F442233

General Info

Members Datasets Scaffolds Average Seq Length
430 247 430 146

Family's Representative Sequence

Representative Sequence 3300048922|Ga0496119_0003792|Ga0496119_0003792_1850_2290
Length 141
Sequence MAIKTDAVGKSWPSTTYQVGREKIKEYATVLGIENPVHFDVGAAREAGFRDVVAPPMFAVVYSMQALDPEVGMNFATMVHGGQTFEWGEPACSGDEITTTAKCISIDEKLGNGFYVFETISVNGAGAEVVRGTWTNIVRGV

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
127 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
141 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
148 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
193 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
194 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
195 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
196 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
228 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
244 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
245 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
246 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.12
Nodule 0
Rhizoplane 9.53
Rhizosphere 80
Stem 0
Stem Tuber 0
Unclassified 5.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000516 3300001977 Bacteria 5795
2 JGI24751J29686_10038121 3300002459 Bacteria 995
3 rootL2_10273478 3300003322 Bacteria 1529
4 Ga0070683_100005111 3300005329 Bacteria 10909
5 Ga0070683_100077794 3300005329 Bacteria 3102
6 Ga0070683_101252499 3300005329 Bacteria 713
7 Ga0070677_10000082 3300005333 Bacteria 30305
8 Ga0070666_10122694 3300005335 Bacteria 1802
9 Ga0070666_10215568 3300005335 Bacteria 1353
10 Ga0070680_101799226 3300005336 Bacteria 531
11 Ga0070682_100000017 3300005337 Bacteria 235228
12 Ga0068868_100000033 3300005338 Bacteria 75402
13 Ga0070689_100115196 3300005340 Bacteria 2142
14 Ga0070661_100000121 3300005344 Bacteria 65344
15 Ga0070661_101407745 3300005344 Bacteria 587
16 Ga0070668_100001145 3300005347 Bacteria 18672
17 Ga0070668_100164783 3300005347 Bacteria 1801
18 Ga0070669_100203553 3300005353 Bacteria 1559
19 Ga0070674_100000002 3300005356 Bacteria 271088
20 Ga0070674_100000009 3300005356 Bacteria 143336
21 Ga0070714_100152320 3300005435 Bacteria 2085
22 Ga0070714_100660812 3300005435 Bacteria 1007
23 Ga0070711_100003868 3300005439 Bacteria 8792
24 Ga0070700_100453888 3300005441 Bacteria 976
25 Ga0070700_100883141 3300005441 Bacteria 727
26 Ga0070663_100000065 3300005455 Bacteria 45157
27 Ga0070663_100382503 3300005455 Bacteria 1146
28 Ga0070678_100012972 3300005456 Bacteria 5204
29 Ga0070678_100035649 3300005456 Bacteria 3476
30 Ga0070662_100000002 3300005457 Bacteria 253208
31 Ga0070681_10230121 3300005458 Bacteria 1768
32 Ga0070681_10396679 3300005458 Bacteria 1291
33 Ga0068867_100004390 3300005459 Bacteria 9921
34 Ga0070679_100002020 3300005530 Bacteria 18198
35 Ga0070679_100170416 3300005530 Bacteria 2150
36 Ga0070679_100385516 3300005530 Bacteria 1348
37 Ga0070684_100010013 3300005535 Bacteria 7496
38 Ga0070684_100011008 3300005535 Bacteria 7195
39 Ga0070684_100862836 3300005535 Bacteria 847
40 Ga0068853_100025426 3300005539 Bacteria 4968
41 Ga0070686_100029755 3300005544 Bacteria 3326
42 Ga0070693_100000406 3300005547 Bacteria 19495
43 Ga0070665_100000040 3300005548 Bacteria 305480
44 Ga0070665_100003676 3300005548 Bacteria 16257
45 Ga0068855_100242393 3300005563 Bacteria 2014
46 Ga0068855_100256173 3300005563 Bacteria 1951
47 Ga0070664_100381821 3300005564 Bacteria 1286
48 Ga0068854_100117494 3300005578 Unclassified 2014
49 Ga0068856_100000237 3300005614 Bacteria 59854
50 Ga0068856_100003571 3300005614 Bacteria 15652
51 Ga0068856_100017715 3300005614 Bacteria 6908
52 Ga0068852_100000002 3300005616 Bacteria 268221
53 Ga0068864_100000015 3300005618 Bacteria 303368
54 Ga0068866_10000003 3300005718 Bacteria 281675
55 Ga0068866_10000036 3300005718 Bacteria 51111
56 Ga0068861_100068033 3300005719 Bacteria 2751
57 Ga0068851_10060758 3300005834 Bacteria 1935
58 Ga0068863_100001187 3300005841 Bacteria 26004
59 Ga0068858_100000156 3300005842 Bacteria 72781
60 Ga0068860_100004826 3300005843 Bacteria 13732
61 Ga0068862_101295642 3300005844 Bacteria 730
62 Ga0081455_10042559 3300005937 Bacteria 3982
63 Ga0081455_10406052 3300005937 Bacteria 944
64 Ga0081540_1157397 3300005983 Bacteria 887
65 Ga0075365_10049928 3300006038 Bacteria 2758
66 Ga0075365_10118597 3300006038 Bacteria 1824
67 Ga0075365_10921484 3300006038 Bacteria 616
68 Ga0075368_10140541 3300006042 Bacteria 1006
69 Ga0075363_100122194 3300006048 Bacteria 1455
70 Ga0075363_100627828 3300006048 Bacteria 645
71 Ga0075364_10039119 3300006051 Bacteria 3074
72 Ga0075364_10325955 3300006051 Bacteria 1046
73 Ga0075364_10669280 3300006051 Bacteria 709
74 Ga0070715_10000001 3300006163 Bacteria 693690
75 Ga0070712_100077517 3300006175 Bacteria 2396
76 Ga0075430_100144120 3300006846 Bacteria 1984
77 Ga0075431_100003809 3300006847 Bacteria 14662
78 Ga0075431_100214239 3300006847 Bacteria 1966
79 Ga0075433_10009335 3300006852 Bacteria 7842
80 Ga0075434_100306331 3300006871 Bacteria 1609
81 Ga0105250_10222617 3300009092 Bacteria 800
82 Ga0105240_11425260 3300009093 Bacteria 728
83 Ga0111539_10512681 3300009094 Bacteria 1397
84 Ga0105245_10000201 3300009098 Bacteria 57152
85 Ga0105245_10006128 3300009098 Bacteria 10578
86 Ga0105247_10229602 3300009101 Bacteria 1260
87 Ga0105247_11522994 3300009101 Bacteria 546
88 Ga0114129_12289170 3300009147 Bacteria 649
89 Ga0105243_10065299 3300009148 Bacteria 2923
90 Ga0105243_11368475 3300009148 Bacteria 727
91 Ga0105242_10024452 3300009176 Bacteria 4771
92 Ga0105248_10000175 3300009177 Bacteria 74795
93 Ga0105237_10905475 3300009545 Bacteria 889
94 Ga0105238_10000009 3300009551 Bacteria 288729
95 Ga0105238_10535101 3300009551 Bacteria 1175
96 Ga0105249_10000050 3300009553 Bacteria 169617
97 Ga0105249_12155998 3300009553 Bacteria 630
98 Ga0105239_10637320 3300010375 Bacteria 1217
99 Ga0105239_10829214 3300010375 Bacteria 1060
100 Ga0105239_11552515 3300010375 Bacteria 765
101 Ga0105246_10122598 3300011119 Bacteria 1929
102 Ga0157370_10009925 3300013104 Bacteria 10084
103 Ga0157374_10013622 3300013296 Bacteria 7103
104 Ga0157374_10418024 3300013296 Bacteria 1339
105 Ga0157378_10098914 3300013297 Bacteria 2661
106 Ga0157378_10826779 3300013297 Bacteria 953
107 Ga0163162_11426264 3300013306 Bacteria 788
108 Ga0157372_10535423 3300013307 Bacteria 1365
109 Ga0157372_12362999 3300013307 Bacteria 610
110 Ga0157375_10000584 3300013308 Bacteria 32509
111 Ga0157375_11002868 3300013308 Bacteria 975
112 Ga0163163_10174037 3300014325 Bacteria 2199
113 Ga0163163_10741586 3300014325 Bacteria 1045
114 Ga0157380_10001197 3300014326 Bacteria 16794
115 Ga0157380_10139726 3300014326 Bacteria 2079
116 Ga0157379_10013140 3300014968 Bacteria 7250
117 Ga0157379_10941904 3300014968 Bacteria 821
118 Ga0157376_10134188 3300014969 Bacteria 2213
119 Ga0207656_10043544 3300025321 Bacteria 1914
120 Ga0207682_10000018 3300025893 Bacteria 66215
121 Ga0207642_10000002 3300025899 Bacteria 658166
122 Ga0207642_10000377 3300025899 Bacteria 13379
123 Ga0207680_10007438 3300025903 Bacteria 5339
124 Ga0207680_10024487 3300025903 Bacteria 3314
125 Ga0207680_10258557 3300025903 Bacteria 1204
126 Ga0207685_10000005 3300025905 Bacteria 289944
127 Ga0207705_10289941 3300025909 Bacteria 1254
