F442147

General Info

Members Datasets Scaffolds Average Seq Length
430 222 860 108

Family's Representative Sequence

Representative Sequence 3300021358|Ga0213873_10085951|Ga0213873_100859512
Length 127
Sequence MICLIWNDLTWNRKFQLNLNMDRRIRVLVAKPGLDGHDRGAKVIARALRVQVIGLSILSGAHNAIVPRVMELLKQKHMDDVLVLVGGIVPDEDAEQLKRLGVAAVFQPGASLEGIVDFIRRSAPQAA

Samples

Sample ID Description Type Environment
1 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
97 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
100 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
101 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
154 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
155 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
156 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
157 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
158 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
159 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
162 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
163 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
207 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
216 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 1.16
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.4
Rhizosphere 91.86
Stem 0
Stem Tuber 0
Unclassified 4.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213873_10085951 3300021358 Bacteria 887
2 Ga0058862_12324567 3300004803 Bacteria 708
3 Ga0070658_10012765 3300005327 Bacteria 6740
4 Ga0070690_100174090 3300005330 Bacteria 1483
5 Ga0070690_100276223 3300005330 Bacteria 1197
6 Ga0068869_100659491 3300005334 Bacteria 889
7 Ga0070666_10018949 3300005335 Bacteria 4434
8 Ga0070666_10870010 3300005335 Bacteria 665
9 Ga0070680_100056615 3300005336 Bacteria 3204
10 Ga0070680_100431998 3300005336 Bacteria 1124
11 Ga0070680_100900549 3300005336 Bacteria 763
12 Ga0070682_100654515 3300005337 Bacteria 837
13 Ga0068868_100022418 3300005338 Bacteria 4765
14 Ga0070660_100009240 3300005339 Bacteria 6926
15 Ga0070689_100234200 3300005340 Bacteria 1510
16 Ga0070689_100800274 3300005340 Bacteria 829
17 Ga0070689_101267785 3300005340 Bacteria 663
18 Ga0070691_10185244 3300005341 Bacteria 1085
19 Ga0070661_100118404 3300005344 Bacteria 1982
20 Ga0070675_100866739 3300005354 Bacteria 827
21 Ga0070671_100298113 3300005355 Bacteria 1372
22 Ga0070673_100327361 3300005364 Bacteria 1355
23 Ga0070673_100384285 3300005364 Bacteria 1252
24 Ga0070673_101488493 3300005364 Bacteria 638
25 Ga0070673_101932096 3300005364 Bacteria 560
26 Ga0070688_100888138 3300005365 Bacteria 702
27 Ga0070709_10060324 3300005434 Bacteria 2411
28 Ga0070709_10154617 3300005434 Bacteria 1589
29 Ga0070709_10160050 3300005434 Bacteria 1564
30 Ga0070709_10608954 3300005434 Bacteria 842
31 Ga0070709_10615039 3300005434 Bacteria 838
32 Ga0070714_100001298 3300005435 Bacteria 18076
33 Ga0070714_100667040 3300005435 Bacteria 1002
34 Ga0070713_100106791 3300005436 Bacteria 2434
35 Ga0070713_100460083 3300005436 Bacteria 1196
36 Ga0070713_100781093 3300005436 Bacteria 915
37 Ga0070713_102029525 3300005436 Bacteria 558
38 Ga0070701_10722707 3300005438 Bacteria 672
39 Ga0070711_100248467 3300005439 Bacteria 1394
40 Ga0070700_100404538 3300005441 Bacteria 1027
41 Ga0070694_100457666 3300005444 Bacteria 1008
42 Ga0070694_100977786 3300005444 Bacteria 702
43 Ga0070708_100009495 3300005445 Bacteria 7840
44 Ga0070708_100165623 3300005445 Bacteria 2062
45 Ga0070678_100548914 3300005456 Bacteria 1026
46 Ga0070662_100970959 3300005457 Bacteria 727
47 Ga0070681_10004213 3300005458 Bacteria 13627
48 Ga0070681_10053091 3300005458 Bacteria 4039
49 Ga0070681_10181058 3300005458 Bacteria 2029
50 Ga0070681_10610079 3300005458 Bacteria 1006
51 Ga0068867_101298538 3300005459 Bacteria 672
52 Ga0070707_100464543 3300005468 Unclassified 1226
53 Ga0070707_100846613 3300005468 Bacteria 879
54 Ga0070698_100509080 3300005471 Bacteria 1142
55 Ga0070699_100089823 3300005518 Bacteria 2685
56 Ga0070699_100663943 3300005518 Bacteria 952
57 Ga0070679_100167496 3300005530 Bacteria 2170
58 Ga0070679_100173944 3300005530 Bacteria 2126
59 Ga0070679_100187359 3300005530 Bacteria 2039
60 Ga0070684_100515845 3300005535 Bacteria 1108
