F442007

General Info

Members Datasets Scaffolds Average Seq Length
429 336 296 330

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0009620|Ga0496126_0009620_2328_3521
Length 397
Sequence MSWCITQVFRFRALLSELHGSRGYARCLSAAFAMLSMQGSGLHAGYSILRRCFRMINAGSLKSVRRMYPLSRRELLETAARAAALIAWPGCARADDYPSRPIRLVIPYTAGAAGDQIGRPWAERIASLLGPTYVENMGGAGGALGSSAVAQSAPDGYSLLLGNGSTQVMIPLSSARPAYDTIRDFRAIYRLITSTLAFVVHPSLPVKNLQELAAYAKANRGTFSYGTPGTGTGNHLVGEMFRQQSGIPAEIVHVPYRGMGLATNDLISGQIPLMIAVVSSQLLQLHEAGKVRMLAVTSEKRLSGAPEIPTVIESGMPGLRYAGWFGLFAPKATPDGIVDRIAAATRRAMSDPALQETYRLQGLEPDIDSSPDKFQQLVEDELGRLAPVIKSIGLKRD

Samples

Sample ID Description Type Environment
1 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
4 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
5 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
6 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
7 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
8 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
9 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
10 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
11 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
12 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
13 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
14 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
15 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
16 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
17 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
18 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
19 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
20 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
21 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
22 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
23 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
24 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
25 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
26 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
27 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
28 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
29 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
30 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
31 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
32 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
33 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
34 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
35 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
36 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
37 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
38 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
39 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
40 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
41 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
42 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
43 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
44 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
45 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
46 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
47 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
48 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
49 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
50 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
51 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
52 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
53 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
54 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
55 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
56 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
57 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
58 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
59 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
60 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
61 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
62 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
63 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
64 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
65 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
66 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
67 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
68 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
69 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
70 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
71 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
72 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
73 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
74 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
75 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
76 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
77 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
78 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
79 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
80 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
81 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
82 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
83 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
84 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
85 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
86 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
87 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
88 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
89 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
90 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
91 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
92 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
93 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
94 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
95 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
96 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
97 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
98 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
99 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
100 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
101 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
102 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
103 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
