
138 iso_pu_bacteria 2818991468 2819723558 420
139 iso_pu_bacteria 2823526263 2823528470 420
140 iso_pu_bacteria 2860837431 2860839916 420
141 iso_pu_bacteria 2877768649 2877770949 420
142 iso_pu_bacteria 2880169592 2880171814 420
143 iso_pu_bacteria 2897109615 2897112039 420
144 iso_pu_bacteria 2904560550 2904561904 420
145 iso_pu_bacteria 2908665501 2908668325 420
146 iso_pu_bacteria 2919093281 2919096094 420
147 iso_pu_bacteria 2919726948 2919728188 420
148 iso_pu_bacteria 2954773129 2954774014 420
149 iso_pu_bacteria 2962290636 2962293188 420
150 iso_pu_bacteria 2969136845 2969139199 420
151 iso_pu_bacteria 2969141011 2969143396 420
152 iso_pu_bacteria 2969765954 2969767164 420
153 iso_pu_bacteria 2969770375 2969773521 420
154 iso_pu_bacteria 2971893375 2971895594 420
155 iso_pu_bacteria 2980492589 2980494931 420
156 iso_pu_bacteria 3006858327 3006860883 420
157 iso_pu_bacteria 3006879489 3006881419 420
158 iso_pu_bacteria 3006978542 3006981580 420
159 iso_pu_bacteria 8022630665 8022633649 420
160 iso_pu_bacteria 8022653035 8022657426 420
161 iso_pu_bacteria 8051952484 8051955465 420
162 iso_pu_bacteria 8052174270 8052176822 420
163 iso_pu_bacteria 8057632132 8057635211 420
164 3300003187 JGI25151J46595_10008483 JGI25151J46595_100084832 421
165 3300009011 Ga0105251_10021982 Ga0105251_100219822 421
166 3300009036 Ga0105244_10006357 Ga0105244_100063575 421
167 3300009092 Ga0105250_10003916 Ga0105250_100039163 421
168 3300025294 Ga0209025_1000457 Ga0209025_100045720 421
169 3300025294 Ga0209025_1012296 Ga0209025_10122962 421
170 3300025728 Ga0207655_1004612 Ga0207655_10046125 421
171 3300048903 Ga0496100_0003063 Ga0496100_0003063_1977_3242 421
172 3300048904 Ga0496101_0003933 Ga0496101_0003933_6728_7993 421
173 3300048905 Ga0496102_0037813 Ga0496102_0037813_1437_2702 421
174 3300048906 Ga0496103_0004032 Ga0496103_0004032_636_1901 421
175 3300048907 Ga0496104_0000392 Ga0496104_0000392_8282_9547 421
176 3300048908 Ga0496105_0001185 Ga0496105_0001185_2914_4179 421
177 3300048909 Ga0496106_0000531 Ga0496106_0000531_259_1524 421
178 3300048910 Ga0496107_0001826 Ga0496107_0001826_7255_8520 421
179 3300048911 Ga0496108_0006128 Ga0496108_0006128_493_1758 421
180 3300048912 Ga0496109_0002688 Ga0496109_0002688_13159_14424 421
181 3300048913 Ga0496110_0015955 Ga0496110_0015955_3307_4572 421
182 3300048914 Ga0496111_0002071 Ga0496111_0002071_1653_2918 421
183 3300048915 Ga0496112_0001416 Ga0496112_0001416_636_1901 421
184 3300048916 Ga0496113_0009952 Ga0496113_0009952_3513_4778 421
185 3300048919 Ga0496116_0018574 Ga0496116_0018574_1161_2426 421
186 3300048920 Ga0496117_0011347 Ga0496117_0011347_2280_3545 421
187 3300048922 Ga0496119_0001898 Ga0496119_0001898_22197_23462 421
188 3300048925 Ga0496122_0015185 Ga0496122_0015185_1977_3242 421
189 3300048929 Ga0496126_0004921 Ga0496126_0004921_12755_14020 421
190 iso_pu_bacteria 2593339131 2595087727 421
191 iso_pu_bacteria 2671180330 2672336775 421
192 iso_pu_bacteria 2738541295 2738814295 421
193 iso_pu_bacteria 2738543017 2739270069 421
194 iso_pu_bacteria 2757320391 2757565712 421
195 iso_pu_bacteria 2775507177 2777761366 421