61 Ga0070684_101410518 3300005535 Bacteria 656
62 Ga0070697_100063919 3300005536 Bacteria 3006
63 Ga0070697_100873809 3300005536 Bacteria 797
64 Ga0070697_101233478 3300005536 Bacteria 667
65 Ga0070672_101180334 3300005543 Bacteria 682
66 Ga0070686_100128701 3300005544 Bacteria 1748
67 Ga0070686_101456981 3300005544 Bacteria 576
68 Ga0070695_100024101 3300005545 Bacteria 3746
69 Ga0070695_100634610 3300005545 Bacteria 842
70 Ga0070696_101659371 3300005546 Bacteria 550
71 Ga0070693_100824019 3300005547 Bacteria 690
72 Ga0070665_100074411 3300005548 Bacteria 3403
73 Ga0070665_100332710 3300005548 Bacteria 1523
74 Ga0070665_100676527 3300005548 Bacteria 1045
75 Ga0070665_101199564 3300005548 Bacteria 770
76 Ga0068855_100013447 3300005563 Bacteria 9867
77 Ga0068855_100317910 3300005563 Bacteria 1721
78 Ga0068855_100975065 3300005563 Bacteria 892
79 Ga0070664_100223986 3300005564 Bacteria 1683
80 Ga0068857_100005615 3300005577 Bacteria 10721
81 Ga0068857_100747443 3300005577 Bacteria 931
82 Ga0068856_100038154 3300005614 Bacteria 4715
83 Ga0070702_100398091 3300005615 Bacteria 984
84 Ga0068852_100299753 3300005616 Bacteria 1555
85 Ga0068859_100069572 3300005617 Bacteria 3555
86 Ga0068859_100330406 3300005617 Bacteria 1619
87 Ga0068859_100844856 3300005617 Bacteria 1002
88 Ga0068864_101093774 3300005618 Bacteria 793
89 Ga0068866_10182181 3300005718 Bacteria 1242
90 Ga0068866_10548139 3300005718 Bacteria 773
91 Ga0068870_10422745 3300005840 Bacteria 872
92 Ga0068870_10464133 3300005840 Bacteria 837
93 Ga0068863_100340673 3300005841 Bacteria 1458
94 Ga0068863_100637198 3300005841 Bacteria 1056
95 Ga0068863_101558362 3300005841 Bacteria 670
96 Ga0068858_100000554 3300005842 Bacteria 38982
97 Ga0068858_100025290 3300005842 Bacteria 5525
98 Ga0068858_100172648 3300005842 Unclassified 2039
99 Ga0068858_100509808 3300005842 Bacteria 1163
100 Ga0068858_100641053 3300005842 Bacteria 1032
101 Ga0068858_100962976 3300005842 Bacteria 836
102 Ga0068858_102167309 3300005842 Bacteria 549
103 Ga0068860_100077638 3300005843 Bacteria 3158
104 Ga0068862_102399516 3300005844 Bacteria 539
105 Ga0070717_10483448 3300006028 Bacteria 1118
106 Ga0070717_10590121 3300006028 Bacteria 1008
107 Ga0070717_10940116 3300006028 Bacteria 787
108 Ga0070717_11531528 3300006028 Unclassified 605
109 Ga0070715_10387422 3300006163 Bacteria 773
110 Ga0070716_100447219 3300006173 Bacteria 941
111 Ga0070712_100739998 3300006175 Bacteria 841
112 Ga0097621_100321156 3300006237 Bacteria 1371
113 Ga0068871_100021494 3300006358 Bacteria 4960
114 Ga0068871_100045697 3300006358 Bacteria 3525
115 Ga0068871_100198858 3300006358 Unclassified 1729
116 Ga0068871_100514080 3300006358 Bacteria 1081
117 Ga0068871_100799441 3300006358 Bacteria 869
118 Ga0075430_100216163 3300006846 Bacteria 1591
119 Ga0075431_100003460 3300006847 Bacteria 15301
120 Ga0075431_100248097 3300006847 Bacteria 1809
121 Ga0075434_101855609 3300006871 Bacteria 609
122 Ga0075429_100000636 3300006880 Bacteria 27115
123 Ga0068865_100649365 3300006881 Bacteria 896
124 Ga0075436_100005318 3300006914 Bacteria 8851
125 Ga0075436_100613492 3300006914 Unclassified 802
126 Ga0097620_100069573 3300006931 Bacteria 3555
127 Ga0097620_100330396 3300006931 Bacteria 1619
128 Ga0097620_100844965 3300006931 Bacteria 1002
129 Ga0099795_10056702 3300007788 Bacteria 1442
130 Ga0099795_10460960 3300007788 Bacteria 587
131 Ga0105251_10166200 3300009011 Bacteria 994
132 Ga0105240_10130212 3300009093 Bacteria 3019
133 Ga0105240_10211726 3300009093 Bacteria 2264
134 Ga0111539_10140075 3300009094 Bacteria 2832
135 Ga0111539_11730491 3300009094 Bacteria 725
136 Ga0105245_10065826 3300009098 Bacteria 3278
137 Ga0105245_11317925 3300009098 Bacteria 771
138 Ga0114129_10002496 3300009147 Bacteria 25530
139 Ga0114129_10600819 3300009147 Bacteria 1425
140 Ga0105243_10053364 3300009148 Bacteria 3206
141 Ga0105243_11416120 3300009148 Bacteria 716
142 Ga0105241_10160884 3300009174 Bacteria 1845
143 Ga0105242_10192787 3300009176 Bacteria 1805
144 Ga0105248_10066157 3300009177 Bacteria 4058
145 Ga0105248_11482724 3300009177 Bacteria 768
146 Ga0105248_11777486 3300009177 Bacteria 699
147 Ga0105248_11791012 3300009177 Bacteria 696