128 Ga0207684_10655767 3300025910 Bacteria 894
129 Ga0207654_10560532 3300025911 Bacteria 812
130 Ga0207707_10020589 3300025912 Bacteria 5762
131 Ga0207707_10291485 3300025912 Bacteria 1412
132 Ga0207695_11320161 3300025913 Bacteria 602
133 Ga0207671_10129317 3300025914 Bacteria 1937
134 Ga0207693_10082967 3300025915 Bacteria 2510
135 Ga0207663_10001006 3300025916 Bacteria 12904
136 Ga0207660_11055421 3300025917 Bacteria 662
137 Ga0207649_10000003 3300025920 Bacteria 388908
138 Ga0207649_10209542 3300025920 Bacteria 1382
139 Ga0207652_10011749 3300025921 Bacteria 7068
140 Ga0207652_10015740 3300025921 Bacteria 6160
141 Ga0207694_10000004 3300025924 Bacteria 967075
142 Ga0207687_10000015 3300025927 Bacteria 261701
143 Ga0207687_10000020 3300025927 Bacteria 228407
144 Ga0207687_10001695 3300025927 Bacteria 15197
145 Ga0207687_10966782 3300025927 Bacteria 730
146 Ga0207664_10228180 3300025929 Bacteria 1618
147 Ga0207706_10000001 3300025933 Bacteria 423014
148 Ga0207686_10042696 3300025934 Bacteria 2774
149 Ga0207709_10072697 3300025935 Bacteria 2188
150 Ga0207670_10522488 3300025936 Bacteria 966
151 Ga0207669_10000001 3300025937 Bacteria 377747
152 Ga0207669_10000003 3300025937 Bacteria 252239
153 Ga0207669_11403585 3300025937 Bacteria 595
154 Ga0207665_10116247 3300025939 Bacteria 1885
155 Ga0207711_10000006 3300025941 Bacteria 792692
156 Ga0207711_10101206 3300025941 Bacteria 2550
157 Ga0207661_10009225 3300025944 Bacteria 7070
158 Ga0207661_10009386 3300025944 Bacteria 7014
159 Ga0207661_10092868 3300025944 Bacteria 2517
160 Ga0207679_10311534 3300025945 Bacteria 1360
161 Ga0207667_10189094 3300025949 Bacteria 2113
162 Ga0207651_10001383 3300025960 Bacteria 10988
163 Ga0207712_10000019 3300025961 Bacteria 317060
164 Ga0207712_10488614 3300025961 Bacteria 1050
165 Ga0207640_10083999 3300025981 Bacteria 2185
166 Ga0207658_10002662 3300025986 Bacteria 12941
167 Ga0207658_10193597 3300025986 Bacteria 1692
168 Ga0207677_10002270 3300026023 Bacteria 10097
169 Ga0207703_10000704 3300026035 Bacteria 33055
170 Ga0207639_10036439 3300026041 Bacteria 3645
171 Ga0207678_10000253 3300026067 Bacteria 48388
172 Ga0207678_11052003 3300026067 Bacteria 721
173 Ga0207708_10384130 3300026075 Bacteria 1158
174 Ga0207708_10746526 3300026075 Unclassified 840
175 Ga0207702_10000251 3300026078 Bacteria 62222
176 Ga0207702_10002325 3300026078 Bacteria 18164
177 Ga0207702_10018073 3300026078 Bacteria 5833
178 Ga0207702_10217649 3300026078 Bacteria 1779
179 Ga0207702_10959157 3300026078 Bacteria 848
180 Ga0207641_10000827 3300026088 Bacteria 32939
181 Ga0207648_10008149 3300026089 Bacteria 10188
182 Ga0207676_10000018 3300026095 Bacteria 306375
183 Ga0207675_100801634 3300026118 Bacteria 955
184 Ga0207683_10013570 3300026121 Bacteria 6950
185 Ga0207683_10148883 3300026121 Bacteria 2112
186 Ga0207698_10000004 3300026142 Bacteria 313614
187 Ga0209813_10142164 3300027866 Bacteria 853
188 Ga0268266_10000045 3300028379 Bacteria 312955
189 Ga0268266_10000491 3300028379 Bacteria 56615
190 Ga0268266_10001210 3300028379 Bacteria 31835
191 Ga0268266_12372414 3300028379 Bacteria 501
192 Ga0268265_10110742 3300028380 Bacteria 2241
193 Ga0268265_11939312 3300028380 Bacteria 596
194 Ga0316576_10039140 3300031727 Bacteria 3403
195 Ga0316578_10228041 3300031728 Bacteria 1119
196 Ga0316574_0075593 3300035398 Bacteria 2133
197 Ga0373947_0663523 3300035725 Bacteria 711
198 Ga0373937_0644600 3300036401 Bacteria 1005
199 Ga0451853_3960444 3300041512 Bacteria 5734
200 Ga0439459_0102608 3300042438 Bacteria 702
201 Ga0466963_0000127 3300044694 Bacteria 28865
202 Ga0466960_0270196 3300044901 Bacteria 950
203 Ga0466960_0340744 3300044901 Bacteria 853
204 Ga0466967_0172081 3300045976 Bacteria 2038
205 Ga0466967_1981223 3300045976 Bacteria 579
206 Ga0495592_0069782 3300046454 Bacteria 2562
207 Ga0495592_0210973 3300046454 Bacteria 1304
208 Ga0495629_0004716 3300046459 Bacteria 10215
209 Ga0495629_0250233 3300046459 Bacteria 1219
210 Ga0495629_0447260 3300046459 Bacteria 875
211 Ga0495638_0027318 3300046460 Bacteria 3695
212 Ga0495641_0000214 3300046461 Bacteria 44992
213 Ga0495641_0192014 3300046461 Bacteria 915
214 Ga0495651_0051355 3300046462 Bacteria 3179
215 Ga0495651_0169163 3300046462 Bacteria 1558
216 Ga0495651_0196049 3300046462 Bacteria 1417
217 Ga0495653_0102454 3300046463 Bacteria 2071
218 Ga0495582_0000009 3300046473 Bacteria 123633
219 Ga0495639_0038529 3300046475 Bacteria 2147
220 Ga0495662_0007572 3300046476 Bacteria 5359
221 Ga0495662_0301393 3300046476 Bacteria 788
222 Ga0495664_0183943 3300046477 Bacteria 1267
223 Ga0495606_0000017 3300046507 Bacteria 284549
224 Ga0495610_0031729 3300046512 Bacteria 2754
225 Ga0495620_0004866 3300046515 Bacteria 7536
226 Ga0495628_0020460 3300046516 Bacteria 5456
227 Ga0495628_0078369 3300046516 Bacteria 2570
228 Ga0495630_0000060 3300046517 Bacteria 90021
229 Ga0495637_0161555 3300046520 Bacteria 840
230 Ga0495586_0014277 3300046535 Bacteria 4220
231 Ga0495586_0458442 3300046535 Bacteria 735
232 Ga0495587_0128311 3300046536 Bacteria 1450
233 Ga0495621_0001490 3300046539 Bacteria 6076
234 Ga0495645_0005265 3300046543 Bacteria 8861
235 Ga0495645_0649640 3300046543 Unclassified 644
236 Ga0495656_0000800 3300046615 Bacteria 10185
237 Ga0495634_0000059 3300046642 Bacteria 88314
238 Ga0495634_0019243 3300046642 Bacteria 4852
239 Ga0495634_0097746 3300046642 Bacteria 1900
240 Ga0495625_0328155 3300046660 Unclassified 973
241 Ga0495635_0000057 3300046663 Bacteria 67714
242 Ga0495635_0379077 3300046663 Bacteria 941
243 Ga0495588_0000229 3300046674 Bacteria 50351
244 Ga0495588_0158256 3300046674 Bacteria 1198
245 Ga0495657_0053901 3300046675 Bacteria 2689
246 Ga0495657_0075691 3300046675 Bacteria 2188
247 Ga0495599_0013261 3300046678 Bacteria 5092
248 Ga0495646_0162194 3300046680 Bacteria 1237
249 Ga0495646_0516298 3300046680 Unclassified 612
250 Ga0495647_0010858 3300046681 Bacteria 3110
251 Ga0495647_0058853 3300046681 Bacteria 1511
252 Ga0495647_0076212 3300046681 Bacteria 1351
253 Ga0495658_0000002 3300046683 Bacteria 309651
254 Ga0495658_0017135 3300046683 Bacteria 3738
255 Ga0495669_0012895 3300046684 Bacteria 3558
256 Ga0495669_0025492 3300046684 Bacteria 2579
257 Ga0495613_0004788 3300046689 Bacteria 10154
258 Ga0495613_0266809 3300046689 Bacteria 1191
259 Ga0495624_0118693 3300046690 Bacteria 1625
260 Ga0495624_0141498 3300046690 Bacteria 1473
261 Ga0495670_0746940 3300046691 Bacteria 534
262 Ga0495600_0165169 3300046809 Bacteria 1430
263 Ga0495660_0149200 3300046810 Bacteria 1156
264 Ga0495604_0000100 3300047317 Bacteria 72995
265 Ga0495604_0296075 3300047317 Bacteria 1088
266 Ga0495676_0000346 3300047321 Bacteria 37821
267 Ga0495676_0008907 3300047321 Bacteria 9166
268 Ga0495676_0041908 3300047321 Bacteria 3764
269 Ga0495676_0310513 3300047321 Bacteria 1061
270 Ga0495680_0000312 3300047322 Bacteria 54495
271 Ga0495680_0003619 3300047322 Bacteria 15122
272 Ga0495686_0132026 3300047472 Bacteria 1480
273 Ga0495602_0334433 3300048088 Bacteria 1097
274 Ga0496100_0000001 3300048903 Bacteria 530179
275 Ga0496100_0000010 3300048903 Bacteria 205204
276 Ga0496100_0518916 3300048903 Bacteria 919
277 Ga0496101_0000004 3300048904 Bacteria 331599
278 Ga0496101_0000025 3300048904 Bacteria 205204