196 iso_pu_bacteria 2775507192 2777839460 421
197 iso_pu_bacteria 2816332186 2816862765 421
198 iso_pu_bacteria 2818991441 2819569607 421
199 iso_pu_bacteria 2842682962 2842684312 421
200 iso_pu_bacteria 2849139964 2849144278 421
201 iso_pu_bacteria 2857581216 2857582500 421
202 iso_pu_bacteria 2857586860 2857587443 421
203 iso_pu_bacteria 2919414237 2919415258 421
204 iso_pu_bacteria 2936340661 2936341586 421
205 iso_pu_bacteria 2936361878 2936367209 421
206 iso_pu_bacteria 2956897341 2956898052 421
207 iso_pu_bacteria 2977254563 2977256786 421
208 iso_pu_bacteria 2990275345 2990277661 421
209 iso_pu_bacteria 3001892409 3001895382 421
210 iso_pu_bacteria 3001892409 3001897977 421
211 iso_pu_bacteria 3006826541 3006828832 421
212 iso_pu_bacteria 3006879489 3006880112 421
213 iso_pu_bacteria 3006973921 3006975677 421
214 3300003578 Ga0006562J51391_1015130 Ga0006562J51391_10151303 422
215 3300032002 Ga0307416_100148416 Ga0307416_1001484163 422
216 3300048913 Ga0496110_0001513 Ga0496110_0001513_6598_7875 422
217 3300048914 Ga0496111_0003913 Ga0496111_0003913_2540_3817 422
218 iso_pu_bacteria 2511231119 2511701504 422
219 iso_pu_bacteria 2545555800 2545557782 422
220 iso_pu_bacteria 2576861599 2578932172 422
221 iso_pu_bacteria 2630968484 2631983326 422
222 iso_pu_bacteria 2643221731 2644715960 422
223 iso_pu_bacteria 2643221732 2644724170 422
224 iso_pu_bacteria 2648501850 2651531105 422
225 iso_pu_bacteria 2671180844 2674421556 422
226 iso_pu_bacteria 2695420354 2695629461 422
227 iso_pu_bacteria 2716884898 2717914847 422
228 iso_pu_bacteria 2818991465 2819709432 422
229 iso_pu_bacteria 2842882022 2842884317 422
230 iso_pu_bacteria 2877768649 2877772388 422
231 iso_pu_bacteria 2880169592 2880173237 422
232 iso_pu_bacteria 2897109615 2897113504 422
233 iso_pu_bacteria 2904524088 2904524654 422
234 iso_pu_bacteria 2904560550 2904561832 422
235 iso_pu_bacteria 2919143609 2919146750 422
236 iso_pu_bacteria 2919517244 2919518673 422
237 iso_pu_bacteria 2919720352 2919723041 422
238 iso_pu_bacteria 2928093941 2928096432 422
239 iso_pu_bacteria 2929004312 2929006193 422
240 iso_pu_bacteria 2936361878 2936362313 422
241 iso_pu_bacteria 2960319331 2960320664 422
242 iso_pu_bacteria 2960375949 2960380736 422
243 iso_pu_bacteria 2969141011 2969144955 422
244 iso_pu_bacteria 2971893375 2971897079 422
245 iso_pu_bacteria 8022630665 8022632606 422
246 iso_pu_bacteria 8022893055 8022897989 422
247 iso_pu_bacteria 8022914991 8022917172 422
248 iso_pu_bacteria 8022948649 8022949648 422
249 iso_pu_bacteria 8051952484 8051954004 422
250 iso_pu_bacteria 8052174270 8052175930 422
251 3300025284 Ga0209130_1000390 Ga0209130_100039035 423
252 3300049161 Ga0501305_001474 Ga0501305_001474_22_1293 423
253 3300049528 Ga0501312_007918 Ga0501312_007918_22_1293 423
254 iso_pu_bacteria 2512564039 2512735295 423
255 iso_pu_bacteria 2738541295 2738814415 423
256 iso_pu_bacteria 2857604169 2857607056 423
257 iso_pu_bacteria 2925326138 2925329453 423
258 iso_pu_bacteria 8022792930 8022798134 423
259 iso_pu_bacteria 8057582654 8057584242 423
260 3300003187 JGI25151J46595_10000006 JGI25151J46595_10000006189 424