148 Ga0105248_12945090 3300009177 Bacteria 542
149 Ga0105237_10403510 3300009545 Bacteria 1371
150 Ga0105238_10085306 3300009551 Bacteria 3146
151 Ga0105238_10111011 3300009551 Bacteria 2722
152 Ga0105238_10924981 3300009551 Bacteria 891
153 Ga0105246_10591241 3300011119 Bacteria 957
154 Ga0157373_10551188 3300013100 Bacteria 836
155 Ga0157370_10026689 3300013104 Bacteria 5699
156 Ga0157370_10322237 3300013104 Bacteria 1425
157 Ga0157369_10056950 3300013105 Bacteria 4218
158 Ga0157369_10760040 3300013105 Bacteria 997
159 Ga0157374_10589416 3300013296 Bacteria 1121
160 Ga0157374_11297651 3300013296 Unclassified 750
161 Ga0157378_10038078 3300013297 Bacteria 4261
162 Ga0157378_10238557 3300013297 Bacteria 1736
163 Ga0157378_10759781 3300013297 Bacteria 993
164 Ga0163162_10001009 3300013306 Bacteria 26176
165 Ga0163162_10135001 3300013306 Bacteria 2578
166 Ga0163162_10651148 3300013306 Bacteria 1177
167 Ga0163162_10706276 3300013306 Bacteria 1130
168 Ga0163162_11258023 3300013306 Bacteria 840
169 Ga0163162_12998425 3300013306 Bacteria 543
170 Ga0157372_10080848 3300013307 Bacteria 3678
171 Ga0157372_10088175 3300013307 Bacteria 3522
172 Ga0157372_10476612 3300013307 Bacteria 1455
173 Ga0157375_10087435 3300013308 Bacteria 3169
174 Ga0157375_10707988 3300013308 Bacteria 1160
175 Ga0157375_10811884 3300013308 Bacteria 1084
176 Ga0157375_11348227 3300013308 Bacteria 840
177 Ga0163163_10335974 3300014325 Unclassified 1566
178 Ga0163163_10586895 3300014325 Bacteria 1177
179 Ga0163163_12048734 3300014325 Bacteria 632
180 Ga0157380_11447541 3300014326 Bacteria 739
181 Ga0157379_10074617 3300014968 Bacteria 3036
182 Ga0157376_12147556 3300014969 Bacteria 597
183 Ga0206356_11215551 3300020070 Bacteria 543
184 Ga0154015_1250796 3300020610 Bacteria 560
185 Ga0213872_10410938 3300021361 Bacteria 548
186 Ga0213874_10026421 3300021377 Bacteria 1645
187 Ga0213876_10018990 3300021384 Bacteria 3631
188 Ga0213876_10281515 3300021384 Bacteria 884
189 Ga0213876_10377563 3300021384 Bacteria 754
190 Ga0213875_10000297 3300021388 Bacteria 47996
191 Ga0213875_10068097 3300021388 Bacteria 1663
192 Ga0213875_10146007 3300021388 Bacteria 1108
193 Ga0213871_10024079 3300021441 Bacteria 1538
194 Ga0224712_10557227 3300022467 Bacteria 557
195 Ga0207710_10054813 3300025900 Bacteria 1796
196 Ga0207680_10089448 3300025903 Unclassified 1955
197 Ga0207680_10824896 3300025903 Bacteria 665
198 Ga0207699_10155866 3300025906 Bacteria 1516
199 Ga0207699_10396583 3300025906 Bacteria 982
200 Ga0207699_10617347 3300025906 Bacteria 790
201 Ga0207645_10825971 3300025907 Bacteria 630
202 Ga0207705_10533557 3300025909 Bacteria 912
203 Ga0207654_10009425 3300025911 Bacteria 4959
204 Ga0207654_10102051 3300025911 Bacteria 1769
205 Ga0207707_10007684 3300025912 Bacteria 9390
206 Ga0207707_10140684 3300025912 Bacteria 2110
207 Ga0207695_10007960 3300025913 Bacteria 13368
208 Ga0207695_10012992 3300025913 Bacteria 9948
209 Ga0207695_10017084 3300025913 Bacteria 8459
210 Ga0207695_10474343 3300025913 Bacteria 1134
211 Ga0207671_10009614 3300025914 Bacteria 8060
212 Ga0207671_11141733 3300025914 Bacteria 611
213 Ga0207671_11400696 3300025914 Bacteria 542
214 Ga0207693_10575645 3300025915 Bacteria 877
215 Ga0207663_10308560 3300025916 Bacteria 1185
216 Ga0207663_11337359 3300025916 Bacteria 577
217 Ga0207660_10098057 3300025917 Bacteria 2185
218 Ga0207660_10294427 3300025917 Bacteria 1291
219 Ga0207660_10385091 3300025917 Bacteria 1128
220 Ga0207657_10014849 3300025919 Bacteria 7581
221 Ga0207649_10090549 3300025920 Bacteria 2002
222 Ga0207652_10155114 3300025921 Bacteria 2051
223 Ga0207652_10192788 3300025921 Bacteria 1833
224 Ga0207652_10415467 3300025921 Bacteria 1213
225 Ga0207646_10285428 3300025922 Bacteria 1492
226 Ga0207694_10003393 3300025924 Bacteria 12687
227 Ga0207694_10344212 3300025924 Bacteria 1233
228 Ga0207694_10505152 3300025924 Bacteria 1013
229 Ga0207659_10901948 3300025926 Bacteria 760
230 Ga0207687_10009865 3300025927 Bacteria 6251
231 Ga0207700_10118196 3300025928 Bacteria 2145
232 Ga0207664_10331836 3300025929 Bacteria 1344
233 Ga0207664_11122896 3300025929 Bacteria 702
234 Ga0207644_10265236 3300025931 Bacteria 1374
235 Ga0207644_10784396 3300025931 Bacteria 797
