F442175

General Info

Members Datasets Scaffolds Average Seq Length
430 260 860 234

Family's Representative Sequence

Representative Sequence 3300031649|Ga0307514_10165117|Ga0307514_101651172
Length 273
Sequence VSDDRGGEEIRRRPRRGRGRLRTASDRPDGSGGQPVPTVPAQDSGPYDVADDRELLARHVDGDPEAFGEIVRRHRDRLWAVAVRTLGDREEAADAVQDALISAYRAAHTFRGQSAVTTWLHRITVNACLDRARKAASRRTSLTDDTERLDQLLEPHESAEVPAERRDLHRQLIAALAQLPAEQRAALVLVDMQGYPVAEAAEVLGVAVGTVKSRCARGRARLLPLVTHLRPNGVVRGTAQQSGGRNRTQGASVPPPKGITEPPGAVMGGGEQT

Samples

Sample ID Description Type Environment
1 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
13 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
14 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
15 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
18 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
19 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
22 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
23 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
24 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
28 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
29 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
30 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
31 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
32 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
33 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
34 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
35 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
36 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
37 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
38 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
39 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
40 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
41 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
42 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
43 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
46 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
47 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
48 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
49 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
50 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
51 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
52 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
53 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
54 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
55 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
56 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
57 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
58 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
59 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
60 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
61 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
68 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
69 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
70 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
71 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
72 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
73 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
84 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
85 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
86 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
87 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
88 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
91 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
92 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
93 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
98 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
99 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
100 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
101 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
102 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
103 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
104 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
105 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
106 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
107 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
108 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
111 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
112 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
116 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
117 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
118 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
119 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
120 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
121 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
122 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
131 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
147 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
152 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