279 Ga0496101_0363722 3300048904 Bacteria 1137
280 Ga0496102_0123681 3300048905 Bacteria 2417
281 Ga0496102_0556951 3300048905 Bacteria 1069
282 Ga0496103_0068876 3300048906 Bacteria 2211
283 Ga0496104_0000024 3300048907 Bacteria 229913
284 Ga0496104_0019269 3300048907 Bacteria 6240
285 Ga0496105_0000013 3300048908 Bacteria 229894
286 Ga0496105_0069629 3300048908 Bacteria 2908
287 Ga0496105_0205764 3300048908 Bacteria 1605
288 Ga0496106_0000012 3300048909 Bacteria 205158
289 Ga0496106_0008407 3300048909 Bacteria 7634
290 Ga0496106_0121876 3300048909 Bacteria 2039
291 Ga0496107_0000002 3300048910 Bacteria 320871
292 Ga0496107_0000010 3300048910 Bacteria 205188
293 Ga0496107_0036920 3300048910 Bacteria 3506
294 Ga0496108_0000006 3300048911 Bacteria 469473
295 Ga0496108_0115941 3300048911 Bacteria 2294
296 Ga0496108_0386040 3300048911 Bacteria 1223
297 Ga0496109_0000004 3300048912 Bacteria 404818
298 Ga0496109_1365088 3300048912 Bacteria 644
299 Ga0496110_0070708 3300048913 Bacteria 3093
300 Ga0496110_0147510 3300048913 Bacteria 2129
301 Ga0496110_0341644 3300048913 Bacteria 1364
302 Ga0496110_0718370 3300048913 Bacteria 901
303 Ga0496110_1485804 3300048913 Bacteria 587
304 Ga0496111_0122749 3300048914 Bacteria 1919
305 Ga0496111_0231807 3300048914 Bacteria 1371
306 Ga0496111_0632391 3300048914 Bacteria 782
307 Ga0496111_0726522 3300048914 Bacteria 721
308 Ga0496112_0000006 3300048915 Bacteria 365227
309 Ga0496113_0042961 3300048916 Bacteria 3342
310 Ga0496113_0505320 3300048916 Bacteria 970
311 Ga0496113_0510050 3300048916 Bacteria 965
312 Ga0496114_0114718 3300048917 Bacteria 2310
313 Ga0496114_0160207 3300048917 Bacteria 1956
314 Ga0496114_1164357 3300048917 Bacteria 657
315 Ga0496116_0000257 3300048919 Bacteria 93214
316 Ga0496117_0006062 3300048920 Bacteria 12411
317 Ga0496117_0213951 3300048920 Bacteria 1078
318 Ga0496118_0005497 3300048921 Bacteria 14381
319 Ga0496118_0051150 3300048921 Bacteria 3163
320 Ga0496119_0003792 3300048922 Bacteria 15458
321 Ga0496119_0026965 3300048922 Bacteria 3967
322 Ga0496120_0009134 3300048923 Bacteria 7071
323 Ga0496120_0064758 3300048923 Bacteria 2028
324 Ga0496121_0010139 3300048924 Bacteria 10675
325 Ga0496121_0077558 3300048924 Bacteria 2645
326 Ga0496121_0169476 3300048924 Bacteria 1588
327 Ga0496124_0846606 3300048927 Bacteria 561
328 Ga0496125_0055663 3300048928 Bacteria 3220
329 Ga0496125_0116794 3300048928 Bacteria 1915
330 Ga0496125_0220800 3300048928 Bacteria 1221
331 Ga0496125_0389677 3300048928 Bacteria 818
332 Ga0496126_0062881 3300048929 Bacteria 3328
333 Ga0496126_0297475 3300048929 Bacteria 1333
334 Ga0496126_0344918 3300048929 Bacteria 1219
335 Ga0496126_0672289 3300048929 Bacteria 808
336 Ga0501031_0000682 3300049568 Bacteria 20260
337 Ga0501032_0033562 3300049569 Bacteria 3515
338 Ga0501032_0406470 3300049569 Bacteria 874
339 Ga0501033_0000534 3300049570 Bacteria 35503
340 Ga0501034_0003560 3300049571 Bacteria 17700
341 Ga0501034_0075794 3300049571 Bacteria 3370
342 Ga0501034_0166673 3300049571 Bacteria 2171
343 Ga0501034_0348581 3300049571 Bacteria 1409
344 Ga0501034_1203223 3300049571 Bacteria 636
345 Ga0501036_0000680 3300049572 Bacteria 25035
346 Ga0501036_0525534 3300049572 Bacteria 984
347 Ga0501037_0000719 3300049573 Bacteria 25133
348 Ga0501038_0001734 3300049574 Bacteria 20296
349 Ga0501039_0181732 3300049575 Bacteria 1654
350 Ga0501039_0212804 3300049575 Bacteria 1520
351 Ga0501040_0233834 3300049576 Bacteria 1309
352 Ga0501042_0074542 3300049578 Bacteria 2429
353 Ga0501043_0000291 3300049579 Bacteria 45276
354 Ga0501043_0331193 3300049579 Bacteria 1159
355 Ga0501046_0001836 3300049580 Bacteria 20241
356 Ga0501046_0658707 3300049580 Bacteria 740
357 Ga0501047_0000313 3300049581 Bacteria 55964
358 Ga0501047_0004429 3300049581 Bacteria 13226
359 Ga0501047_0036397 3300049581 Bacteria 4757
360 Ga0501047_0082792 3300049581 Bacteria 3084
361 Ga0501047_0115397 3300049581 Bacteria 2567
362 Ga0501047_0647324 3300049581 Bacteria 876
363 Ga0501048_0008340 3300049582 Bacteria 7835
364 Ga0501067_0255268 3300049583 Bacteria 976
365 Ga0501068_0082306 3300049584 Bacteria 1977
366 Ga0501068_0126626 3300049584 Bacteria 1595
367 Ga0501068_0767728 3300049584 Bacteria 631
368 Ga0501068_0781001 3300049584 Bacteria 626
369 Ga0501069_0008174 3300049585 Bacteria 5495
370 Ga0501069_0027529 3300049585 Bacteria 3114
371 Ga0501070_0000308 3300049586 Bacteria 44689
372 Ga0501070_0003118 3300049586 Bacteria 14437
373 Ga0501070_0149165 3300049586 Bacteria 1929
374 Ga0501071_0163090 3300049587 Bacteria 1666
375 Ga0501072_0111716 3300049588 Bacteria 2175
376 Ga0501072_0158471 3300049588 Bacteria 1805
377 Ga0501072_0338581 3300049588 Bacteria 1195
378 Ga0501073_0036767 3300049589 Bacteria 3478
379 Ga0501073_0273097 3300049589 Bacteria 1166
380 Ga0501074_0024186 3300049590 Bacteria 4415
381 Ga0501074_0123888 3300049590 Bacteria 1848
382 Ga0501074_0145248 3300049590 Bacteria 1696
383 Ga0501076_0128727 3300049592 Bacteria 2052
384 Ga0501079_0026475 3300049741 Bacteria 4446
385 Ga0501079_0147464 3300049741 Bacteria 1834
386 Ga0501079_0322253 3300049741 Bacteria 1210
387 Ga0501080_0048663 3300049742 Bacteria 3945
388 Ga0501080_0114240 3300049742 Bacteria 2503
389 Ga0501080_0447440 3300049742 Bacteria 1158
390 Ga0501081_0790254 3300049743 Bacteria 714
391 Ga0501083_0008321 3300049744 Bacteria 7337
392 Ga0501083_0011546 3300049744 Bacteria 6195
393 Ga0501083_0044916 3300049744 Bacteria 2990
394 Ga0501035_0000736 3300049822 Bacteria 35413
395 Ga0501044_0000211 3300049823 Bacteria 73920
396 Ga0501044_0057786 3300049823 Bacteria 3980
397 Ga0501044_0752754 3300049823 Bacteria 856
398 Ga0501045_0374336 3300049824 Bacteria 1060
399 Ga0501045_0464467 3300049824 Bacteria 941
400 Ga0501045_0798937 3300049824 Bacteria 695
401 Ga0501045_0906406 3300049824 Bacteria 648
402 nmdc:mga03n38_13318_c1 3300050490 Bacteria 3120
403 nmdc:mga00v17_20105_c1 3300050491 Bacteria 3821
404 nmdc:mga00v17_710667_c1 3300050491 Bacteria 644
405 nmdc:mga0yw44_30815_c2 3300050492 Bacteria 1811
406 nmdc:mga0yw44_381896_c1 3300050492 Unclassified 951
407 nmdc:mga0yw44_871223_c1 3300050492 Bacteria 611
408 nmdc:mga0yw44_89776_c1 3300050492 Bacteria 1940
409 nmdc:mga04h51_166100_c1 3300050495 Bacteria 852
410 nmdc:mga0qj67_378863_c1 3300050509 Bacteria 1143
411 nmdc:mga06r32_277242_c1 3300050510 Bacteria 1664
412 nmdc:mga06r32_290079_c1 3300050510 Bacteria 1623
413 nmdc:mga0n895_305215_c1 3300050512 Bacteria 1613
414 nmdc:mga0a205_7810_c1 3300050515 Bacteria 9715
415 Ga0495601_0000261 3300053077 Bacteria 28454
416 Ga0495601_0013682 3300053077 Bacteria 4880
417 Ga0495601_1000044 3300053077 Unclassified 526
418 Ga0495612_0000880 3300053078 Bacteria 12262
419 Ga0495612_0008451 3300053078 Bacteria 4175
420 Ga0495612_0074948 3300053078 Bacteria 1415
421 Ga0495595_0413264 3300053084 Bacteria 684
422 Ga0495619_0000010 3300053085 Bacteria 302390
423 Ga0495619_0000765 3300053085 Bacteria 20982
424 Ga0495619_0002751 3300053085 Bacteria 11480
425 Ga0495619_0005241 3300053085 Bacteria 8218
426 Ga0500566_0000943 3300053094 Bacteria 16679
427 Ga0500554_007652 3300053102 Bacteria 2497
428 Ga0500595_009661 3300053119 Bacteria 3883
429 Ga0500614_068854 3300053123 Bacteria 967
430 Ga0501082_0064322 3300060353 Bacteria 3159