236 Ga0207690_10777554 3300025932 Bacteria 790
237 Ga0207706_10949297 3300025933 Bacteria 724
238 Ga0207686_10048042 3300025934 Unclassified 2641
239 Ga0207709_10119128 3300025935 Bacteria 1779
240 Ga0207670_11191079 3300025936 Bacteria 645
241 Ga0207704_10357474 3300025938 Bacteria 1139
242 Ga0207704_10651414 3300025938 Bacteria 867
243 Ga0207665_10088892 3300025939 Bacteria 2138
244 Ga0207711_10130968 3300025941 Bacteria 2249
245 Ga0207711_10158203 3300025941 Bacteria 2049
246 Ga0207711_10927470 3300025941 Bacteria 809
247 Ga0207711_11357250 3300025941 Bacteria 653
248 Ga0207711_11390593 3300025941 Bacteria 644
249 Ga0207689_10685066 3300025942 Bacteria 864
250 Ga0207689_11656594 3300025942 Unclassified 531
251 Ga0207661_10447332 3300025944 Bacteria 1176
252 Ga0207679_10161433 3300025945 Bacteria 1835
253 Ga0207679_10445489 3300025945 Bacteria 1147
254 Ga0207667_10013129 3300025949 Bacteria 9503
255 Ga0207667_10015448 3300025949 Bacteria 8671
256 Ga0207667_10883408 3300025949 Bacteria 886
257 Ga0207651_10415673 3300025960 Bacteria 1147
258 Ga0207712_10501253 3300025961 Bacteria 1038
259 Ga0207658_10560523 3300025986 Bacteria 1023
260 Ga0207677_10146467 3300026023 Bacteria 1815
261 Ga0207703_10003577 3300026035 Bacteria 12988
262 Ga0207703_10067925 3300026035 Unclassified 2935
263 Ga0207703_10633194 3300026035 Bacteria 1013
264 Ga0207703_10753930 3300026035 Bacteria 928
265 Ga0207703_10874553 3300026035 Unclassified 860
266 Ga0207708_10234730 3300026075 Bacteria 1473
267 Ga0207702_10015133 3300026078 Bacteria 6396
268 Ga0207702_10017832 3300026078 Bacteria 5877
269 Ga0207641_10004105 3300026088 Bacteria 12689
270 Ga0207641_10138111 3300026088 Bacteria 2196
271 Ga0207648_10162221 3300026089 Bacteria 1974
272 Ga0207648_11320720 3300026089 Bacteria 678
273 Ga0207676_10060103 3300026095 Bacteria 3004
274 Ga0207676_10906302 3300026095 Bacteria 865
275 Ga0207674_10001211 3300026116 Bacteria 33626
276 Ga0207674_10158297 3300026116 Bacteria 2220
277 Ga0207683_10325233 3300026121 Bacteria 1409
278 Ga0207683_10695881 3300026121 Bacteria 942
279 Ga0207683_11946472 3300026121 Bacteria 536
280 Ga0207698_10061048 3300026142 Bacteria 2935
281 Ga0268266_10591587 3300028379 Bacteria 1065
282 Ga0268266_10762707 3300028379 Bacteria 934
283 Ga0268266_10916036 3300028379 Bacteria 848
284 Ga0268265_11436489 3300028380 Bacteria 692
285 Ga0268264_10047292 3300028381 Bacteria 3577
286 Ga0268264_10221395 3300028381 Bacteria 1742
287 Ga0268264_10476325 3300028381 Bacteria 1214
288 Ga0265338_10001801 3300028800 Bacteria 33703
289 Ga0265338_10004036 3300028800 Bacteria 20147
290 Ga0265765_1006998 3300030879 Bacteria 1210
291 Ga0265330_10024748 3300031235 Bacteria 2722
292 Ga0265332_10010795 3300031238 Bacteria 4060
293 Ga0265320_10035874 3300031240 Bacteria 2510
294 Ga0265325_10023523 3300031241 Bacteria 3362
295 Ga0265329_10013174 3300031242 Bacteria 2954
296 Ga0265340_10012495 3300031247 Bacteria 4482
297 Ga0265339_10017123 3300031249 Bacteria 4298
298 Ga0265339_10044459 3300031249 Bacteria 2450
299 Ga0265339_10146938 3300031249 Bacteria 1195
300 Ga0265331_10006871 3300031250 Bacteria 6650
301 Ga0265316_10000847 3300031344 Bacteria 33692
302 Ga0265316_10017254 3300031344 Bacteria 6245
303 Ga0265316_10065937 3300031344 Bacteria 2803
304 Ga0265313_10282130 3300031595 Bacteria 671
305 Ga0265342_10014571 3300031712 Bacteria 5215
306 Ga0265342_10239566 3300031712 Bacteria 971
307 Ga0373926_0094119 3300035083 Bacteria 1116
308 Ga0373954_0391359 3300035118 Bacteria 687
309 Ga0373946_0098914 3300035171 Bacteria 1305
310 Ga0373955_0462976 3300035172 Bacteria 773
311 Ga0373955_0500761 3300035172 Bacteria 742
312 Ga0373961_0294274 3300035241 Bacteria 599
313 Ga0373924_0390026 3300035410 Bacteria 622
314 Ga0373931_0821142 3300035691 Bacteria 621
315 Ga0373935_0070479 3300035692 Bacteria 2254
316 Ga0373935_0081126 3300035692 Bacteria 2108
317 Ga0373935_1031259 3300035692 Bacteria 611
318 Ga0373927_0001128 3300035695 Bacteria 20226
319 Ga0373927_0004194 3300035695 Bacteria 10124
320 Ga0373927_0059247 3300035695 Bacteria 2477
321 Ga0373927_0087866 3300035695 Unclassified 2018
322 Ga0373927_0340094 3300035695 Bacteria 989
323 Ga0373927_0360516 3300035695 Bacteria 958