261 3300003578 Ga0006562J51391_1001638 Ga0006562J51391_100163811 424
262 3300003758 Ga0055532_1000024 Ga0055532_100002499 424
263 3300025229 Ga0209147_100020 Ga0209147_100020264 424
264 3300025229 Ga0209147_103082 Ga0209147_1030823 424
265 3300025294 Ga0209025_1000001 Ga0209025_1000001806 424
266 iso_pu_bacteria 2551306519 2553391680 424
267 iso_pu_bacteria 2593339131 2595090061 424
268 iso_pu_bacteria 2643221729 2644703983 424
269 iso_pu_bacteria 2643221730 2644708676 424
270 iso_pu_bacteria 2684622632 2685149413 424
271 iso_pu_bacteria 2695420987 2698323766 424
272 iso_pu_bacteria 2703719227 2705993458 424
273 iso_pu_bacteria 2718218445 2721504793 424
274 iso_pu_bacteria 2738541358 2739156237 424
275 iso_pu_bacteria 2738543006 2739210823 424
276 iso_pu_bacteria 2757320391 2757567598 424
277 iso_pu_bacteria 2775507192 2777836261 424
278 iso_pu_bacteria 2775507192 2777838063 424
279 iso_pu_bacteria 2818991443 2819579440 424
280 iso_pu_bacteria 2929233124 2929234688 424
281 iso_pu_bacteria 2936340661 2936345509 424
282 iso_pu_bacteria 2938917290 2938918862 424
283 iso_pu_bacteria 2947426588 2947428235 424
284 iso_pu_bacteria 2956897341 2956902640 424
285 iso_pu_bacteria 2965761152 2965762727 424
286 iso_pu_bacteria 2979083700 2979085159 424
287 iso_pu_bacteria 8022621104 8022622657 424
288 iso_pu_bacteria 8023438354 8023442458 424
289 iso_pu_bacteria 8023444577 8023447946 424
290 3300003187 JGI25151J46595_10001503 JGI25151J46595_1000150316 425
291 3300003187 JGI25151J46595_10020856 JGI25151J46595_100208562 425
292 3300003578 Ga0006562J51391_1007192 Ga0006562J51391_10071921 425
293 3300003758 Ga0055532_1000079 Ga0055532_1000079121 425
294 3300025229 Ga0209147_100014 Ga0209147_100014504 425
295 3300025292 Ga0209676_1000940 Ga0209676_100094010 425
296 3300025294 Ga0209025_1000041 Ga0209025_1000041388 425
297 3300025294 Ga0209025_1004262 Ga0209025_10042629 425
298 3300031911 Ga0307412_10055797 Ga0307412_100557971 425
299 3300031995 Ga0307409_100011909 Ga0307409_1000119098 425
300 3300048905 Ga0496102_0018569 Ga0496102_0018569_2634_3914 425
301 3300048914 Ga0496111_0020805 Ga0496111_0020805_2596_3873 425
302 3300048915 Ga0496112_0018463 Ga0496112_0018463_3316_4593 425
303 3300049131 Ga0501341_01029 Ga0501341_01029_30_1307 425
304 3300049531 Ga0501315_004499 Ga0501315_004499_18_1295 425
305 3300049552 Ga0501336_001730 Ga0501336_001730_36_1313 425
306 3300049661 Ga0501217_011587 Ga0501217_011587_10_1287 425
307 iso_pu_bacteria 2585428059 2587742359 425
308 iso_pu_bacteria 2593339131 2595089999 425
309 iso_pu_bacteria 2643221731 2644721171 425
310 iso_pu_bacteria 2738543017 2739271057 425
311 iso_pu_bacteria 2757320391 2757567663 425
312 iso_pu_bacteria 2775507177 2777762389 425
313 iso_pu_bacteria 2857604169 2857608002 425
314 iso_pu_bacteria 2898907183 2898909847 425
315 iso_pu_bacteria 2904524088 2904529499 425
316 iso_pu_bacteria 2919143609 2919148909 425
317 iso_pu_bacteria 2919517244 2919522648 425
318 iso_pu_bacteria 2919720352 2919725450 425
319 iso_pu_bacteria 2928093941 2928099943 425
320 iso_pu_bacteria 2936340661 2936345443 425
321 iso_pu_bacteria 8022792930 8022798283 425