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025910 Ga0207684_10655767 Ga0207684_106557672 120
2 3300005347 Ga0070668_100164783 Ga0070668_1001647832 128
3 3300045976 Ga0466967_1981223 Ga0466967_1981223_10_396 128
4 3300048919 Ga0496116_0000257 Ga0496116_0000257_42694_43134 141
5 3300048922 Ga0496119_0003792 Ga0496119_0003792_1850_2290 141
6 3300046642 Ga0495634_0000059 Ga0495634_0000059_72553_73005 144
7 3300046691 Ga0495670_0746940 Ga0495670_0746940_45_479 144
8 3300049589 Ga0501073_0036767 Ga0501073_0036767_1244_1678 144
9 3300049824 Ga0501045_0906406 Ga0501045_0906406_13_447 144
10 3300001977 JGI24746J21847_1000516 JGI24746J21847_10005163 146
11 3300002459 JGI24751J29686_10038121 JGI24751J29686_100381212 146
12 3300003322 rootL2_10273478 rootL2_102734782 146
13 3300005329 Ga0070683_100005111 Ga0070683_1000051113 146
14 3300005329 Ga0070683_100077794 Ga0070683_1000777944 146
15 3300005329 Ga0070683_101252499 Ga0070683_1012524991 146
16 3300005333 Ga0070677_10000082 Ga0070677_100000827 146
17 3300005335 Ga0070666_10122694 Ga0070666_101226942 146
18 3300005335 Ga0070666_10215568 Ga0070666_102155681 146
19 3300005336 Ga0070680_101799226 Ga0070680_1017992261 146
20 3300005337 Ga0070682_100000017 Ga0070682_1000000176 146
21 3300005338 Ga0068868_100000033 Ga0068868_10000003333 146
22 3300005340 Ga0070689_100115196 Ga0070689_1001151963 146
23 3300005344 Ga0070661_100000121 Ga0070661_10000012111 146
24 3300005344 Ga0070661_101407745 Ga0070661_1014077451 146
25 3300005347 Ga0070668_100001145 Ga0070668_10000114523 146
26 3300005353 Ga0070669_100203553 Ga0070669_1002035532 146
27 3300005356 Ga0070674_100000002 Ga0070674_100000002139 146
28 3300005356 Ga0070674_100000009 Ga0070674_10000000945 146
29 3300005435 Ga0070714_100152320 Ga0070714_1001523202 146
30 3300005435 Ga0070714_100660812 Ga0070714_1006608122 146
31 3300005439 Ga0070711_100003868 Ga0070711_1000038683 146
32 3300005441 Ga0070700_100453888 Ga0070700_1004538882 146
33 3300005441 Ga0070700_100883141 Ga0070700_1008831411 146
34 3300005455 Ga0070663_100000065 Ga0070663_1000000652 146
35 3300005455 Ga0070663_100382503 Ga0070663_1003825032 146
36 3300005456 Ga0070678_100012972 Ga0070678_1000129722 146
37 3300005456 Ga0070678_100035649 Ga0070678_1000356492 146
38 3300005457 Ga0070662_100000002 Ga0070662_10000000241 146
39 3300005458 Ga0070681_10230121 Ga0070681_102301211 146
40 3300005458 Ga0070681_10396679 Ga0070681_103966792 146
41 3300005459 Ga0068867_100004390 Ga0068867_1000043904 146
42 3300005530 Ga0070679_100002020 Ga0070679_10000202010 146
43 3300005530 Ga0070679_100170416 Ga0070679_1001704163 146
44 3300005530 Ga0070679_100385516 Ga0070679_1003855162 146
45 3300005535 Ga0070684_100010013 Ga0070684_1000100132 146
46 3300005535 Ga0070684_100011008 Ga0070684_1000110085 146
47 3300005535 Ga0070684_100862836 Ga0070684_1008628362 146
48 3300005539 Ga0068853_100025426 Ga0068853_1000254262 146
49 3300005544 Ga0070686_100029755 Ga0070686_1000297552 146
50 3300005547 Ga0070693_100000406 Ga0070693_1000004069 146
51 3300005548 Ga0070665_100000040 Ga0070665_100000040185 146
52 3300005548 Ga0070665_100003676 Ga0070665_1000036762 146
53 3300005563 Ga0068855_100242393 Ga0068855_1002423932 146
54 3300005563 Ga0068855_100256173 Ga0068855_1002561732 146
55 3300005564 Ga0070664_100381821 Ga0070664_1003818212 146
56 3300005578 Ga0068854_100117494 Ga0068854_1001174941 146
57 3300005614 Ga0068856_100000237 Ga0068856_1000002372 146
58 3300005614 Ga0068856_100003571 Ga0068856_1000035712 146
59 3300005614 Ga0068856_100017715 Ga0068856_1000177152 146
60 3300005616 Ga0068852_100000002 Ga0068852_10000000212 146
61 3300005618 Ga0068864_100000015 Ga0068864_10000001511 146
62 3300005718 Ga0068866_10000003 Ga0068866_1000000397 146
63 3300005718 Ga0068866_10000036 Ga0068866_100000365 146
64 3300005719 Ga0068861_100068033 Ga0068861_1000680332 146
65 3300005834 Ga0068851_10060758 Ga0068851_100607583 146
66 3300005841 Ga0068863_100001187 Ga0068863_1000011878 146
67 3300005842 Ga0068858_100000156 Ga0068858_10000015618 146
68 3300005843 Ga0068860_100004826 Ga0068860_1000048268 146
69 3300005844 Ga0068862_101295642 Ga0068862_1012956422 146
70 3300005937 Ga0081455_10042559 Ga0081455_100425595 146
71 3300005937 Ga0081455_10406052 Ga0081455_104060521 146
72 3300005983 Ga0081540_1157397 Ga0081540_11573972 146
73 3300006038 Ga0075365_10049928 Ga0075365_100499282 146
74 3300006038 Ga0075365_10118597 Ga0075365_101185974 146
75 3300006038 Ga0075365_10921484 Ga0075365_109214841 146
76 3300006042 Ga0075368_10140541 Ga0075368_101405412 146
77 3300006048 Ga0075363_100122194 Ga0075363_1001221943 146
78 3300006048 Ga0075363_100627828 Ga0075363_1006278281 146
79 3300006051 Ga0075364_10039119 Ga0075364_100391193 146
80 3300006051 Ga0075364_10325955 Ga0075364_103259553 146
81 3300006051 Ga0075364_10669280 Ga0075364_106692802 146
82 3300006163 Ga0070715_10000001 Ga0070715_10000001634 146
83 3300006175 Ga0070712_100077517 Ga0070712_1000775173 146
84 3300006846 Ga0075430_100144120 Ga0075430_1001441203 146
85 3300006847 Ga0075431_100003809 Ga0075431_1000038092 146
86 3300006847 Ga0075431_100214239 Ga0075431_1002142393 146
87 3300006852 Ga0075433_10009335 Ga0075433_100093351 146
88 3300006871 Ga0075434_100306331 Ga0075434_1003063312 146
89 3300009092 Ga0105250_10222617 Ga0105250_102226172 146
90 3300009093 Ga0105240_11425260 Ga0105240_114252602 146
91 3300009094 Ga0111539_10512681 Ga0111539_105126812 146
92 3300009098 Ga0105245_10000201 Ga0105245_1000020112 146
93 3300009098 Ga0105245_10006128 Ga0105245_1000612813 146
94 3300009101 Ga0105247_10229602 Ga0105247_102296022 146
95 3300009101 Ga0105247_11522994 Ga0105247_115229941 146
96 3300009147 Ga0114129_12289170 Ga0114129_122891702 146
97 3300009148 Ga0105243_10065299 Ga0105243_100652993 146
98 3300009148 Ga0105243_11368475 Ga0105243_113684752 146
99 3300009176 Ga0105242_10024452 Ga0105242_100244526 146
100 3300009177 Ga0105248_10000175 Ga0105248_1000017545 146
101 3300009545 Ga0105237_10905475 Ga0105237_109054752 146
102 3300009551 Ga0105238_10000009 Ga0105238_10000009123 146
103 3300009551 Ga0105238_10535101 Ga0105238_105351012 146
104 3300009553 Ga0105249_10000050 Ga0105249_1000005047 146
105 3300009553 Ga0105249_12155998 Ga0105249_121559982 146
106 3300010375 Ga0105239_10637320 Ga0105239_106373202 146
107 3300010375 Ga0105239_10829214 Ga0105239_108292142 146
108 3300010375 Ga0105239_11552515 Ga0105239_115525152 146
109 3300011119 Ga0105246_10122598 Ga0105246_101225982 146
110 3300013104 Ga0157370_10009925 Ga0157370_100099254 146
111 3300013296 Ga0157374_10013622 Ga0157374_100136222 146
112 3300013296 Ga0157374_10418024 Ga0157374_104180242 146
113 3300013297 Ga0157378_10098914 Ga0157378_100989142 146