324 Ga0373927_0467201 3300035695 Bacteria 833
325 Ga0373927_0471812 3300035695 Bacteria 829
326 Ga0373933_1053938 3300035724 Bacteria 536
327 Ga0373947_0199350 3300035725 Bacteria 1309
328 Ga0373947_0245773 3300035725 Bacteria 1182
329 Ga0373937_0002413 3300036401 Bacteria 15536
330 Ga0373937_1212993 3300036401 Bacteria 703
331 Ga0373925_0069671 3300037068 Bacteria 2657
332 Ga0373925_0316657 3300037068 Bacteria 1262
333 Ga0373925_0435184 3300037068 Bacteria 1073
334 Ga0373925_0551391 3300037068 Bacteria 948
335 Ga0395898_1425290 3300037466 Bacteria 620
336 Ga0436364_0061600 3300037853 Bacteria 783
337 Ga0436364_0281764 3300037853 Bacteria 4076
338 Ga0436364_0485745 3300037853 Bacteria 835
339 Ga0436364_0507336 3300037853 Bacteria 1288
340 Ga0436364_0573140 3300037853 Bacteria 101258
341 Ga0436364_0934438 3300037853 Bacteria 3062
342 Ga0436364_0937796 3300037853 Bacteria 3349
343 Ga0436364_1102724 3300037853 Bacteria 7260
344 Ga0436364_1145409 3300037853 Bacteria 706
345 Ga0436364_1348183 3300037853 Bacteria 1645
346 Ga0436364_1377278 3300037853 Unclassified 559
347 Ga0436364_1407596 3300037853 Bacteria 5375
348 Ga0436365_1170125 3300039437 Bacteria 1668
349 Ga0436365_1408778 3300039437 Bacteria 1405
350 Ga0436365_1556991 3300039437 Bacteria 8412
351 Ga0436365_1597476 3300039437 Bacteria 596
352 Ga0436360_0371169 3300039438 Bacteria 665
353 Ga0436360_0807740 3300039438 Bacteria 2284
354 Ga0436360_1206165 3300039438 Unclassified 1282
355 Ga0436361_0056328 3300039447 Bacteria 946
356 Ga0436361_0396012 3300039447 Bacteria 994
357 Ga0436361_0419405 3300039447 Bacteria 103155
358 Ga0436361_1163522 3300039447 Bacteria 1044
359 Ga0436363_0288782 3300039450 Bacteria 1295
360 Ga0436363_0390178 3300039450 Bacteria 582
361 Ga0436363_0806817 3300039450 Bacteria 582
362 Ga0436363_0949361 3300039450 Bacteria 687
363 Ga0436363_1052103 3300039450 Bacteria 721
364 Ga0436363_1553307 3300039450 Bacteria 3078
365 Ga0436362_0109496 3300039453 Unclassified 705
366 Ga0436362_0185316 3300039453 Bacteria 845
367 Ga0436362_0644528 3300039453 Bacteria 660
368 Ga0436362_0723511 3300039453 Bacteria 820
369 Ga0436362_0885873 3300039453 Bacteria 1366
370 Ga0466963_0132287 3300044694 Bacteria 1724
371 Ga0466963_0628025 3300044694 Bacteria 758
372 Ga0466957_0872995 3300044842 Bacteria 642
373 Ga0451576_0065787 3300045051 Bacteria 3774
374 Ga0451576_0592310 3300045051 Bacteria 1165
375 Ga0451576_1076169 3300045051 Bacteria 842
376 Ga0451576_1213047 3300045051 Bacteria 788
377 Ga0466958_0360742 3300045836 Unclassified 936
378 Ga0466967_0661906 3300045976 Unclassified 1033
379 Ga0495629_0562453 3300046459 Bacteria 765
380 Ga0495580_0046897 3300046472 Bacteria 3064
381 Ga0495580_0054224 3300046472 Bacteria 2828
382 Ga0495580_0083616 3300046472 Bacteria 2224
383 Ga0495580_0124167 3300046472 Bacteria 1792
384 Ga0495580_0910458 3300046472 Bacteria 565
385 Ga0495582_0038290 3300046473 Bacteria 2639
386 Ga0495582_0257236 3300046473 Bacteria 1002
387 Ga0495582_0543602 3300046473 Bacteria 672
388 Ga0495594_0492076 3300046499 Bacteria 697
389 Ga0495666_0146357 3300046526 Bacteria 1100
390 Ga0495665_0356564 3300046531 Bacteria 744
391 Ga0495665_0390898 3300046531 Bacteria 706
392 Ga0495587_0542867 3300046536 Bacteria 642
393 Ga0495645_0134925 3300046543 Bacteria 1727
394 Ga0495645_0186111 3300046543 Bacteria 1419
395 Ga0495645_0371577 3300046543 Bacteria 917
396 Ga0495669_0103333 3300046684 Bacteria 1325
397 Ga0495624_0527312 3300046690 Bacteria 706
398 Ga0495624_0639695 3300046690 Bacteria 633
399 Ga0495600_0218609 3300046809 Bacteria 1219
400 Ga0495600_0415927 3300046809 Bacteria 835
401 Ga0495600_0628309 3300046809 Bacteria 651
402 Ga0495604_0011290 3300047317 Bacteria 7092
403 Ga0495604_0084110 3300047317 Bacteria 2377
404 Ga0495636_0014734 3300047318 Bacteria 3112
405 Ga0495674_0091455 3300047319 Bacteria 2599
406 Ga0495680_0028250 3300047322 Bacteria 4600
407 Ga0495684_0278506 3300047471 Bacteria 1208
408 Ga0495684_0364991 3300047471 Bacteria 1022
409 Ga0495684_0392713 3300047471 Bacteria 976
410 Ga0495684_0837267 3300047471 Bacteria 598
411 Ga0495614_0606165 3300048089 Bacteria 526
412 Ga0496101_0636833 3300048904 Unclassified 843
413 Ga0496104_0281455 3300048907 Bacteria 1576