322 iso_pu_bacteria 8057582654 8057584091 425
323 3300003322 rootL2_10014752 rootL2_100147525 426
324 3300003578 Ga0006562J51391_1000764 Ga0006562J51391_10007644 426
325 3300003790 Ga0055528_1003593 Ga0055528_10035932 426
326 3300005355 Ga0070671_100027902 Ga0070671_1000279022 426
327 3300009098 Ga0105245_10060345 Ga0105245_100603453 426
328 3300009101 Ga0105247_10028387 Ga0105247_100283872 426
329 3300009148 Ga0105243_10001131 Ga0105243_1000113113 426
330 3300009176 Ga0105242_10001620 Ga0105242_100016207 426
331 3300011119 Ga0105246_10079418 Ga0105246_100794182 426
332 3300013297 Ga0157378_10011320 Ga0157378_100113209 426
333 3300014745 Ga0157377_10023395 Ga0157377_100233953 426
334 3300025229 Ga0209147_100301 Ga0209147_10030131 426
335 3300025273 Ga0209673_1003357 Ga0209673_100335710 426
336 3300025294 Ga0209025_1007551 Ga0209025_10075511 426
337 3300025711 Ga0207696_1001757 Ga0207696_100175711 426
338 3300025735 Ga0207713_1001305 Ga0207713_100130518 426
339 3300025935 Ga0207709_10004833 Ga0207709_100048338 426
340 3300031548 Ga0307408_100095700 Ga0307408_1000957002 426
341 3300032002 Ga0307416_100018146 Ga0307416_1000181466 426
342 3300037466 Ga0395898_0263859 Ga0395898_0263859_275_1567 426
343 3300046455 Ga0495603_0041027 Ga0495603_0041027_1339_2619 426
344 3300046492 Ga0495585_0008228 Ga0495585_0008228_3138_4418 426
345 3300046810 Ga0495660_0024777 Ga0495660_0024777_1793_3082 426
346 3300048091 Ga0495626_0053584 Ga0495626_0053584_409_1692 426
347 3300048913 Ga0496110_0008329 Ga0496110_0008329_3995_5275 426
348 3300048915 Ga0496112_0081905 Ga0496112_0081905_465_1751 426
349 iso_pu_bacteria 2643221731 2644717850 426
350 iso_pu_bacteria 2738541295 2738816825 426
351 iso_pu_bacteria 2818991465 2819707029 426
352 iso_pu_bacteria 2842882022 2842882661 426
353 iso_pu_bacteria 2904524088 2904526673 426
354 iso_pu_bacteria 2919143609 2919144733 426
355 iso_pu_bacteria 2919414237 2919414249 426
356 iso_pu_bacteria 2919517244 2919519923 426
357 iso_pu_bacteria 2919720352 2919721065 426
358 iso_pu_bacteria 2928093941 2928095186 426
359 iso_pu_bacteria 2929004312 2929008896 426
360 iso_pu_bacteria 2936361878 2936362171 426
361 iso_pu_bacteria 2956897341 2956902458 426
362 iso_pu_bacteria 2960319331 2960323957 426
363 iso_pu_bacteria 2990275345 2990279113 426
364 iso_pu_bacteria 3001892409 3001893143 426
365 iso_pu_bacteria 8022893055 8022897387 426
366 iso_pu_bacteria 8022914991 8022919415 426
367 3300002987 JGI25159J45721_1011906 JGI25159J45721_10119063 427
368 3300003578 Ga0006562J51391_1002322 Ga0006562J51391_10023221 427
369 3300025284 Ga0209130_1001398 Ga0209130_10013984 427
370 3300025294 Ga0209025_1000939 Ga0209025_100093919 427
371 3300025294 Ga0209025_1011409 Ga0209025_10114091 427
372 3300025294 Ga0209025_1016806 Ga0209025_10168064 427
373 3300031995 Ga0307409_100023207 Ga0307409_1000232074 427
374 3300049661 Ga0501217_002039 Ga0501217_002039_2142_3431 427
375 3300002987 JGI25159J45721_1002835 JGI25159J45721_10028359 428
376 3300003187 JGI25151J46595_10003005 JGI25151J46595_100030055 428
377 3300003187 JGI25151J46595_10004470 JGI25151J46595_100044703 428