114 3300013297 Ga0157378_10826779 Ga0157378_108267791 146
115 3300013306 Ga0163162_11426264 Ga0163162_114262642 146
116 3300013307 Ga0157372_10535423 Ga0157372_105354231 146
117 3300013307 Ga0157372_12362999 Ga0157372_123629992 146
118 3300013308 Ga0157375_10000584 Ga0157375_100005842 146
119 3300013308 Ga0157375_11002868 Ga0157375_110028682 146
120 3300014325 Ga0163163_10174037 Ga0163163_101740372 146
121 3300014325 Ga0163163_10741586 Ga0163163_107415862 146
122 3300014326 Ga0157380_10001197 Ga0157380_100011972 146
123 3300014326 Ga0157380_10139726 Ga0157380_101397262 146
124 3300014968 Ga0157379_10013140 Ga0157379_100131403 146
125 3300014968 Ga0157379_10941904 Ga0157379_109419042 146
126 3300014969 Ga0157376_10134188 Ga0157376_101341882 146
127 3300025321 Ga0207656_10043544 Ga0207656_100435443 146
128 3300025893 Ga0207682_10000018 Ga0207682_100000183 146
129 3300025899 Ga0207642_10000002 Ga0207642_10000002349 146
130 3300025899 Ga0207642_10000377 Ga0207642_100003775 146
131 3300025903 Ga0207680_10007438 Ga0207680_100074382 146
132 3300025903 Ga0207680_10024487 Ga0207680_100244874 146
133 3300025903 Ga0207680_10258557 Ga0207680_102585572 146
134 3300025905 Ga0207685_10000005 Ga0207685_1000000597 146
135 3300025909 Ga0207705_10289941 Ga0207705_102899412 146
136 3300025911 Ga0207654_10560532 Ga0207654_105605321 146
137 3300025912 Ga0207707_10020589 Ga0207707_100205899 146
138 3300025912 Ga0207707_10291485 Ga0207707_102914853 146
139 3300025913 Ga0207695_11320161 Ga0207695_113201611 146
140 3300025914 Ga0207671_10129317 Ga0207671_101293172 146
141 3300025915 Ga0207693_10082967 Ga0207693_100829673 146
142 3300025916 Ga0207663_10001006 Ga0207663_100010064 146
143 3300025917 Ga0207660_11055421 Ga0207660_110554211 146
144 3300025920 Ga0207649_10000003 Ga0207649_10000003268 146
145 3300025920 Ga0207649_10209542 Ga0207649_102095421 146
146 3300025921 Ga0207652_10011749 Ga0207652_100117494 146
147 3300025921 Ga0207652_10015740 Ga0207652_100157402 146
148 3300025924 Ga0207694_10000004 Ga0207694_10000004172 146
149 3300025927 Ga0207687_10000015 Ga0207687_10000015214 146
150 3300025927 Ga0207687_10000020 Ga0207687_10000020185 146
151 3300025927 Ga0207687_10001695 Ga0207687_1000169512 146
152 3300025927 Ga0207687_10966782 Ga0207687_109667822 146
153 3300025929 Ga0207664_10228180 Ga0207664_102281802 146
154 3300025933 Ga0207706_10000001 Ga0207706_10000001221 146
155 3300025934 Ga0207686_10042696 Ga0207686_100426963 146
156 3300025935 Ga0207709_10072697 Ga0207709_100726972 146
157 3300025936 Ga0207670_10522488 Ga0207670_105224882 146
158 3300025937 Ga0207669_10000001 Ga0207669_10000001193 146
159 3300025937 Ga0207669_10000003 Ga0207669_10000003155 146
160 3300025937 Ga0207669_11403585 Ga0207669_114035852 146
161 3300025939 Ga0207665_10116247 Ga0207665_101162472 146
162 3300025941 Ga0207711_10000006 Ga0207711_1000000638 146
163 3300025941 Ga0207711_10101206 Ga0207711_101012063 146
164 3300025944 Ga0207661_10009225 Ga0207661_100092254 146
165 3300025944 Ga0207661_10009386 Ga0207661_100093862 146
166 3300025944 Ga0207661_10092868 Ga0207661_100928683 146
167 3300025945 Ga0207679_10311534 Ga0207679_103115342 146
168 3300025949 Ga0207667_10189094 Ga0207667_101890943 146
169 3300025960 Ga0207651_10001383 Ga0207651_100013835 146
170 3300025961 Ga0207712_10000019 Ga0207712_10000019120 146
171 3300025961 Ga0207712_10488614 Ga0207712_104886142 146
172 3300025981 Ga0207640_10083999 Ga0207640_100839991 146
173 3300025986 Ga0207658_10002662 Ga0207658_100026629 146
174 3300025986 Ga0207658_10193597 Ga0207658_101935972 146
175 3300026023 Ga0207677_10002270 Ga0207677_1000227015 146
176 3300026035 Ga0207703_10000704 Ga0207703_100007047 146
177 3300026041 Ga0207639_10036439 Ga0207639_100364393 146
178 3300026067 Ga0207678_10000253 Ga0207678_100002537 146
179 3300026067 Ga0207678_11052003 Ga0207678_110520032 146
180 3300026075 Ga0207708_10384130 Ga0207708_103841302 146
181 3300026075 Ga0207708_10746526 Ga0207708_107465261 146
182 3300026078 Ga0207702_10000251 Ga0207702_1000025168 146
183 3300026078 Ga0207702_10002325 Ga0207702_100023254 146
184 3300026078 Ga0207702_10018073 Ga0207702_100180732 146
185 3300026078 Ga0207702_10217649 Ga0207702_102176493 146
186 3300026078 Ga0207702_10959157 Ga0207702_109591572 146
187 3300026088 Ga0207641_10000827 Ga0207641_1000082717 146
188 3300026089 Ga0207648_10008149 Ga0207648_1000814910 146
189 3300026095 Ga0207676_10000018 Ga0207676_10000018289 146
190 3300026118 Ga0207675_100801634 Ga0207675_1008016342 146
191 3300026121 Ga0207683_10013570 Ga0207683_100135707 146
192 3300026121 Ga0207683_10148883 Ga0207683_101488833 146
193 3300026142 Ga0207698_10000004 Ga0207698_10000004273 146
194 3300027866 Ga0209813_10142164 Ga0209813_101421642 146
195 3300028379 Ga0268266_10000045 Ga0268266_10000045187 146
196 3300028379 Ga0268266_10000491 Ga0268266_1000049151 146
197 3300028379 Ga0268266_10001210 Ga0268266_1000121011 146
198 3300028379 Ga0268266_12372414 Ga0268266_123724141 146
199 3300028380 Ga0268265_10110742 Ga0268265_101107424 146
200 3300028380 Ga0268265_11939312 Ga0268265_119393122 146
201 3300031727 Ga0316576_10039140 Ga0316576_100391403 146
202 3300031728 Ga0316578_10228041 Ga0316578_102280412 146
203 3300035398 Ga0316574_0075593 Ga0316574_0075593_1582_2022 146
204 3300035725 Ga0373947_0663523 Ga0373947_0663523_61_501 146
205 3300036401 Ga0373937_0644600 Ga0373937_0644600_130_570 146
206 3300041512 Ga0451853_3960444 Ga0451853_3960444_5198_5638 146
207 3300042438 Ga0439459_0102608 Ga0439459_0102608_143_583 146
208 3300044694 Ga0466963_0000127 Ga0466963_0000127_10282_10722 146
209 3300044901 Ga0466960_0270196 Ga0466960_0270196_57_497 146
210 3300044901 Ga0466960_0340744 Ga0466960_0340744_218_658 146
211 3300045976 Ga0466967_0172081 Ga0466967_0172081_1269_1709 146
212 3300046454 Ga0495592_0069782 Ga0495592_0069782_569_1009 146
213 3300046454 Ga0495592_0210973 Ga0495592_0210973_84_524 146
214 3300046459 Ga0495629_0004716 Ga0495629_0004716_7941_8381 146
215 3300046459 Ga0495629_0250233 Ga0495629_0250233_155_595 146
216 3300046459 Ga0495629_0447260 Ga0495629_0447260_284_724 146
217 3300046460 Ga0495638_0027318 Ga0495638_0027318_221_661 146
218 3300046461 Ga0495641_0000214 Ga0495641_0000214_11282_11722 146
219 3300046461 Ga0495641_0192014 Ga0495641_0192014_102_542 146
220 3300046462 Ga0495651_0051355 Ga0495651_0051355_841_1281 146
221 3300046462 Ga0495651_0169163 Ga0495651_0169163_130_570 146
222 3300046462 Ga0495651_0196049 Ga0495651_0196049_606_1046 146
223 3300046463 Ga0495653_0102454 Ga0495653_0102454_1537_1977 146
224 3300046473 Ga0495582_0000009 Ga0495582_0000009_18014_18454 146
225 3300046475 Ga0495639_0038529 Ga0495639_0038529_1158_1598 146