414 Ga0496104_0795980 3300048907 Bacteria 852
415 Ga0496106_0707374 3300048909 Bacteria 803
416 Ga0496106_1169765 3300048909 Bacteria 601
417 Ga0496112_0230399 3300048915 Bacteria 1807
418 Ga0501042_1086110 3300049578 Bacteria 583
419 Ga0501073_0502915 3300049589 Bacteria 838
420 Ga0501075_1276098 3300049591 Bacteria 557
421 Ga0501081_0493433 3300049743 Bacteria 912
422 nmdc:mga05p37_2123_c1 3300050507 Bacteria 9713
423 nmdc:mga09592_6794_c1 3300050508 Bacteria 9308
424 nmdc:mga06r32_213210_c1 3300050510 Bacteria 1919
425 nmdc:mga08y16_1529414_c1 3300050511 Bacteria 627
426 nmdc:mga0n895_498811_c1 3300050512 Bacteria 1226
427 nmdc:mga08x19_5862_c1 3300050514 Bacteria 7270
428 Ga0501084_0549432 3300054114 Bacteria 976
429 Ga0501084_0550363 3300054114 Bacteria 975
430 Ga0501082_0000532 3300060353 Bacteria 33889
431 Ga0213873_10085951
432 Ga0058862_12324567
433 Ga0070658_10012765
434 Ga0070690_100174090
435 Ga0070690_100276223
436 Ga0068869_100659491
437 Ga0070666_10018949
438 Ga0070666_10870010
439 Ga0070680_100056615
440 Ga0070680_100431998
441 Ga0070680_100900549
442 Ga0070682_100654515
443 Ga0068868_100022418
444 Ga0070660_100009240
445 Ga0070689_100234200
446 Ga0070689_100800274
447 Ga0070689_101267785
448 Ga0070691_10185244
449 Ga0070661_100118404
450 Ga0070675_100866739
451 Ga0070671_100298113
452 Ga0070673_100327361
453 Ga0070673_100384285
454 Ga0070673_101488493
455 Ga0070673_101932096
456 Ga0070688_100888138
457 Ga0070709_10060324
458 Ga0070709_10154617
459 Ga0070709_10160050
460 Ga0070709_10608954
461 Ga0070709_10615039
462 Ga0070714_100001298
463 Ga0070714_100667040
464 Ga0070713_100106791
465 Ga0070713_100460083
466 Ga0070713_100781093
467 Ga0070713_102029525
468 Ga0070701_10722707
469 Ga0070711_100248467
470 Ga0070700_100404538
471 Ga0070694_100457666
472 Ga0070694_100977786
473 Ga0070708_100009495
474 Ga0070708_100165623
475 Ga0070678_100548914
476 Ga0070662_100970959
477 Ga0070681_10004213
478 Ga0070681_10053091
479 Ga0070681_10181058
480 Ga0070681_10610079
481 Ga0068867_101298538
482 Ga0070707_100464543
483 Ga0070707_100846613
484 Ga0070698_100509080
485 Ga0070699_100089823
486 Ga0070699_100663943
487 Ga0070679_100167496
488 Ga0070679_100173944
489 Ga0070679_100187359
490 Ga0070684_100515845
491 Ga0070684_101410518
492 Ga0070697_100063919
493 Ga0070697_100873809
494 Ga0070697_101233478
495 Ga0070672_101180334
496 Ga0070686_100128701
497 Ga0070686_101456981
498 Ga0070695_100024101
499 Ga0070695_100634610
500 Ga0070696_101659371
501 Ga0070693_100824019
502 Ga0070665_100074411
503 Ga0070665_100332710
504 Ga0070665_100676527
505 Ga0070665_101199564
506 Ga0068855_100013447
507 Ga0068855_100317910
508 Ga0068855_100975065
509 Ga0070664_100223986
510 Ga0068857_100005615
511 Ga0068857_100747443
512 Ga0068856_100038154
513 Ga0070702_100398091
514 Ga0068852_100299753
515 Ga0068859_100069572
516 Ga0068859_100330406
517 Ga0068859_100844856
518 Ga0068864_101093774
519 Ga0068866_10182181
520 Ga0068866_10548139
521 Ga0068870_10422745
522 Ga0068870_10464133
523 Ga0068863_100340673
524 Ga0068863_100637198
525 Ga0068863_101558362
526 Ga0068858_100000554
527 Ga0068858_100025290
528 Ga0068858_100172648
529 Ga0068858_100509808
530 Ga0068858_100641053
531 Ga0068858_100962976
532 Ga0068858_102167309
533 Ga0068860_100077638
534 Ga0068862_102399516
535 Ga0070717_10483448
536 Ga0070717_10590121
537 Ga0070717_10940116
538 Ga0070717_11531528
539 Ga0070715_10387422
540 Ga0070716_100447219
541 Ga0070712_100739998
542 Ga0097621_100321156
543 Ga0068871_100021494
544 Ga0068871_100045697
545 Ga0068871_100198858
546 Ga0068871_100514080
547 Ga0068871_100799441
548 Ga0075430_100216163
549 Ga0075431_100003460
550 Ga0075431_100248097
551 Ga0075434_101855609
552 Ga0075429_100000636
553 Ga0068865_100649365
554 Ga0075436_100005318
555 Ga0075436_100613492
556 Ga0097620_100069573
557 Ga0097620_100330396
558 Ga0097620_100844965
559 Ga0099795_10056702
560 Ga0099795_10460960
561 Ga0105251_10166200
562 Ga0105240_10130212
563 Ga0105240_10211726
564 Ga0111539_10140075
565 Ga0111539_11730491
566 Ga0105245_10065826
567 Ga0105245_11317925
568 Ga0114129_10002496
569 Ga0114129_10600819
570 Ga0105243_10053364
571 Ga0105243_11416120
572 Ga0105241_10160884