104 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
105 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
106 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
107 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
108 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
109 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
110 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
111 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
112 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
113 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
114 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
115 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
116 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
117 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
118 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
119 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
120 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
121 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
122 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
123 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
124 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
125 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
126 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
127 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
128 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
129 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
130 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
131 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
132 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
133 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
134 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
135 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
136 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
137 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
138 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
139 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
140 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
141 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
142 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
143 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
144 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
145 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
146 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
147 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
148 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
149 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
150 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
151 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
152 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
153 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
154 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
155 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
156 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
157 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
158 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
159 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
160 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
161 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
162 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
163 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
164 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
165 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
166 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
167 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
168 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
169 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
170 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
171 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
172 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
174 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
176 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
177 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
178 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
179 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
180 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
205 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
206 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
207 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
208 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
212 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
213 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
220 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
226 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
227 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
230 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
231 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
232 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
233 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
234 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
235 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
243 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
244 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
245 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
246 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
249 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
253 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
254 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
262 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
263 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
264 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
265 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
279 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
280 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
281 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
282 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
283 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
284 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
288 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
289 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
290 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
291 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
292 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
293 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
296 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
297 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
298 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
299 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
300 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
301 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
302 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
303 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
304 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
305 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
306 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
307 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
308 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
309 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
310 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
311 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
312 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
313 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
314 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
315 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
316 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
317 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
318 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
319 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
320 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
321 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
322 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
323 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
324 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
325 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
326 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
327 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
328 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
329 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
330 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
331 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
332 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
333 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
334 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
335 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
336 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 69
Metatranscriptomes 0
Isolates 31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.81
Nodule 25.64
Rhizoplane 3.5
Rhizosphere 39.16
Stem 0
Stem Tuber 0
Unclassified 11.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10035972 3300001989 Bacteria 1675
2 JGI25406J46586_10001773 3300003203 Bacteria 10162
3 JGI25406J46586_10003971 3300003203 Bacteria 6915
4 JGI25165J46597_1006370 3300003214 Bacteria 2102
5 JGI25165J46597_1007661 3300003214 Bacteria 1768
6 JGI25153J46596_10000150 3300003215 Bacteria 70192
7 JGI25153J46596_10000497 3300003215 Bacteria 24990
8 JGI25153J46596_10003816 3300003215 Bacteria 8315
9 JGI25153J46596_10010067 3300003215 Bacteria 4313
10 JGI25153J46596_10020260 3300003215 Bacteria 2519
11 rootH2_10076667 3300003320 Bacteria 2571
12 rootL2_10022965 3300003322 Bacteria 2523
13 rootL2_10168568 3300003322 Bacteria 4952
14 JGI25160J50197_1001650 3300003354 Bacteria 10915
15 JGI25160J50197_1024676 3300003354 Bacteria 1700
16 JGI25404J52841_10005949 3300003659 Bacteria 2534
17 Ga0055542_1003559 3300003762 Bacteria 4149
18 Ga0055531_10001974 3300003794 Bacteria 14304
19 Ga0065165_1000297 3300005262 Bacteria 83874
20 Ga0065165_1004424 3300005262 Bacteria 8745
21 Ga0065165_1009264 3300005262 Bacteria 4443
22 Ga0070676_10236878 3300005328 Bacteria 1212
23 Ga0070670_100049323 3300005331 Bacteria 3619
24 Ga0070660_100081277 3300005339 Bacteria 2544
25 Ga0070661_100125415 3300005344 Bacteria 1926
26 Ga0070668_100030939 3300005347 Bacteria 4072
27 Ga0070668_100144228 3300005347 Bacteria 1921
28 Ga0070669_100247902 3300005353 Bacteria 1417
29 Ga0070659_100144046 3300005366 Bacteria 1941
30 Ga0070667_100006154 3300005367 Bacteria 9973
31 Ga0070667_100068805 3300005367 Bacteria 3013
32 Ga0070694_100203661 3300005444 Bacteria 1476
33 Ga0070663_100044601 3300005455 Bacteria 3127
34 Ga0070663_100064211 3300005455 Bacteria 2653
35 Ga0070663_100183426 3300005455 Bacteria 1625
36 Ga0070662_100184630 3300005457 Bacteria 1646
37 Ga0068867_100392755 3300005459 Bacteria 1168
38 Ga0070699_100021851 3300005518 Bacteria 5516
39 Ga0068853_100038354 3300005539 Bacteria 4081
40 Ga0070696_100158428 3300005546 Bacteria 1667
41 Ga0070665_100051969 3300005548 Bacteria 4110
42 Ga0070665_100060375 3300005548 Bacteria 3800
43 Ga0070704_100028377 3300005549 Bacteria 3723
44 Ga0068856_100048725 3300005614 Bacteria 4176
45 Ga0068856_100194017 3300005614 Bacteria 2045
46 Ga0068852_100001332 3300005616 Bacteria 16555
47 Ga0068864_100088602 3300005618 Bacteria 2726
48 Ga0068866_10159095 3300005718 Bacteria 1315
49 Ga0068858_100094215 3300005842 Bacteria 2789
50 Ga0068862_100060386 3300005844 Bacteria 3256
51 Ga0068862_100108954 3300005844 Bacteria 2429
52 Ga0068862_100160335 3300005844 Bacteria 2007
53 Ga0081455_10036897 3300005937 Bacteria 4346
54 Ga0081540_1003799 3300005983 Bacteria 11819
55 Ga0081540_1010745 3300005983 Bacteria 6162
56 Ga0081540_1021748 3300005983 Bacteria 3808
57 Ga0081539_10000617 3300005985 Bacteria 72003
58 Ga0075365_10004736 3300006038 Bacteria 7254
59 Ga0075365_10006706 3300006038 Bacteria 6365
60 Ga0075365_10025020 3300006038 Bacteria 3774
61 Ga0075368_10014730 3300006042 Bacteria 2892
62 Ga0075363_100000244 3300006048 Bacteria 15313
63 Ga0075363_100024250 3300006048 Bacteria 3082
64 Ga0075364_10090757 3300006051 Bacteria 2026
65 Ga0075364_10226287 3300006051 Bacteria 1270
66 Ga0075362_10136725 3300006177 Bacteria 1169
67 Ga0075367_10084691 3300006178 Bacteria 1922
68 Ga0075367_10105568 3300006178 Bacteria 1725
69 Ga0075367_10243544 3300006178 Bacteria 1127
70 Ga0075366_10037230 3300006195 Bacteria 2871
71 Ga0075366_10123785 3300006195 Bacteria 1559
72 Ga0075370_10004834 3300006353 Bacteria 6603
73 Ga0075370_10068338 3300006353 Bacteria 2029
74 Ga0075370_10080179 3300006353 Bacteria 1875
75 Ga0075431_100030381 3300006847 Bacteria 5565