226 3300046476 Ga0495662_0007572 Ga0495662_0007572_3472_3912 146
227 3300046476 Ga0495662_0301393 Ga0495662_0301393_260_700 146
228 3300046477 Ga0495664_0183943 Ga0495664_0183943_21_461 146
229 3300046507 Ga0495606_0000017 Ga0495606_0000017_280699_281139 146
230 3300046512 Ga0495610_0031729 Ga0495610_0031729_1610_2050 146
231 3300046515 Ga0495620_0004866 Ga0495620_0004866_2010_2450 146
232 3300046516 Ga0495628_0020460 Ga0495628_0020460_2964_3404 146
233 3300046516 Ga0495628_0078369 Ga0495628_0078369_396_836 146
234 3300046517 Ga0495630_0000060 Ga0495630_0000060_87631_88071 146
235 3300046520 Ga0495637_0161555 Ga0495637_0161555_266_706 146
236 3300046535 Ga0495586_0014277 Ga0495586_0014277_517_957 146
237 3300046535 Ga0495586_0458442 Ga0495586_0458442_264_704 146
238 3300046536 Ga0495587_0128311 Ga0495587_0128311_203_643 146
239 3300046539 Ga0495621_0001490 Ga0495621_0001490_3570_4010 146
240 3300046543 Ga0495645_0005265 Ga0495645_0005265_7172_7612 146
241 3300046543 Ga0495645_0649640 Ga0495645_0649640_167_607 146
242 3300046615 Ga0495656_0000800 Ga0495656_0000800_17_475 146
243 3300046642 Ga0495634_0019243 Ga0495634_0019243_3959_4399 146
244 3300046642 Ga0495634_0097746 Ga0495634_0097746_489_929 146
245 3300046660 Ga0495625_0328155 Ga0495625_0328155_82_522 146
246 3300046663 Ga0495635_0000057 Ga0495635_0000057_51574_52014 146
247 3300046663 Ga0495635_0379077 Ga0495635_0379077_45_485 146
248 3300046674 Ga0495588_0000229 Ga0495588_0000229_33797_34237 146
249 3300046674 Ga0495588_0158256 Ga0495588_0158256_352_792 146
250 3300046675 Ga0495657_0053901 Ga0495657_0053901_1983_2423 146
251 3300046675 Ga0495657_0075691 Ga0495657_0075691_659_1135 146
252 3300046678 Ga0495599_0013261 Ga0495599_0013261_1384_1824 146
253 3300046680 Ga0495646_0162194 Ga0495646_0162194_33_473 146
254 3300046680 Ga0495646_0516298 Ga0495646_0516298_48_488 146
255 3300046681 Ga0495647_0010858 Ga0495647_0010858_746_1186 146
256 3300046681 Ga0495647_0058853 Ga0495647_0058853_770_1210 146
257 3300046681 Ga0495647_0076212 Ga0495647_0076212_465_905 146
258 3300046683 Ga0495658_0000002 Ga0495658_0000002_18009_18449 146
259 3300046683 Ga0495658_0017135 Ga0495658_0017135_1960_2400 146
260 3300046684 Ga0495669_0012895 Ga0495669_0012895_2930_3370 146
261 3300046684 Ga0495669_0025492 Ga0495669_0025492_1757_2197 146
262 3300046689 Ga0495613_0004788 Ga0495613_0004788_9262_9702 146
263 3300046689 Ga0495613_0266809 Ga0495613_0266809_680_1138 146
264 3300046690 Ga0495624_0118693 Ga0495624_0118693_817_1257 146
265 3300046690 Ga0495624_0141498 Ga0495624_0141498_505_945 146
266 3300046809 Ga0495600_0165169 Ga0495600_0165169_294_734 146
267 3300046810 Ga0495660_0149200 Ga0495660_0149200_646_1086 146
268 3300047317 Ga0495604_0000100 Ga0495604_0000100_18213_18653 146
269 3300047317 Ga0495604_0296075 Ga0495604_0296075_467_907 146
270 3300047321 Ga0495676_0000346 Ga0495676_0000346_28655_29095 146
271 3300047321 Ga0495676_0008907 Ga0495676_0008907_2035_2475 146
272 3300047321 Ga0495676_0041908 Ga0495676_0041908_2891_3331 146
273 3300047321 Ga0495676_0310513 Ga0495676_0310513_473_913 146
274 3300047322 Ga0495680_0000312 Ga0495680_0000312_38107_38547 146
275 3300047322 Ga0495680_0003619 Ga0495680_0003619_162_602 146
276 3300047472 Ga0495686_0132026 Ga0495686_0132026_164_604 146
277 3300048088 Ga0495602_0334433 Ga0495602_0334433_420_860 146
278 3300048903 Ga0496100_0000001 Ga0496100_0000001_200604_201044 146
279 3300048903 Ga0496100_0000010 Ga0496100_0000010_17131_17571 146
280 3300048903 Ga0496100_0518916 Ga0496100_0518916_80_520 146
281 3300048904 Ga0496101_0000004 Ga0496101_0000004_1956_2396 146
282 3300048904 Ga0496101_0000025 Ga0496101_0000025_17131_17571 146
283 3300048904 Ga0496101_0363722 Ga0496101_0363722_270_710 146
284 3300048905 Ga0496102_0123681 Ga0496102_0123681_55_495 146
285 3300048905 Ga0496102_0556951 Ga0496102_0556951_260_700 146
286 3300048906 Ga0496103_0068876 Ga0496103_0068876_1256_1696 146
287 3300048907 Ga0496104_0000024 Ga0496104_0000024_189457_189897 146
288 3300048907 Ga0496104_0019269 Ga0496104_0019269_4286_4726 146
289 3300048908 Ga0496105_0000013 Ga0496105_0000013_40017_40457 146
290 3300048908 Ga0496105_0069629 Ga0496105_0069629_35_475 146
291 3300048908 Ga0496105_0205764 Ga0496105_0205764_940_1380 146
292 3300048909 Ga0496106_0000012 Ga0496106_0000012_187606_188046 146
293 3300048909 Ga0496106_0008407 Ga0496106_0008407_5346_5786 146
294 3300048909 Ga0496106_0121876 Ga0496106_0121876_443_883 146
295 3300048910 Ga0496107_0000002 Ga0496107_0000002_47444_47884 146
296 3300048910 Ga0496107_0000010 Ga0496107_0000010_187618_188058 146
297 3300048910 Ga0496107_0036920 Ga0496107_0036920_247_687 146
298 3300048911 Ga0496108_0000006 Ga0496108_0000006_40126_40566 146
299 3300048911 Ga0496108_0115941 Ga0496108_0115941_1363_1803 146
300 3300048911 Ga0496108_0386040 Ga0496108_0386040_510_950 146
301 3300048912 Ga0496109_0000004 Ga0496109_0000004_212869_213309 146
302 3300048912 Ga0496109_1365088 Ga0496109_1365088_22_462 146
303 3300048913 Ga0496110_0070708 Ga0496110_0070708_988_1428 146
304 3300048913 Ga0496110_0147510 Ga0496110_0147510_1325_1765 146
305 3300048913 Ga0496110_0341644 Ga0496110_0341644_792_1232 146
306 3300048913 Ga0496110_0718370 Ga0496110_0718370_47_487 146
307 3300048913 Ga0496110_1485804 Ga0496110_1485804_35_475 146
308 3300048914 Ga0496111_0122749 Ga0496111_0122749_1282_1722 146
309 3300048914 Ga0496111_0231807 Ga0496111_0231807_386_826 146
310 3300048914 Ga0496111_0632391 Ga0496111_0632391_170_610 146
311 3300048914 Ga0496111_0726522 Ga0496111_0726522_248_688 146
312 3300048915 Ga0496112_0000006 Ga0496112_0000006_155409_155849 146
313 3300048916 Ga0496113_0042961 Ga0496113_0042961_2745_3185 146
314 3300048916 Ga0496113_0505320 Ga0496113_0505320_412_852 146
315 3300048916 Ga0496113_0510050 Ga0496113_0510050_138_578 146
316 3300048917 Ga0496114_0114718 Ga0496114_0114718_461_901 146
317 3300048917 Ga0496114_0160207 Ga0496114_0160207_468_908 146
318 3300048917 Ga0496114_1164357 Ga0496114_1164357_178_618 146
319 3300048920 Ga0496117_0006062 Ga0496117_0006062_1814_2254 146
320 3300048920 Ga0496117_0213951 Ga0496117_0213951_339_779 146
321 3300048921 Ga0496118_0005497 Ga0496118_0005497_12487_12927 146
322 3300048921 Ga0496118_0051150 Ga0496118_0051150_2674_3114 146
323 3300048922 Ga0496119_0026965 Ga0496119_0026965_2131_2571 146
324 3300048923 Ga0496120_0009134 Ga0496120_0009134_3350_3790 146
325 3300048923 Ga0496120_0064758 Ga0496120_0064758_244_684 146
326 3300048924 Ga0496121_0010139 Ga0496121_0010139_846_1286 146
327 3300048924 Ga0496121_0077558 Ga0496121_0077558_233_673 146
328 3300048924 Ga0496121_0169476 Ga0496121_0169476_54_494 146
329 3300048927 Ga0496124_0846606 Ga0496124_0846606_27_467 146