378 3300003187 JGI25151J46595_10014009 JGI25151J46595_100140093 428
379 3300003187 JGI25151J46595_10037479 JGI25151J46595_100374791 428
380 3300003758 Ga0055532_1000024 Ga0055532_100002435 428
381 3300009036 Ga0105244_10011396 Ga0105244_100113961 428
382 3300009092 Ga0105250_10005181 Ga0105250_100051817 428
383 3300009092 Ga0105250_10006272 Ga0105250_100062723 428
384 3300011119 Ga0105246_10017881 Ga0105246_100178812 428
385 3300013296 Ga0157374_10015570 Ga0157374_100155701 428
386 3300025229 Ga0209147_100020 Ga0209147_100020327 428
387 3300025284 Ga0209130_1001340 Ga0209130_100134010 428
388 3300025284 Ga0209130_1001670 Ga0209130_10016707 428
389 3300025292 Ga0209676_1000274 Ga0209676_100027460 428
390 3300025294 Ga0209025_1000043 Ga0209025_1000043186 428
391 3300025294 Ga0209025_1000043 Ga0209025_1000043272 428
392 3300025294 Ga0209025_1000258 Ga0209025_100025820 428
393 3300025294 Ga0209025_1000851 Ga0209025_100085149 428
394 3300025294 Ga0209025_1001121 Ga0209025_100112112 428
395 3300025294 Ga0209025_1002359 Ga0209025_10023598 428
396 3300025294 Ga0209025_1002492 Ga0209025_100249214 428
397 3300025294 Ga0209025_1039398 Ga0209025_10393981 428
398 3300025711 Ga0207696_1003470 Ga0207696_10034702 428
399 3300025711 Ga0207696_1004131 Ga0207696_10041317 428
400 3300025728 Ga0207655_1042808 Ga0207655_10428081 428
401 3300025735 Ga0207713_1005799 Ga0207713_10057991 428
402 3300027462 Ga0210000_1004091 Ga0210000_10040912 428
403 3300030083 Ga0237817_10045 Ga0237817_100459 428
404 3300030083 Ga0237817_10271 Ga0237817_1027110 428
405 3300032002 Ga0307416_100114910 Ga0307416_1001149101 428
406 3300038705 Ga0237819_00041 Ga0237819_00041_28727_30013 428
407 3300042007 Ga0439449_0006050 Ga0439449_0006050_280_1632 428
408 3300045976 Ga0466967_0024891 Ga0466967_0024891_544_1830 428
409 3300048903 Ga0496100_0137774 Ga0496100_0137774_343_1641 428
410 3300048905 Ga0496102_0035859 Ga0496102_0035859_305_1603 428
411 3300048905 Ga0496102_0108434 Ga0496102_0108434_900_2192 428
412 3300048906 Ga0496103_0005212 Ga0496103_0005212_1278_2576 428
413 3300048906 Ga0496103_0168288 Ga0496103_0168288_96_1388 428
414 3300048910 Ga0496107_0032044 Ga0496107_0032044_187_1485 428
415 3300048912 Ga0496109_0046762 Ga0496109_0046762_1131_2429 428
416 3300048913 Ga0496110_0017190 Ga0496110_0017190_1151_2449 428
417 3300048913 Ga0496110_0131687 Ga0496110_0131687_832_2118 428
418 3300048914 Ga0496111_0011673 Ga0496111_0011673_3873_5171 428
419 3300048914 Ga0496111_0096749 Ga0496111_0096749_561_1853 428
420 3300048915 Ga0496112_0064468 Ga0496112_0064468_323_1615 428
421 3300048915 Ga0496112_0096639 Ga0496112_0096639_1326_2624 428
422 3300048916 Ga0496113_0013096 Ga0496113_0013096_1569_2861 428
423 3300048918 Ga0496115_0219301 Ga0496115_0219301_166_1458 428
424 3300048925 Ga0496122_0107580 Ga0496122_0107580_355_1653 428
425 iso_pu_bacteria 2738543017 2739271142 428
426 iso_pu_bacteria 2857586860 2857590105 428
427 iso_pu_bacteria 2857604169 2857607328 428
428 iso_pu_bacteria 2916971899 2916974363 428
429 iso_pu_bacteria 2956897341 2956898823 428
430 iso_pu_bacteria 2960375949 2960377610 428
431 iso_pu_bacteria 8022914991 8022919128 428