153 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
154 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
155 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
156 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
161 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
162 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
163 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
164 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
165 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
166 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
167 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
168 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
169 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
170 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
171 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
174 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
175 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
176 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
177 2643221548 Streptomyces sp. Root55 Isolate Unclassified
178 2643221578 Streptomyces sp. Root63 Isolate Unclassified
179 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
180 2643221670 Streptomyces sp. Root431 Isolate Unclassified
181 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
182 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
183 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
184 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
185 2643221714 Streptomyces sp. Root264 Isolate Unclassified
186 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
187 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
188 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
189 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
190 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
191 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
192 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
193 2808606448 Streptomyces sp. 193411 Isolate Unclassified
194 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
195 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
196 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
197 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
198 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
199 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
200 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
201 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
202 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
203 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
204 2862574272 Streptomyces sp. AcE210 Isolate Nodule
205 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
206 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
207 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
208 2867369537 Streptomyces sp. Z26 Isolate Unclassified
209 2867428634 Streptomyces sp. RP5T Isolate Unclassified
210 2867475112 Streptomyces sp. TM32 Isolate Unclassified
211 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
212 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
213 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
214 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
215 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
216 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
217 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
218 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
219 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
220 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
221 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
222 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
223 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
224 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
225 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
226 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
227 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
228 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
229 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
230 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
231 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
232 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
233 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
234 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
235 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
236 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
237 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
238 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
239 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
240 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
241 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
242 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
243 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
244 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
245 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