330 3300048928 Ga0496125_0055663 Ga0496125_0055663_2759_3199 146
331 3300048928 Ga0496125_0116794 Ga0496125_0116794_824_1264 146
332 3300048928 Ga0496125_0220800 Ga0496125_0220800_130_570 146
333 3300048928 Ga0496125_0389677 Ga0496125_0389677_35_475 146
334 3300048929 Ga0496126_0062881 Ga0496126_0062881_567_1007 146
335 3300048929 Ga0496126_0297475 Ga0496126_0297475_808_1248 146
336 3300048929 Ga0496126_0344918 Ga0496126_0344918_342_782 146
337 3300048929 Ga0496126_0672289 Ga0496126_0672289_239_679 146
338 3300049568 Ga0501031_0000682 Ga0501031_0000682_688_1128 146
339 3300049569 Ga0501032_0033562 Ga0501032_0033562_2318_2758 146
340 3300049569 Ga0501032_0406470 Ga0501032_0406470_231_671 146
341 3300049570 Ga0501033_0000534 Ga0501033_0000534_15789_16229 146
342 3300049571 Ga0501034_0003560 Ga0501034_0003560_14083_14529 146
343 3300049571 Ga0501034_0075794 Ga0501034_0075794_1472_1912 146
344 3300049571 Ga0501034_0166673 Ga0501034_0166673_935_1375 146
345 3300049571 Ga0501034_0348581 Ga0501034_0348581_53_493 146
346 3300049571 Ga0501034_1203223 Ga0501034_1203223_33_473 146
347 3300049572 Ga0501036_0000680 Ga0501036_0000680_19257_19697 146
348 3300049572 Ga0501036_0525534 Ga0501036_0525534_257_703 146
349 3300049573 Ga0501037_0000719 Ga0501037_0000719_5550_5990 146
350 3300049574 Ga0501038_0001734 Ga0501038_0001734_670_1110 146
351 3300049575 Ga0501039_0181732 Ga0501039_0181732_680_1120 146
352 3300049575 Ga0501039_0212804 Ga0501039_0212804_820_1260 146
353 3300049576 Ga0501040_0233834 Ga0501040_0233834_247_687 146
354 3300049578 Ga0501042_0074542 Ga0501042_0074542_349_789 146
355 3300049579 Ga0501043_0000291 Ga0501043_0000291_29165_29605 146
356 3300049579 Ga0501043_0331193 Ga0501043_0331193_266_706 146
357 3300049580 Ga0501046_0001836 Ga0501046_0001836_669_1109 146
358 3300049580 Ga0501046_0658707 Ga0501046_0658707_56_496 146
359 3300049581 Ga0501047_0000313 Ga0501047_0000313_15701_16141 146
360 3300049581 Ga0501047_0004429 Ga0501047_0004429_572_1012 146
361 3300049581 Ga0501047_0036397 Ga0501047_0036397_3668_4114 146
362 3300049581 Ga0501047_0082792 Ga0501047_0082792_2188_2628 146
363 3300049581 Ga0501047_0115397 Ga0501047_0115397_1125_1565 146
364 3300049581 Ga0501047_0647324 Ga0501047_0647324_338_778 146
365 3300049582 Ga0501048_0008340 Ga0501048_0008340_2077_2517 146
366 3300049583 Ga0501067_0255268 Ga0501067_0255268_26_466 146
367 3300049584 Ga0501068_0082306 Ga0501068_0082306_388_828 146
368 3300049584 Ga0501068_0126626 Ga0501068_0126626_670_1110 146
369 3300049584 Ga0501068_0767728 Ga0501068_0767728_113_553 146
370 3300049584 Ga0501068_0781001 Ga0501068_0781001_145_585 146
371 3300049585 Ga0501069_0008174 Ga0501069_0008174_4838_5278 146
372 3300049585 Ga0501069_0027529 Ga0501069_0027529_2389_2829 146
373 3300049586 Ga0501070_0000308 Ga0501070_0000308_38910_39350 146
374 3300049586 Ga0501070_0003118 Ga0501070_0003118_11004_11444 146
375 3300049586 Ga0501070_0149165 Ga0501070_0149165_1204_1644 146
376 3300049587 Ga0501071_0163090 Ga0501071_0163090_727_1167 146
377 3300049588 Ga0501072_0111716 Ga0501072_0111716_63_503 146
378 3300049588 Ga0501072_0158471 Ga0501072_0158471_497_937 146
379 3300049588 Ga0501072_0338581 Ga0501072_0338581_502_942 146
380 3300049589 Ga0501073_0273097 Ga0501073_0273097_37_477 146
381 3300049590 Ga0501074_0024186 Ga0501074_0024186_2485_2925 146
382 3300049590 Ga0501074_0123888 Ga0501074_0123888_1027_1467 146
383 3300049590 Ga0501074_0145248 Ga0501074_0145248_587_1027 146
384 3300049592 Ga0501076_0128727 Ga0501076_0128727_351_791 146
385 3300049741 Ga0501079_0026475 Ga0501079_0026475_2385_2825 146
386 3300049741 Ga0501079_0147464 Ga0501079_0147464_553_1005 146
387 3300049741 Ga0501079_0322253 Ga0501079_0322253_585_1025 146
388 3300049742 Ga0501080_0048663 Ga0501080_0048663_3328_3768 146
389 3300049742 Ga0501080_0114240 Ga0501080_0114240_829_1269 146
390 3300049742 Ga0501080_0447440 Ga0501080_0447440_677_1117 146
391 3300049743 Ga0501081_0790254 Ga0501081_0790254_93_533 146
392 3300049744 Ga0501083_0008321 Ga0501083_0008321_690_1130 146
393 3300049744 Ga0501083_0011546 Ga0501083_0011546_887_1327 146
394 3300049744 Ga0501083_0044916 Ga0501083_0044916_1811_2251 146
395 3300049822 Ga0501035_0000736 Ga0501035_0000736_15679_16119 146
396 3300049823 Ga0501044_0000211 Ga0501044_0000211_5333_5773 146
397 3300049823 Ga0501044_0057786 Ga0501044_0057786_930_1370 146
398 3300049823 Ga0501044_0752754 Ga0501044_0752754_23_463 146
399 3300049824 Ga0501045_0374336 Ga0501045_0374336_583_1023 146
400 3300049824 Ga0501045_0464467 Ga0501045_0464467_62_502 146
401 3300049824 Ga0501045_0798937 Ga0501045_0798937_28_468 146
402 3300050490 nmdc:mga03n38_13318_c1 nmdc:mga03n38_13318_c1_1392_1832 146
403 3300050491 nmdc:mga00v17_20105_c1 nmdc:mga00v17_20105_c1_1824_2264 146
404 3300050491 nmdc:mga00v17_710667_c1 nmdc:mga00v17_710667_c1_153_593 146
405 3300050492 nmdc:mga0yw44_30815_c2 nmdc:mga0yw44_30815_c2_17_457 146
406 3300050492 nmdc:mga0yw44_381896_c1 nmdc:mga0yw44_381896_c1_123_563 146
407 3300050492 nmdc:mga0yw44_871223_c1 nmdc:mga0yw44_871223_c1_76_516 146
408 3300050492 nmdc:mga0yw44_89776_c1 nmdc:mga0yw44_89776_c1_640_1080 146
409 3300050495 nmdc:mga04h51_166100_c1 nmdc:mga04h51_166100_c1_219_659 146
410 3300050509 nmdc:mga0qj67_378863_c1 nmdc:mga0qj67_378863_c1_192_632 146
411 3300050510 nmdc:mga06r32_277242_c1 nmdc:mga06r32_277242_c1_637_1077 146
412 3300050510 nmdc:mga06r32_290079_c1 nmdc:mga06r32_290079_c1_428_868 146
413 3300050512 nmdc:mga0n895_305215_c1 nmdc:mga0n895_305215_c1_735_1175 146
414 3300050515 nmdc:mga0a205_7810_c1 nmdc:mga0a205_7810_c1_7344_7784 146
415 3300053077 Ga0495601_0000261 Ga0495601_0000261_422_862 146
416 3300053077 Ga0495601_0013682 Ga0495601_0013682_3210_3686 146
417 3300053077 Ga0495601_1000044 Ga0495601_1000044_11_451 146
418 3300053078 Ga0495612_0000880 Ga0495612_0000880_10653_11093 146
419 3300053078 Ga0495612_0008451 Ga0495612_0008451_1799_2239 146
420 3300053078 Ga0495612_0074948 Ga0495612_0074948_112_552 146
421 3300053084 Ga0495595_0413264 Ga0495595_0413264_121_570 146
422 3300053085 Ga0495619_0000010 Ga0495619_0000010_240696_241136 146
423 3300053085 Ga0495619_0000765 Ga0495619_0000765_8735_9175 146
424 3300053085 Ga0495619_0002751 Ga0495619_0002751_10602_11042 146
425 3300053085 Ga0495619_0005241 Ga0495619_0005241_6058_6498 146
426 3300053094 Ga0500566_0000943 Ga0500566_0000943_854_1294 146
427 3300053102 Ga0500554_007652 Ga0500554_007652_1160_1600 146
428 3300053119 Ga0500595_009661 Ga0500595_009661_1849_2289 146
429 3300053123 Ga0500614_068854 Ga0500614_068854_124_564 146
430 3300060353 Ga0501082_0064322 Ga0501082_0064322_1801_2241 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