573 Ga0105242_10192787
574 Ga0105248_10066157
575 Ga0105248_11482724
576 Ga0105248_11777486
577 Ga0105248_11791012
578 Ga0105248_12945090
579 Ga0105237_10403510
580 Ga0105238_10085306
581 Ga0105238_10111011
582 Ga0105238_10924981
583 Ga0105246_10591241
584 Ga0157373_10551188
585 Ga0157370_10026689
586 Ga0157370_10322237
587 Ga0157369_10056950
588 Ga0157369_10760040
589 Ga0157374_10589416
590 Ga0157374_11297651
591 Ga0157378_10038078
592 Ga0157378_10238557
593 Ga0157378_10759781
594 Ga0163162_10001009
595 Ga0163162_10135001
596 Ga0163162_10651148
597 Ga0163162_10706276
598 Ga0163162_11258023
599 Ga0163162_12998425
600 Ga0157372_10080848
601 Ga0157372_10088175
602 Ga0157372_10476612
603 Ga0157375_10087435
604 Ga0157375_10707988
605 Ga0157375_10811884
606 Ga0157375_11348227
607 Ga0163163_10335974
608 Ga0163163_10586895
609 Ga0163163_12048734
610 Ga0157380_11447541
611 Ga0157379_10074617
612 Ga0157376_12147556
613 Ga0206356_11215551
614 Ga0154015_1250796
615 Ga0213872_10410938
616 Ga0213874_10026421
617 Ga0213876_10018990
618 Ga0213876_10281515
619 Ga0213876_10377563
620 Ga0213875_10000297
621 Ga0213875_10068097
622 Ga0213875_10146007
623 Ga0213871_10024079
624 Ga0224712_10557227
625 Ga0207710_10054813
626 Ga0207680_10089448
627 Ga0207680_10824896
628 Ga0207699_10155866
629 Ga0207699_10396583
630 Ga0207699_10617347
631 Ga0207645_10825971
632 Ga0207705_10533557
633 Ga0207654_10009425
634 Ga0207654_10102051
635 Ga0207707_10007684
636 Ga0207707_10140684
637 Ga0207695_10007960
638 Ga0207695_10012992
639 Ga0207695_10017084
640 Ga0207695_10474343
641 Ga0207671_10009614
642 Ga0207671_11141733
643 Ga0207671_11400696
644 Ga0207693_10575645
645 Ga0207663_10308560
646 Ga0207663_11337359
647 Ga0207660_10098057
648 Ga0207660_10294427
649 Ga0207660_10385091
650 Ga0207657_10014849
651 Ga0207649_10090549
652 Ga0207652_10155114
653 Ga0207652_10192788
654 Ga0207652_10415467
655 Ga0207646_10285428
656 Ga0207694_10003393
657 Ga0207694_10344212
658 Ga0207694_10505152
659 Ga0207659_10901948
660 Ga0207687_10009865
661 Ga0207700_10118196
662 Ga0207664_10331836
663 Ga0207664_11122896
664 Ga0207644_10265236
665 Ga0207644_10784396
666 Ga0207690_10777554
667 Ga0207706_10949297
668 Ga0207686_10048042
669 Ga0207709_10119128
670 Ga0207670_11191079
671 Ga0207704_10357474
672 Ga0207704_10651414
673 Ga0207665_10088892
674 Ga0207711_10130968
675 Ga0207711_10158203
676 Ga0207711_10927470
677 Ga0207711_11357250
678 Ga0207711_11390593
679 Ga0207689_10685066
680 Ga0207689_11656594
681 Ga0207661_10447332
682 Ga0207679_10161433
683 Ga0207679_10445489
684 Ga0207667_10013129
685 Ga0207667_10015448
686 Ga0207667_10883408
687 Ga0207651_10415673
688 Ga0207712_10501253
689 Ga0207658_10560523
690 Ga0207677_10146467
691 Ga0207703_10003577
692 Ga0207703_10067925
693 Ga0207703_10633194
694 Ga0207703_10753930
695 Ga0207703_10874553
696 Ga0207708_10234730
697 Ga0207702_10015133
698 Ga0207702_10017832
699 Ga0207641_10004105
700 Ga0207641_10138111
701 Ga0207648_10162221
702 Ga0207648_11320720
703 Ga0207676_10060103
704 Ga0207676_10906302
705 Ga0207674_10001211
706 Ga0207674_10158297
707 Ga0207683_10325233
708 Ga0207683_10695881
709 Ga0207683_11946472
710 Ga0207698_10061048
711 Ga0268266_10591587
712 Ga0268266_10762707
713 Ga0268266_10916036
714 Ga0268265_11436489
715 Ga0268264_10047292
716 Ga0268264_10221395
717 Ga0268264_10476325
718 Ga0265338_10001801
719 Ga0265338_10004036
720 Ga0265765_1006998
721 Ga0265330_10024748
722 Ga0265332_10010795
723 Ga0265320_10035874
724 Ga0265325_10023523
725 Ga0265329_10013174
726 Ga0265340_10012495
727 Ga0265339_10017123
728 Ga0265339_10044459
729 Ga0265339_10146938
730 Ga0265331_10006871
731 Ga0265316_10000847
732 Ga0265316_10017254
733 Ga0265316_10065937
734 Ga0265313_10282130
735 Ga0265342_10014571
736 Ga0265342_10239566
737 Ga0373926_0094119
738 Ga0373954_0391359
739 Ga0373946_0098914
740 Ga0373955_0462976
741 Ga0373955_0500761
742 Ga0373961_0294274
743 Ga0373924_0390026
744 Ga0373931_0821142
745 Ga0373935_0070479
746 Ga0373935_0081126
747 Ga0373935_1031259
748 Ga0373927_0001128
749 Ga0373927_0004194
750 Ga0373927_0059247
751 Ga0373927_0087866
752 Ga0373927_0340094
753 Ga0373927_0360516
754 Ga0373927_0467201
755 Ga0373927_0471812
756 Ga0373933_1053938