246 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
247 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
248 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
249 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
250 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
251 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
252 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
253 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
254 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
255 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
256 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
257 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
258 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
259 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
260 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 78.84
Metatranscriptomes 0.47
Isolates 20.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.95
Nodule 0.47
Rhizoplane 0.7
Rhizosphere 76.51
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307514_10165117 3300031649 Bacteria 1458
2 JGI24739J22299_10011962 3300001989 Bacteria 3190
3 JGI24735J21928_10014423 3300002067 Bacteria 2475
4 JGI24738J21930_10002970 3300002075 Bacteria 4332
5 rootH2_10016700 3300003320 Bacteria 9820
6 rootL2_10009330 3300003322 Bacteria 2666
7 rootH1_10065453 3300003323 Bacteria 3953
8 JGI25160J50197_1020810 3300003354 Bacteria 1968
9 Ga0006562J51391_1092124 3300003578 Bacteria 1690
10 Ga0006562J51391_1092125 3300003578 Bacteria 1517
11 Ga0070683_100779383 3300005329 Bacteria 916
12 Ga0068855_100467300 3300005563 Bacteria 1375
13 Ga0068854_100310420 3300005578 Bacteria 1279
14 Ga0075368_10007171 3300006042 Bacteria 3927
15 Ga0075367_10000116 3300006178 Bacteria 22957
16 Ga0105245_10068110 3300009098 Bacteria 3225
17 Ga0105243_10011156 3300009148 Bacteria 6796
18 Ga0105246_10000742 3300011119 Bacteria 18537
19 Ga0157372_10141966 3300013307 Bacteria 2768
20 Ga0182008_10000554 3300014497 Bacteria 27720
21 Ga0182007_10000530 3300015262 Bacteria 22535
22 Ga0182005_1020463 3300015265 Bacteria 1821
23 Ga0183367_1008 3300015688 Bacteria 490626
24 Ga0207426_1009234 3300025302 Bacteria 3919
25 Ga0207426_1009352 3300025302 Bacteria 3886
26 Ga0207426_1012536 3300025302 Bacteria 3179
27 Ga0207647_10004338 3300025904 Bacteria 10515
28 Ga0207709_10021047 3300025935 Bacteria 3688
29 Ga0207661_10690938 3300025944 Bacteria 938
30 Ga0209813_10005558 3300027866 Bacteria 3066
31 Ga0307517_10084485 3300028786 Bacteria 2671
32 Ga0307515_10001593 3300028794 Bacteria 50590
33 Ga0307515_10006297 3300028794 Bacteria 23796
34 Ga0307515_10501650 3300028794 Bacteria 824
35 Ga0307511_10000329 3300030521 Bacteria 50299
36 Ga0307511_10028726 3300030521 Bacteria 5040
37 Ga0307512_10104456 3300030522 Bacteria 1900
38 Ga0307513_10012049 3300031456 Bacteria 10697
39 Ga0307513_10044779 3300031456 Bacteria 4843
40 Ga0307509_10008697 3300031507 Bacteria 12861
41 Ga0307509_10022867 3300031507 Bacteria 7032
42 Ga0307509_10042213 3300031507 Bacteria 4945
43 Ga0307509_10328334 3300031507 Bacteria 1263
44 Ga0307408_100490392 3300031548 Bacteria 1074
45 Ga0307508_10003887 3300031616 Bacteria 14864
46 Ga0307508_10032688 3300031616 Bacteria 4699
47 Ga0307508_10070796 3300031616 Bacteria 3060
48 Ga0307508_10218081 3300031616 Bacteria 1508
49 Ga0307514_10037318 3300031649 Bacteria 3855
50 Ga0307514_10038892 3300031649 Bacteria 3760
51 Ga0307514_10327774 3300031649 Bacteria 835
52 Ga0307516_10001611 3300031730 Bacteria 31098
53 Ga0307516_10283195 3300031730 Bacteria 1339
54 Ga0307516_10401980 3300031730 Bacteria 1029
55 Ga0307518_10096674 3300031838 Bacteria 2119
56 Ga0307416_100137426 3300032002 Bacteria 2214
57 Ga0307507_10028969 3300033179 Bacteria 5884
58 Ga0307507_10086364 3300033179 Bacteria 2721
59 Ga0307510_10016158 3300033180 Bacteria 8816
60 Ga0307510_10069917 3300033180 Bacteria 3511
61 Ga0307510_10106570 3300033180 Bacteria 2565
62 Ga0307510_10120613 3300033180 Bacteria 2328
63 Ga0395899_0194493 3300037312 Bacteria 1418
64 Ga0395900_0815424 3300037418 Bacteria 860
65 Ga0395898_0003489 3300037466 Bacteria 17566
66 Ga0395898_0004365 3300037466 Bacteria 15475
67 Ga0395898_0087144 3300037466 Bacteria 3008
68 Ga0395901_0315023 3300038443 Bacteria 1620
69 Ga0439436_0000298 3300041404 Bacteria 12033
70 Ga0439439_0025479 3300041406 Bacteria 1488
71 Ga0451853_0417726 3300041512 Bacteria 1860
72 Ga0451853_0698697 3300041512 Bacteria 3392
73 Ga0451853_1031664 3300041512 Bacteria 3895
74 Ga0439433_0000181 3300041999 Bacteria 10034
75 Ga0439433_0010342 3300041999 Bacteria 2036
76 Ga0439442_033376 3300042002 Bacteria 1076
77 Ga0439449_0004474 3300042007 Bacteria 5397
78 Ga0439449_0041117 3300042007 Bacteria 1718
79 Ga0439449_0041299 3300042007 Bacteria 1714
80 Ga0439449_0071394 3300042007 Bacteria 1279
81 Ga0439450_023872 3300042008 Bacteria 1330
82 Ga0439455_0001562 3300042012 Bacteria 3885
83 Ga0439457_001030 3300042014 Bacteria 8410
84 Ga0439457_007683 3300042014 Bacteria 2580