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00208

ELFV_dehydrog

Glutamate/Leucine/Phenylalanine/Valine dehydrogenase

219

450

0.99

PF02812

ELFV_dehydrog_N

Glu/Leu/Phe/Val dehydrogenase, dimerisation domain

73

201

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3k8z-assembly1.cif.gz_F crystal structure of gudb1 a decryptified secondary glutamate dehydrogenase from b. subtilis 0.9859 22 428
3k8z-assembly1.cif.gz_F crystal structure of gudb1 a decryptified secondary glutamate dehydrogenase from b. subtilis 0.9811 22 428
3aoe-assembly1.cif.gz_C crystal structure of hetero-hexameric glutamate dehydrogenase from thermus thermophilus (leu bound form) 0.9657 20 426
4xgi-assembly1.cif.gz_F crystal structure of glutamate dehydrogenase from burkholderia thailandensis 0.9554 21 426
4xgi-assembly1.cif.gz_C crystal structure of glutamate dehydrogenase from burkholderia thailandensis 0.9551 21 426
ID Description Score Start End Superfamily
3k8zE03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9934 202 355 3.40.50.720
3k8zD03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9933 202 355 3.40.50.720
3k8zE03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9864 202 355 3.40.50.720
3k8zD03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9854 202 355 3.40.50.720
1b26A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9733 51 193 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A2N0QHJ3-F1-model_v4 Glu/Leu/Phe/Val dehydrogenase 0.9922 21 142 GO:0004352
GO:0006538
AF-A0A2S6DJ21-F1-model_v4 deleted 0.9875 231 420
AF-A0A662Z5L2-F1-model_v4 Glutamate dehydrogenase 0.9874 18 428 GO:0000166
GO:0004352
GO:0006538
AF-A0A454GYL6-F1-model_v4 deleted 0.987 21 261
AF-A0A3G4QWI8-F1-model_v4 deleted 0.9865 18 428

Feature Viewer

pLDDT pTM Quality
90.21 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map