4

122

0.9

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

6

131

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rlj-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis 0.8935 3 144
4rlw-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with butein 0.8931 6 144
5i7n-assembly1.cif.gz_A-2 maoc-like dehydratase 0.8833 7 146
4v12-assembly1.cif.gz_A-2 crystal structure of the msmeg_6754 dehydratase from mycobacterium smegmatis 0.8813 7 143
4rlt-assembly1.cif.gz_A crystal structure of (3r)-hydroxyacyl-acp dehydratase hadab hetero-dimer from mycobacterium tuberculosis complexed with fisetin 0.8805 1 144
ID Description Score Start End Superfamily
af_P9WFK3_7_161_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8938 6 145 3.10.129.10
4rltA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8806 1 144 3.10.129.10
af_Q5A4W7_1240_1442_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8738 8 145 3.10.129.10
4rv2A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8732 8 141 3.10.129.10
2uvaG08 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8646 9 145 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A537ZWW6-F1-model_v4 MaoC family dehydratase 0.9862 34 146
AF-A0A537ZWW6-F1-model_v4 MaoC family dehydratase 0.9692 34 146
AF-A0A538ICL0-F1-model_v4 MaoC family dehydratase 0.9578 73 146
AF-A0A538AMH9-F1-model_v4 MaoC family dehydratase 0.9556 3 145 GO:0006633
GO:0019171
AF-A0A7Y5XYS2-F1-model_v4 MaoC family dehydratase 0.9541 14 144 GO:0016836

Feature Viewer

pLDDT pTM Quality
96.67 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map