85 Ga0439462_0029847 3300042015 Bacteria 1442
86 Ga0439462_0058976 3300042015 Bacteria 1037
87 Ga0450894_000019 3300042131 Bacteria 23129
88 Ga0450898_002071 3300042134 Bacteria 2757
89 Ga0450903_000524 3300042138 Bacteria 8016
90 Ga0450903_003122 3300042138 Bacteria 2887
91 Ga0450906_000303 3300042145 Bacteria 9869
92 Ga0439458_0000948 3300042157 Bacteria 7460
93 Ga0450908_023817 3300042184 Bacteria 1071
94 Ga0466969_0004202 3300044656 Bacteria 7643
95 Ga0466972_0000996 3300044658 Bacteria 13620
96 Ga0466972_0009152 3300044658 Bacteria 4973
97 Ga0466972_0023377 3300044658 Bacteria 3075
98 Ga0466965_0000266 3300044683 Bacteria 17061
99 Ga0466965_0075022 3300044683 Bacteria 1705
100 Ga0466966_0009948 3300044684 Bacteria 6303
101 Ga0466966_0033552 3300044684 Bacteria 3323
102 Ga0466961_0086246 3300044693 Bacteria 1984
103 Ga0466961_0148489 3300044693 Bacteria 1465
104 Ga0466963_0000900 3300044694 Bacteria 15113
105 Ga0466963_0347402 3300044694 Bacteria 1045
106 Ga0466964_0019539 3300044706 Bacteria 2604
107 Ga0466971_0000101 3300044719 Bacteria 31687
108 Ga0466971_0001965 3300044719 Bacteria 8707
109 Ga0466971_0017784 3300044719 Bacteria 3149
110 Ga0466971_0023059 3300044719 Bacteria 2773
111 Ga0466970_0011678 3300044765 Bacteria 4480
112 Ga0466970_0046098 3300044765 Bacteria 2321
113 Ga0466957_0000458 3300044842 Bacteria 20202
114 Ga0466959_0003745 3300045049 Bacteria 10059
115 Ga0466959_0026017 3300045049 Bacteria 4339
116 Ga0466959_0042187 3300045049 Bacteria 3365
117 Ga0466958_0228406 3300045836 Bacteria 1188
118 Ga0466967_0002379 3300045976 Bacteria 11653
119 Ga0466967_0946914 3300045976 Bacteria 857
120 Ga0495592_0006233 3300046454 Bacteria 8871
121 Ga0495592_0039036 3300046454 Bacteria 3569
122 Ga0495603_0021289 3300046455 Bacteria 3926
123 Ga0495603_0222637 3300046455 Bacteria 1088
124 Ga0495629_0004038 3300046459 Bacteria 11030
125 Ga0495629_0005048 3300046459 Bacteria 9878
126 Ga0495629_0142416 3300046459 Bacteria 1668
127 Ga0495629_0234675 3300046459 Bacteria 1264
128 Ga0495638_0242538 3300046460 Bacteria 997
129 Ga0495651_0002987 3300046462 Bacteria 13049
130 Ga0495651_0009883 3300046462 Bacteria 7337
131 Ga0495651_0076785 3300046462 Bacteria 2530
132 Ga0495653_0017140 3300046463 Bacteria 5891
133 Ga0495582_0106441 3300046473 Bacteria 1573
134 Ga0495662_0000224 3300046476 Bacteria 23821
135 Ga0495662_0004609 3300046476 Bacteria 6912
136 Ga0495664_0003655 3300046477 Bacteria 8384
137 Ga0495664_0029937 3300046477 Bacteria 3186
138 Ga0495664_0375878 3300046477 Bacteria 855
139 Ga0495585_0002986 3300046492 Bacteria 11685
140 Ga0495594_0030622 3300046499 Bacteria 2913
141 Ga0495594_0243261 3300046499 Bacteria 1025
142 Ga0495608_0000571 3300046511 Bacteria 25313
143 Ga0495618_0007595 3300046514 Bacteria 6563
144 Ga0495618_0248579 3300046514 Bacteria 1116
145 Ga0495628_0009883 3300046516 Bacteria 8122
146 Ga0495628_0017954 3300046516 Bacteria 5870
147 Ga0495630_0009141 3300046517 Bacteria 7126
148 Ga0495630_0080954 3300046517 Bacteria 2450
149 Ga0495666_0013578 3300046526 Bacteria 4060
150 Ga0495652_0049895 3300046529 Bacteria 3580
151 Ga0495652_0076953 3300046529 Bacteria 2766
152 Ga0495665_0005012 3300046531 Bacteria 7139
153 Ga0495640_0015712 3300046533 Bacteria 5686
154 Ga0495640_0028639 3300046533 Bacteria 4007
155 Ga0495640_0096460 3300046533 Bacteria 1945
156 Ga0495586_0016478 3300046535 Bacteria 3931
157 Ga0495587_0000559 3300046536 Bacteria 25651
158 Ga0495587_0003235 3300046536 Bacteria 10894
159 Ga0495645_0011674 3300046543 Bacteria 6184
160 Ga0495645_0016667 3300046543 Bacteria 5253
161 Ga0495622_0025371 3300046557 Bacteria 2769
162 Ga0495622_0037346 3300046557 Bacteria 2263
163 Ga0495667_0053212 3300046559 Bacteria 2666
164 Ga0495634_0002713 3300046642 Bacteria 14560
165 Ga0495634_0083896 3300046642 Bacteria 2079
166 Ga0495634_0129266 3300046642 Bacteria 1611
167 Ga0495611_0037742 3300046648 Bacteria 2147
168 Ga0495611_0053717 3300046648 Bacteria 1819
169 Ga0495625_0002746 3300046660 Bacteria 18634
170 Ga0495625_0010866 3300046660 Bacteria 7482
171 Ga0495635_0000585 3300046663 Bacteria 23441
172 Ga0495588_0002000 3300046674 Bacteria 8718
173 Ga0495588_0004748 3300046674 Bacteria 6007
174 Ga0495657_0003065 3300046675 Bacteria 13825
175 Ga0495657_0004290 3300046675 Bacteria 11383
176 Ga0495623_0017220 3300046679 Bacteria 4667
177 Ga0495646_0003260 3300046680 Bacteria 10094
178 Ga0495646_0070238 3300046680 Bacteria 2063
179 Ga0495658_0024844 3300046683 Bacteria 3197
180 Ga0495613_0004429 3300046689 Bacteria 10515
181 Ga0495613_0007850 3300046689 Bacteria 7934
182 Ga0495624_0071850 3300046690 Bacteria 2153
183 Ga0495624_0177839 3300046690 Bacteria 1297
184 Ga0495670_0033073 3300046691 Bacteria 2573
185 Ga0495649_0007230 3300046694 Bacteria 6802
186 Ga0495589_0019492 3300046794 Bacteria 3476
187 Ga0495589_0021235 3300046794 Bacteria 3318
188 Ga0495589_0023476 3300046794 Bacteria 3142
189 Ga0495589_0049433 3300046794 Bacteria 2081
190 Ga0495600_0006083 3300046809 Bacteria 7311
191 Ga0495600_0015422 3300046809 Bacteria 4830