757 Ga0373947_0199350
758 Ga0373947_0245773
759 Ga0373937_0002413
760 Ga0373937_1212993
761 Ga0373925_0069671
762 Ga0373925_0316657
763 Ga0373925_0435184
764 Ga0373925_0551391
765 Ga0395898_1425290
766 Ga0436364_0061600
767 Ga0436364_0281764
768 Ga0436364_0485745
769 Ga0436364_0507336
770 Ga0436364_0573140
771 Ga0436364_0934438
772 Ga0436364_0937796
773 Ga0436364_1102724
774 Ga0436364_1145409
775 Ga0436364_1348183
776 Ga0436364_1377278
777 Ga0436364_1407596
778 Ga0436365_1170125
779 Ga0436365_1408778
780 Ga0436365_1556991
781 Ga0436365_1597476
782 Ga0436360_0371169
783 Ga0436360_0807740
784 Ga0436360_1206165
785 Ga0436361_0056328
786 Ga0436361_0396012
787 Ga0436361_0419405
788 Ga0436361_1163522
789 Ga0436363_0288782
790 Ga0436363_0390178
791 Ga0436363_0806817
792 Ga0436363_0949361
793 Ga0436363_1052103
794 Ga0436363_1553307
795 Ga0436362_0109496
796 Ga0436362_0185316
797 Ga0436362_0644528
798 Ga0436362_0723511
799 Ga0436362_0885873
800 Ga0466963_0132287
801 Ga0466963_0628025
802 Ga0466957_0872995
803 Ga0451576_0065787
804 Ga0451576_0592310
805 Ga0451576_1076169
806 Ga0451576_1213047
807 Ga0466958_0360742
808 Ga0466967_0661906
809 Ga0495629_0562453
810 Ga0495580_0046897
811 Ga0495580_0054224
812 Ga0495580_0083616
813 Ga0495580_0124167
814 Ga0495580_0910458
815 Ga0495582_0038290
816 Ga0495582_0257236
817 Ga0495582_0543602
818 Ga0495594_0492076
819 Ga0495666_0146357
820 Ga0495665_0356564
821 Ga0495665_0390898
822 Ga0495587_0542867
823 Ga0495645_0134925
824 Ga0495645_0186111
825 Ga0495645_0371577
826 Ga0495669_0103333
827 Ga0495624_0527312
828 Ga0495624_0639695
829 Ga0495600_0218609
830 Ga0495600_0415927
831 Ga0495600_0628309
832 Ga0495604_0011290
833 Ga0495604_0084110
834 Ga0495636_0014734
835 Ga0495674_0091455
836 Ga0495680_0028250
837 Ga0495684_0278506
838 Ga0495684_0364991
839 Ga0495684_0392713
840 Ga0495684_0837267
841 Ga0495614_0606165
842 Ga0496101_0636833
843 Ga0496104_0281455
844 Ga0496104_0795980
845 Ga0496106_0707374
846 Ga0496106_1169765
847 Ga0496112_0230399
848 Ga0501042_1086110
849 Ga0501073_0502915
850 Ga0501075_1276098
851 Ga0501081_0493433
852 nmdc:mga05p37_2123_c1
853 nmdc:mga09592_6794_c1
854 nmdc:mga06r32_213210_c1
855 nmdc:mga08y16_1529414_c1
856 nmdc:mga0n895_498811_c1
857 nmdc:mga08x19_5862_c1
858 Ga0501084_0549432
859 Ga0501084_0550363
860 Ga0501082_0000532

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02310

B12-binding

B12 binding domain

46

116

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gkj-assembly1.cif.gz_A structure of endoms in apo form 0.7538 44 87
2yxb-assembly1.cif.gz_A crystal structure of the methylmalonyl-coa mutase alpha-subunit from aeropyrum pernix 0.737 4 103
4r3u-assembly1.cif.gz_C crystal structure of 2-hydroxyisobutyryl-coa mutase 0.7297 4 104
5i03-assembly1.cif.gz_A-2 trna-guanine transglycosylase (tgt) in co-crystallized complex with 6-amino-4-[2-(4-methylphenyl)ethyl]-1,7-dihydro-8h-imidazo[4,5-g]quinazolin-8-one 0.7206 60 88
4ghr-assembly1.cif.gz_A-2 tgt d102n mutant in complex with lin-benzohypoxanthine inhibitor 0.7171 60 87
ID Description Score Start End Superfamily
4r3uD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.7205 4 105 3.40.50.280
af_C0H5Y5_243_480_3.40.50.1460 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7105 2 67 3.40.50.1460
af_Q9C7W4_6_145_3.30.300.30 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;ANL, C-terminal domain 0.6905 3 44 3.30.300.30
4r3uD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Cobalamin-binding domain 0.6858 4 105 3.40.50.280
af_A0A0R0IJM4_4_260_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.6674 47 90 3.20.20.70
ID Description Score Start End GO Terms
AF-T1C270-F1-model_v4 Cobalamin B12-binding domain protein 0.9826 45 105 GO:0016853
GO:0031419
GO:0046872
AF-X1E800-F1-model_v4 B12-binding domain-containing protein 0.9753 40 101 GO:0016853
GO:0031419
GO:0046872
AF-A0A348UKK3-F1-model_v4 B12-binding domain-containing protein 0.9444 38 104 GO:0004494
GO:0005737
GO:0019678
GO:0031419
GO:0046872
AF-A0A3C1G670-F1-model_v4 Methylmalonyl-CoA mutase 0.9421 36 95 GO:0016853
GO:0031419
GO:0046872
AF-T1C270-F1-model_v4 Cobalamin B12-binding domain protein 0.937 45 105 GO:0016853
GO:0031419
GO:0046872

Map