192 Ga0495581_0006072 3300047315 Bacteria 7002
193 Ga0495581_0009276 3300047315 Bacteria 5695
194 Ga0495604_0000418 3300047317 Bacteria 38255
195 Ga0495604_0000570 3300047317 Bacteria 32433
196 Ga0495604_0008468 3300047317 Bacteria 8121
197 Ga0495636_0001703 3300047318 Bacteria 8381
198 Ga0495636_0001775 3300047318 Bacteria 8229
199 Ga0495636_0003764 3300047318 Bacteria 5904
200 Ga0495636_0018091 3300047318 Bacteria 2827
201 Ga0495674_0130426 3300047319 Bacteria 2118
202 Ga0495676_0001783 3300047321 Bacteria 18795
203 Ga0495676_0054835 3300047321 Bacteria 3165
204 Ga0495683_0038718 3300047323 Bacteria 2413
205 Ga0495687_002448 3300047443 Bacteria 14892
206 Ga0495687_007662 3300047443 Bacteria 6314
207 Ga0495675_0055080 3300047444 Bacteria 2522
208 Ga0495675_0203498 3300047444 Bacteria 1204
209 Ga0495685_001237 3300047447 Bacteria 7826
210 Ga0495685_002332 3300047447 Bacteria 5932
211 Ga0495685_016741 3300047447 Bacteria 2505
212 Ga0495685_075366 3300047447 Bacteria 1127
213 Ga0495681_0000384 3300047470 Bacteria 34515
214 Ga0495684_0016526 3300047471 Bacteria 5683
215 Ga0495684_0042429 3300047471 Bacteria 3484
216 Ga0495686_0049764 3300047472 Bacteria 2635
217 Ga0495593_0000135 3300047673 Bacteria 35475
218 Ga0495602_0055416 3300048088 Bacteria 3491
219 Ga0495602_0067132 3300048088 Bacteria 3087
220 Ga0495614_0002603 3300048089 Bacteria 8021
221 Ga0495614_0013051 3300048089 Bacteria 3642
222 Ga0495614_0035047 3300048089 Bacteria 2157
223 Ga0496109_0281289 3300048912 Bacteria 1568
224 Ga0496113_0367283 3300048916 Bacteria 1155
225 Ga0496123_0248635 3300048926 Bacteria 879
226 Ga0501031_0000765 3300049568 Bacteria 19320
227 Ga0501031_0002289 3300049568 Bacteria 12133
228 Ga0501031_0126400 3300049568 Bacteria 1670
229 Ga0501031_0189702 3300049568 Bacteria 1342
230 Ga0501032_0000748 3300049569 Bacteria 26429
231 Ga0501032_0004943 3300049569 Bacteria 9968
232 Ga0501032_0012466 3300049569 Bacteria 6074
233 Ga0501032_0023470 3300049569 Bacteria 4261
234 Ga0501032_0158196 3300049569 Bacteria 1488
235 Ga0501032_0193084 3300049569 Bacteria 1330
236 Ga0501033_0015875 3300049570 Bacteria 5704
237 Ga0501033_0020173 3300049570 Bacteria 5039
238 Ga0501033_0041690 3300049570 Bacteria 3424
239 Ga0501033_0042371 3300049570 Bacteria 3394
240 Ga0501033_0066214 3300049570 Bacteria 2656
241 Ga0501033_0075922 3300049570 Bacteria 2466
242 Ga0501033_0192695 3300049570 Bacteria 1458
243 Ga0501034_0017472 3300049571 Bacteria 7356
244 Ga0501034_0040723 3300049571 Bacteria 4701
245 Ga0501034_0063490 3300049571 Bacteria 3707
246 Ga0501034_0107293 3300049571 Bacteria 2785
247 Ga0501034_0312552 3300049571 Bacteria 1505
248 Ga0501034_0528978 3300049571 Bacteria 1090
249 Ga0501036_0066162 3300049572 Bacteria 3057
250 Ga0501036_0268880 3300049572 Bacteria 1427
251 Ga0501036_0290682 3300049572 Bacteria 1367
252 Ga0501036_0385247 3300049572 Bacteria 1170
253 Ga0501037_0003770 3300049573 Bacteria 10998
254 Ga0501037_0033575 3300049573 Bacteria 3789
255 Ga0501037_0035393 3300049573 Bacteria 3682
256 Ga0501037_0355849 3300049573 Bacteria 1009
257 Ga0501037_0387241 3300049573 Bacteria 960
258 Ga0501038_0004119 3300049574 Bacteria 13527
259 Ga0501038_0005857 3300049574 Bacteria 11369
260 Ga0501038_0016004 3300049574 Bacteria 6814
261 Ga0501038_0264692 3300049574 Bacteria 1357
262 Ga0501038_0350194 3300049574 Bacteria 1150
263 Ga0501039_0073145 3300049575 Bacteria 2663
264 Ga0501039_0210151 3300049575 Bacteria 1530
265 Ga0501039_0305094 3300049575 Bacteria 1251
266 Ga0501039_0384814 3300049575 Bacteria 1102
267 Ga0501040_0021086 3300049576 Bacteria 4345
268 Ga0501041_0046866 3300049577 Bacteria 2630
269 Ga0501042_0005547 3300049578 Bacteria 8133
270 Ga0501043_0011627 3300049579 Bacteria 6890
271 Ga0501043_0021085 3300049579 Bacteria 5108
272 Ga0501043_0030352 3300049579 Bacteria 4248
273 Ga0501043_0078707 3300049579 Bacteria 2590
274 Ga0501043_0092678 3300049579 Bacteria 2375
275 Ga0501046_0011501 3300049580 Bacteria 7566
276 Ga0501046_0078040 3300049580 Bacteria 2562
277 Ga0501046_0146259 3300049580 Bacteria 1785
278 Ga0501047_0000280 3300049581 Bacteria 59132
279 Ga0501047_0004485 3300049581 Bacteria 13134
280 Ga0501047_0057323 3300049581 Bacteria 3767
281 Ga0501047_0073506 3300049581 Bacteria 3292
282 Ga0501047_0086646 3300049581 Bacteria 3009
283 Ga0501047_0323947 3300049581 Bacteria 1380
284 Ga0501047_0517749 3300049581 Bacteria 1019
285 Ga0501048_0188751 3300049582 Bacteria 1460
286 Ga0501067_0009683 3300049583 Bacteria 5334
287 Ga0501068_0041118 3300049584 Bacteria 2777
288 Ga0501070_0021553 3300049586 Bacteria 5406
289 Ga0501070_0248563 3300049586 Bacteria 1455
290 Ga0501070_0427654 3300049586 Bacteria 1069
291 Ga0501070_0480464 3300049586 Bacteria 999
292 Ga0501071_0101014 3300049587 Bacteria 2126
293 Ga0501072_0007522 3300049588 Bacteria 8267
294 Ga0501073_0090718 3300049589 Bacteria 2123
295 Ga0501074_0069171 3300049590 Bacteria 2538
296 Ga0501074_0319901 3300049590 Bacteria 1102
297 Ga0501074_0556374 3300049590 Bacteria 812
298 Ga0501235_034505 3300049669 Bacteria 1148
299 Ga0501079_0022379 3300049741 Bacteria 4846
300 Ga0501080_0030924 3300049742 Bacteria 4989
301 Ga0501083_0001976 3300049744 Bacteria 14100
302 Ga0501035_0000431 3300049822 Bacteria 47303
303 Ga0501035_0009396 3300049822 Bacteria 9090
304 Ga0501035_0027632 3300049822 Bacteria 5185
305 Ga0501035_0053318 3300049822 Bacteria 3617
306 Ga0501035_0061314 3300049822 Bacteria 3347
307 Ga0501035_0131694 3300049822 Bacteria 2179
308 Ga0501035_0164488 3300049822 Bacteria 1919
309 Ga0501035_0205715 3300049822 Bacteria 1686
310 Ga0501035_0553653 3300049822 Bacteria 942
311 Ga0501044_0001532 3300049823 Bacteria 27104
312 Ga0501044_0002066 3300049823 Bacteria 23143
313 Ga0501044_0005235 3300049823 Bacteria 14427
314 Ga0501044_0009554 3300049823 Bacteria 10559
315 Ga0501044_0036307 3300049823 Bacteria 5156
316 Ga0501044_0147556 3300049823 Bacteria 2336
317 Ga0501044_0192150 3300049823 Bacteria 2003
318 Ga0501045_0024306 3300049824 Bacteria 4349
319 Ga0501045_0150665 3300049824 Bacteria 1730
320 Ga0501045_0474805 3300049824 Bacteria 929
321 Ga0501045_0480144 3300049824 Bacteria 923
322 Ga0501045_0517853 3300049824 Bacteria 885
323 nmdc:mga03n38_1517_c1 3300050490 Bacteria 6708
324 nmdc:mga06z11_215_c1 3300050494 Bacteria 23038
325 nmdc:mga04h51_4097_c1 3300050495 Bacteria 3594
326 nmdc:mga07m45_9083_c2 3300050496 Bacteria 2683
327 Ga0495601_0014570 3300053077 Bacteria 4739
328 Ga0495612_0229792 3300053078 Bacteria 823
329 Ga0495619_0002666 3300053085 Bacteria 11674
330 Ga0500640_000117 3300053095 Bacteria 14619
331 Ga0500553_158947 3300053101 Bacteria 854
332 Ga0500573_0003616 3300053140 Bacteria 8024
333 Ga0500573_0008831 3300053140 Bacteria 5564
334 Ga0500573_0207739 3300053140 Bacteria 1035
335 Ga0500634_0067005 3300053161 Bacteria 1889
336 Ga0501084_0005338 3300054114 Bacteria 10522
337 Ga0501084_0319228 3300054114 Bacteria 1312
338 Ga0466962_0007444 3300061719 Bacteria 5254
339 Ga0466962_0011196 3300061719 Bacteria 4319
340 Ga0466962_0019690 3300061719 Bacteria 3243
341 Ga0466962_0057730 3300061719 Bacteria 1853
342 2554257507 2554235005 Bacteria 6457341
343 2585305752 2582581313 Bacteria 10042643
344 2585314571 2582581314 Bacteria 11452267
345 2616700374 2616644814 Bacteria 11555299
346 2616702130 2616644814 Bacteria 11555299
347 2643763158 2643221548 Bacteria 8053412
348 2643900171 2643221578 Bacteria 9213798
349 2643947925 2643221587 Bacteria 7586415
350 2644390637 2643221670 Bacteria 6497041
351 2644405605 2643221673 Bacteria 9196637
352 2644433791 2643221677 Bacteria 7584031
353 2644443067 2643221678 Bacteria 9540101
354 2644463972 2643221682 Bacteria 6743283
355 2644627122 2643221714 Bacteria 9015452
356 2768642431 2767802112 Bacteria 6465194
357 2784589044 2784132148 Bacteria 8627943
358 2785342804 2784746763 Bacteria 9783172
359 2786671070 2786546132 Bacteria 10419719
360 2793975391 2791355406 Bacteria 11364898
361 2808842494 2808606359 Bacteria 9866990
362 2808921000 2808606375 Bacteria 9466072
363 2809232647 2808606448 Bacteria 8656184
364 2811845730 2808606982 Bacteria 7791042
365 2812357605 2811994879 Bacteria 9313447
366 2812480127 2811994917 Bacteria 7761064
367 2819697326 2818991463 Bacteria 7948711
368 2852637316 2852635781 Bacteria 8251373
369 2862178927 2862178590 Bacteria 8583590
370 2862286099 2862281513 Bacteria 9621493
371 2862295648 2862290372 Bacteria 7471434
372 2862384208 2862382967 Bacteria 10317375
373 2862508154 2862507626 Bacteria 9425308
374 2862578816 2862574272 Bacteria 10567477
375 2862709121 2862705112 Bacteria 6563286
376 2863412693 2863404153 Bacteria 9672205
377 2867347516 2867346516 Bacteria 7608576
378 2867372452 2867369537 Bacteria 6501581
379 2867436411 2867428634 Bacteria 9590268
380 2867480450 2867475112 Bacteria 6909112
381 2873155305 2873151551 Bacteria 8625867
382 2875395159 2875391855 Bacteria 7600475
383 2877680626 2877676314 Bacteria 9512378
384 2912719342 2912715099 Bacteria 9460473
385 2918505131 2918501144 Bacteria 8668083
386 2919471842 2919468124 Bacteria 9133025
387 2935390783 2935390628 Bacteria 7043367
388 2946049462 2946045630 Bacteria 8527308
389 2946068249 2946064051 Bacteria 8957905
390 2946076384 2946072368 Bacteria 8999607
391 2947228674 2947224130 Bacteria 9938529
392 2954006852 2954002825 Bacteria 9173742
393 2954385755 2954380949 Bacteria 10050426
394 2954677399 2954673503 Bacteria 9685905
395 2954686754 2954682443 Bacteria 9862841
396 2954696401 2954691527 Bacteria 10720516
397 2954705875 2954701450 Bacteria 10834262
398 2954715758 2954711539 Bacteria 10867210
399 2954725696 2954721474 Bacteria 10456478
400 2954736104 2954731030 Bacteria 10243860
401 2954744650 2954740390 Bacteria 10229294
402 2954754964 2954749733 Bacteria 10366972
403 2954763617 2954759201 Bacteria 9358192
404 2966602124 2966598605 Bacteria 7676064
405 2990049915 2990044586 Bacteria 6603797
406 2990061606 2990059506 Bacteria 9321252
407 2990089286 2990088156 Bacteria 6657676
408 2995468756 2995463766 Bacteria 8577691
409 2997459015 2997451912 Bacteria 8492419
410 2997604652 2997600082 Bacteria 9896405
411 3006325748 3006321560 Bacteria 8247479
412 3006396198 3006393351 Bacteria 6615579
413 3006425763 3006425503 Bacteria 6491253
414 3006488493 3006486233 Bacteria 8157040
415 3006499425 3006493962 Bacteria 8825450
416 8008486008 8008485437 Bacteria 7198341
417 8023630534 8023623736 Bacteria 8593882
418 8025419910 8025413630 Bacteria 7014048
419 8025525324 8025524527 Bacteria 7197316
420 8033691038 8033684223 Bacteria 6906479
421 8047897566 8047893842 Bacteria 11723082
422 8048127847 8048127548 Bacteria 11053136
423 8048361304 8048356638 Bacteria 11044339
424 8048374553 8048369669 Bacteria 11666822
425 8048383669 8048379754 Bacteria 11877923
426 8048410246 8048406513 Bacteria 8936924
427 8054167462 8054160619 Bacteria 7783213
428 8056452946 8056447290 Bacteria 7680491
429 8056671961 8056667051 Bacteria 6953971
430 8056838024 8056829672 Bacteria 9045328
431 Ga0307514_10165117
432 JGI24739J22299_10011962
433 JGI24735J21928_10014423
434 JGI24738J21930_10002970
435 rootH2_10016700
436 rootL2_10009330
437 rootH1_10065453
438 JGI25160J50197_1020810
439 Ga0006562J51391_1092124
440 Ga0006562J51391_1092125
441 Ga0070683_100779383
442 Ga0068855_100467300
443 Ga0068854_100310420
444 Ga0075368_10007171
445 Ga0075367_10000116
446 Ga0105245_10068110
447 Ga0105243_10011156
448 Ga0105246_10000742
449 Ga0157372_10141966
450 Ga0182008_10000554
451 Ga0182007_10000530
452 Ga0182005_1020463
453 Ga0183367_1008
454 Ga0207426_1009234
455 Ga0207426_1009352
456 Ga0207426_1012536
457 Ga0207647_10004338
458 Ga0207709_10021047
459 Ga0207661_10690938
460 Ga0209813_10005558
461 Ga0307517_10084485
462 Ga0307515_10001593
463 Ga0307515_10006297
464 Ga0307515_10501650
465 Ga0307511_10000329
466 Ga0307511_10028726
467 Ga0307512_10104456
468 Ga0307513_10012049
469 Ga0307513_10044779
470 Ga0307509_10008697
471 Ga0307509_10022867
472 Ga0307509_10042213
473 Ga0307509_10328334
474 Ga0307408_100490392
475 Ga0307508_10003887
476 Ga0307508_10032688
477 Ga0307508_10070796
478 Ga0307508_10218081
479 Ga0307514_10037318
480 Ga0307514_10038892
481 Ga0307514_10327774
482 Ga0307516_10001611
483 Ga0307516_10283195
484 Ga0307516_10401980
485 Ga0307518_10096674
486 Ga0307416_100137426
487 Ga0307507_10028969
488 Ga0307507_10086364
489 Ga0307510_10016158
490 Ga0307510_10069917
491 Ga0307510_10106570
492 Ga0307510_10120613
493 Ga0395899_0194493
494 Ga0395900_0815424
495 Ga0395898_0003489
496 Ga0395898_0004365
497 Ga0395898_0087144
498 Ga0395901_0315023
499 Ga0439436_0000298
500 Ga0439439_0025479
501 Ga0451853_0417726
502 Ga0451853_0698697
503 Ga0451853_1031664
504 Ga0439433_0000181
505 Ga0439433_0010342
506 Ga0439442_033376
507 Ga0439449_0004474
508 Ga0439449_0041117
509 Ga0439449_0041299
510 Ga0439449_0071394
511 Ga0439450_023872
512 Ga0439455_0001562
513 Ga0439457_001030
514 Ga0439457_007683
515 Ga0439462_0029847
516 Ga0439462_0058976
517 Ga0450894_000019
518 Ga0450898_002071
519 Ga0450903_000524
520 Ga0450903_003122
521 Ga0450906_000303
522 Ga0439458_0000948
523 Ga0450908_023817
524 Ga0466969_0004202
525 Ga0466972_0000996
526 Ga0466972_0009152
527 Ga0466972_0023377
528 Ga0466965_0000266
529 Ga0466965_0075022
530 Ga0466966_0009948
531 Ga0466966_0033552
532 Ga0466961_0086246
533 Ga0466961_0148489
534 Ga0466963_0000900
535 Ga0466963_0347402
536 Ga0466964_0019539
537 Ga0466971_0000101
538 Ga0466971_0001965
539 Ga0466971_0017784
540 Ga0466971_0023059
541 Ga0466970_0011678
542 Ga0466970_0046098
543 Ga0466957_0000458
544 Ga0466959_0003745
545 Ga0466959_0026017
546 Ga0466959_0042187
547 Ga0466958_0228406
548 Ga0466967_0002379
549 Ga0466967_0946914
550 Ga0495592_0006233
551 Ga0495592_0039036
552 Ga0495603_0021289
553 Ga0495603_0222637
554 Ga0495629_0004038
555 Ga0495629_0005048
556 Ga0495629_0142416
557 Ga0495629_0234675
558 Ga0495638_0242538
559 Ga0495651_0002987
560 Ga0495651_0009883
561 Ga0495651_0076785
562 Ga0495653_0017140
563 Ga0495582_0106441
564 Ga0495662_0000224
565 Ga0495662_0004609
566 Ga0495664_0003655
567 Ga0495664_0029937
568 Ga0495664_0375878
569 Ga0495585_0002986
570 Ga0495594_0030622
571 Ga0495594_0243261
572 Ga0495608_0000571
573 Ga0495618_0007595
574 Ga0495618_0248579
575 Ga0495628_0009883
576 Ga0495628_0017954
577 Ga0495630_0009141
578 Ga0495630_0080954
579 Ga0495666_0013578
580 Ga0495652_0049895
581 Ga0495652_0076953
582 Ga0495665_0005012
583 Ga0495640_0015712
584 Ga0495640_0028639
585 Ga0495640_0096460
586 Ga0495586_0016478
587 Ga0495587_0000559
588 Ga0495587_0003235
589 Ga0495645_0011674
590 Ga0495645_0016667
591 Ga0495622_0025371
592 Ga0495622_0037346
593 Ga0495667_0053212
594 Ga0495634_0002713
595 Ga0495634_0083896
596 Ga0495634_0129266
597 Ga0495611_0037742
598 Ga0495611_0053717
599 Ga0495625_0002746
600 Ga0495625_0010866
601 Ga0495635_0000585
602 Ga0495588_0002000
603 Ga0495588_0004748
604 Ga0495657_0003065
605 Ga0495657_0004290
606 Ga0495623_0017220
607 Ga0495646_0003260
608 Ga0495646_0070238
609 Ga0495658_0024844
610 Ga0495613_0004429
611 Ga0495613_0007850
612 Ga0495624_0071850
613 Ga0495624_0177839
614 Ga0495670_0033073
615 Ga0495649_0007230
616 Ga0495589_0019492
617 Ga0495589_0021235
618 Ga0495589_0023476
619 Ga0495589_0049433
620 Ga0495600_0006083
621 Ga0495600_0015422
622 Ga0495581_0006072
623 Ga0495581_0009276
624 Ga0495604_0000418
625 Ga0495604_0000570
626 Ga0495604_0008468
627 Ga0495636_0001703
628 Ga0495636_0001775
629 Ga0495636_0003764
630 Ga0495636_0018091
631 Ga0495674_0130426
632 Ga0495676_0001783
633 Ga0495676_0054835
634 Ga0495683_0038718
635 Ga0495687_002448
636 Ga0495687_007662
637 Ga0495675_0055080
638 Ga0495675_0203498
639 Ga0495685_001237
640 Ga0495685_002332
641 Ga0495685_016741
642 Ga0495685_075366
643 Ga0495681_0000384
644 Ga0495684_0016526
645 Ga0495684_0042429
646 Ga0495686_0049764
647 Ga0495593_0000135
648 Ga0495602_0055416
649 Ga0495602_0067132
650 Ga0495614_0002603
651 Ga0495614_0013051
652 Ga0495614_0035047
653 Ga0496109_0281289
654 Ga0496113_0367283
655 Ga0496123_0248635
656 Ga0501031_0000765
657 Ga0501031_0002289
658 Ga0501031_0126400
659 Ga0501031_0189702
660 Ga0501032_0000748
661 Ga0501032_0004943
662 Ga0501032_0012466
663 Ga0501032_0023470
664 Ga0501032_0158196
665 Ga0501032_0193084
666 Ga0501033_0015875
667 Ga0501033_0020173
668 Ga0501033_0041690
669 Ga0501033_0042371
670 Ga0501033_0066214
671 Ga0501033_0075922
672 Ga0501033_0192695
673 Ga0501034_0017472
674 Ga0501034_0040723
675 Ga0501034_0063490
676 Ga0501034_0107293
677 Ga0501034_0312552
678 Ga0501034_0528978
679 Ga0501036_0066162
680 Ga0501036_0268880
681 Ga0501036_0290682
682 Ga0501036_0385247
683 Ga0501037_0003770
684 Ga0501037_0033575
685 Ga0501037_0035393
686 Ga0501037_0355849
687 Ga0501037_0387241
688 Ga0501038_0004119
689 Ga0501038_0005857
690 Ga0501038_0016004
691 Ga0501038_0264692
692 Ga0501038_0350194
693 Ga0501039_0073145
694 Ga0501039_0210151
695 Ga0501039_0305094
696 Ga0501039_0384814
697 Ga0501040_0021086
698 Ga0501041_0046866
699 Ga0501042_0005547
700 Ga0501043_0011627
701 Ga0501043_0021085
702 Ga0501043_0030352
703 Ga0501043_0078707
704 Ga0501043_0092678
705 Ga0501046_0011501
706 Ga0501046_0078040
707 Ga0501046_0146259
708 Ga0501047_0000280
709 Ga0501047_0004485
710 Ga0501047_0057323
711 Ga0501047_0073506
712 Ga0501047_0086646
713 Ga0501047_0323947
714 Ga0501047_0517749
715 Ga0501048_0188751
716 Ga0501067_0009683
717 Ga0501068_0041118
718 Ga0501070_0021553
719 Ga0501070_0248563
720 Ga0501070_0427654
721 Ga0501070_0480464
722 Ga0501071_0101014
723 Ga0501072_0007522
724 Ga0501073_0090718
725 Ga0501074_0069171
726 Ga0501074_0319901
727 Ga0501074_0556374
728 Ga0501235_034505
729 Ga0501079_0022379
730 Ga0501080_0030924
731 Ga0501083_0001976
732 Ga0501035_0000431
733 Ga0501035_0009396
734 Ga0501035_0027632
735 Ga0501035_0053318
736 Ga0501035_0061314
737 Ga0501035_0131694
738 Ga0501035_0164488
739 Ga0501035_0205715
740 Ga0501035_0553653
741 Ga0501044_0001532
742 Ga0501044_0002066
743 Ga0501044_0005235
744 Ga0501044_0009554
745 Ga0501044_0036307
746 Ga0501044_0147556
747 Ga0501044_0192150
748 Ga0501045_0024306
749 Ga0501045_0150665
750 Ga0501045_0474805
751 Ga0501045_0480144
752 Ga0501045_0517853
753 nmdc:mga03n38_1517_c1
754 nmdc:mga06z11_215_c1
755 nmdc:mga04h51_4097_c1
756 nmdc:mga07m45_9083_c2
757 Ga0495601_0014570
758 Ga0495612_0229792
759 Ga0495619_0002666
760 Ga0500640_000117
761 Ga0500553_158947
762 Ga0500573_0003616
763 Ga0500573_0008831
764 Ga0500573_0207739
765 Ga0500634_0067005
766 Ga0501084_0005338
767 Ga0501084_0319228
768 Ga0466962_0007444
769 Ga0466962_0011196
770 Ga0466962_0019690
771 Ga0466962_0057730
772 2554257507
773 2585305752
774 2585314571
775 2616700374
776 2616702130
777 2643763158
778 2643900171
779 2643947925
780 2644390637
781 2644405605
782 2644433791
783 2644443067
784 2644463972
785 2644627122
786 2768642431
787 2784589044
788 2785342804
789 2786671070
790 2793975391
791 2808842494
792 2808921000
793 2809232647
794 2811845730
795 2812357605
796 2812480127
797 2819697326
798 2852637316
799 2862178927
800 2862286099
801 2862295648
802 2862384208
803 2862508154
804 2862578816
805 2862709121
806 2863412693
807 2867347516
808 2867372452
809 2867436411
810 2867480450
811 2873155305
812 2875395159
813 2877680626
814 2912719342
815 2918505131
816 2919471842
817 2935390783
818 2946049462
819 2946068249
820 2946076384
821 2947228674
822 2954006852
823 2954385755
824 2954677399
825 2954686754
826 2954696401
827 2954705875
828 2954715758
829 2954725696
830 2954736104
831 2954744650
832 2954754964
833 2954763617
834 2966602124
835 2990049915
836 2990061606
837 2990089286
838 2995468756
839 2997459015
840 2997604652
841 3006325748
842 3006396198
843 3006425763
844 3006488493
845 3006499425
846 8008486008
847 8023630534
848 8025419910
849 8025525324
850 8033691038
851 8047897566
852 8048127847
853 8048361304
854 8048374553
855 8048383669
856 8048410246
857 8054167462
858 8056452946
859 8056671961
860 8056838024

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

175

222

0.98

PF04542

Sigma70_r2

Sigma-70 region 2

70

138

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

169

222

0.97

PF07638

Sigma70_ECF

ECF sigma factor

50

225

0.77

Map