76 Ga0105250_10018582 3300009092 Bacteria 2814
77 Ga0105240_10005643 3300009093 Bacteria 18580
78 Ga0105248_10035481 3300009177 Bacteria 5579
79 Ga0105237_10001927 3300009545 Bacteria 26484
80 Ga0105237_10034784 3300009545 Bacteria 5099
81 Ga0105237_10088065 3300009545 Bacteria 3094
82 Ga0105237_10137658 3300009545 Bacteria 2436
83 Ga0105237_10262691 3300009545 Bacteria 1729
84 Ga0105238_10093716 3300009551 Bacteria 2991
85 Ga0105249_10118613 3300009553 Bacteria 2512
86 Ga0105249_10141747 3300009553 Bacteria 2306
87 Ga0105239_10011841 3300010375 Bacteria 9731
88 Ga0105239_10036949 3300010375 Bacteria 5358
89 Ga0105239_10043507 3300010375 Bacteria 4923
90 Ga0105239_10080709 3300010375 Bacteria 3579
91 Ga0105239_10320946 3300010375 Bacteria 1746
92 Ga0105246_10024813 3300011119 Bacteria 3901
93 Ga0157370_10283178 3300013104 Bacteria 1531
94 Ga0157374_10094383 3300013296 Bacteria 2859
95 Ga0163162_10008330 3300013306 Bacteria 10113
96 Ga0163163_10054978 3300014325 Bacteria 3934
97 Ga0157379_10031564 3300014968 Bacteria 4720
98 Ga0157379_10209440 3300014968 Bacteria 1764
99 Ga0209563_100831 3300025230 Bacteria 9217
100 Ga0209677_101532 3300025253 Bacteria 9878
101 Ga0209148_1000647 3300025254 Bacteria 30166
102 Ga0209233_1001062 3300025261 Bacteria 11368
103 Ga0209233_1005995 3300025261 Bacteria 3966
104 Ga0209455_1003432 3300025272 Bacteria 5614
105 Ga0209455_1008405 3300025272 Bacteria 2809
106 Ga0209673_1045631 3300025273 Bacteria 1202
107 Ga0209564_1006455 3300025295 Bacteria 6318
108 Ga0209758_1000024 3300025297 Bacteria 591966
109 Ga0209758_1000068 3300025297 Bacteria 286488
110 Ga0209758_1000838 3300025297 Bacteria 42919
111 Ga0209758_1003537 3300025297 Bacteria 14078
112 Ga0209758_1005297 3300025297 Bacteria 10072
113 Ga0209758_1035174 3300025297 Bacteria 1978
114 Ga0209758_1058622 3300025297 Bacteria 1286
115 Ga0209256_1001511 3300025299 Bacteria 23555
116 Ga0207426_1000225 3300025302 Bacteria 129646
117 Ga0207426_1000273 3300025302 Bacteria 107794
118 Ga0209257_1000972 3300025304 Bacteria 39166
119 Ga0209257_1021499 3300025304 Bacteria 2341
120 Ga0207696_1024887 3300025711 Bacteria 1872
121 Ga0207647_10012234 3300025904 Bacteria 5980
122 Ga0207705_10017473 3300025909 Bacteria 5137
123 Ga0207654_10016073 3300025911 Bacteria 3892
124 Ga0207695_10000008 3300025913 Bacteria 1058268
125 Ga0207695_10135476 3300025913 Bacteria 2416
126 Ga0207657_10112857 3300025919 Bacteria 2242
127 Ga0207681_10237887 3300025923 Bacteria 1416
128 Ga0207650_10035416 3300025925 Bacteria 3625
129 Ga0207644_10029985 3300025931 Bacteria 3777
130 Ga0207690_10045130 3300025932 Bacteria 2910
131 Ga0207706_10010266 3300025933 Bacteria 8562
132 Ga0207711_10180705 3300025941 Bacteria 1918
133 Ga0207689_10003593 3300025942 Bacteria 14162
134 Ga0207712_10133098 3300025961 Bacteria 1897
135 Ga0207668_10144342 3300025972 Bacteria 1834
136 Ga0207703_10083437 3300026035 Bacteria 2670
137 Ga0207678_10002589 3300026067 Bacteria 16491
138 Ga0207678_10012159 3300026067 Bacteria 7560
139 Ga0207678_10016351 3300026067 Bacteria 6514
140 Ga0207678_10185070 3300026067 Bacteria 1779
141 Ga0207708_10013899 3300026075 Bacteria 6018
142 Ga0207702_10515058 3300026078 Bacteria 1167
143 Ga0207641_10225487 3300026088 Bacteria 1740
144 Ga0207676_10169407 3300026095 Bacteria 1901
145 Ga0207674_10138913 3300026116 Bacteria 2390
146 Ga0207675_100011368 3300026118 Bacteria 8331
147 Ga0207675_100319103 3300026118 Bacteria 1516
148 Ga0209389_1000010 3300027296 Bacteria 223892
149 Ga0209389_1000162 3300027296 Bacteria 55061
150 Ga0209589_1000016 3300027357 Bacteria 223788
151 Ga0209489_100016 3300027361 Bacteria 223873
152 Ga0209489_115959 3300027361 Bacteria 4285
153 Ga0209700_100509 3300027363 Bacteria 73459
154 Ga0268266_10002697 3300028379 Bacteria 18634
155 Ga0268266_10007171 3300028379 Bacteria 10099
156 Ga0268266_10120136 3300028379 Bacteria 2338
157 Ga0268266_10120611 3300028379 Unclassified 2333
158 Ga0268265_10006979 3300028380 Bacteria 7640
159 Ga0268265_10058376 3300028380 Bacteria 2946
160 Ga0268265_10389677 3300028380 Unclassified 1284
161 Ga0268264_10149389 3300028381 Bacteria 2093
162 Ga0265336_10001436 3300028666 Bacteria 10875
163 Ga0265338_10000572 3300028800 Bacteria 64902
164 Ga0307509_10012675 3300031507 Bacteria 10058
165 Ga0265314_10108734 3300031711 Bacteria 1766
166 Ga0307405_10065945 3300031731 Bacteria 2307
167 Ga0307407_10065254 3300031903 Bacteria 2143
168 Ga0307409_100525745 3300031995 Bacteria 1156
169 Ga0395905_0002655 3300037471 Bacteria 19624
170 Ga0451797_0079688 3300041453 Bacteria 1755
171 Ga0466972_0039433 3300044658 Bacteria 2305
172 Ga0495603_0086981 3300046455 Bacteria 1829
173 Ga0495650_0058164 3300046471 Bacteria 1562
174 Ga0495605_0030635 3300046474 Bacteria 2756
175 Ga0495605_0031479 3300046474 Bacteria 2710
176 Ga0495605_0063419 3300046474 Bacteria 1763
177 Ga0495664_0217357 3300046477 Bacteria 1157
178 Ga0495584_0065596 3300046491 Bacteria 1826
179 Ga0495585_0094099 3300046492 Bacteria 1611
180 Ga0495585_0129071 3300046492 Bacteria 1332
181 Ga0495583_0062983 3300046506 Bacteria 1650
182 Ga0495606_0042050 3300046507 Bacteria 3060
183 Ga0495606_0042470 3300046507 Bacteria 3040
184 Ga0495610_0081783 3300046512 Bacteria 1482
185 Ga0495616_0040797 3300046513 Bacteria 2370
186 Ga0495616_0060809 3300046513 Bacteria 1854
187 Ga0495620_0026965 3300046515 Bacteria 2695
188 Ga0495620_0032702 3300046515 Bacteria 2367
189 Ga0495628_0165224 3300046516 Bacteria 1681
190 Ga0495631_0076954 3300046518 Bacteria 1440
191 Ga0495632_0037797 3300046519 Bacteria 2447
192 Ga0495632_0178327 3300046519 Bacteria 974
193 Ga0495637_0032859 3300046520 Bacteria 2283
194 Ga0495643_0002684 3300046522 Bacteria 13749
195 Ga0495644_0089587 3300046523 Bacteria 1161
196 Ga0495648_0033537 3300046524 Bacteria 3351
197 Ga0495663_0007741 3300046525 Bacteria 2972
198 Ga0495652_0018953 3300046529 Bacteria 6132
199 Ga0495621_0048480 3300046539 Bacteria 1513
200 Ga0495597_0023212 3300046542 Bacteria 2871
201 Ga0495645_0038304 3300046543 Bacteria 3497
202 Ga0495622_0024896 3300046557 Bacteria 2795
203 Ga0495633_0073013 3300046558 Bacteria 1599
204 Ga0495656_0046880 3300046615 Bacteria 1830
205 Ga0495656_0075830 3300046615 Bacteria 1505
206 Ga0495668_0045264 3300046616 Bacteria 2446
207 Ga0495625_0022539 3300046660 Bacteria 4828
208 Ga0495625_0046776 3300046660 Bacteria 3121
209 Ga0495625_0126634 3300046660 Bacteria 1733
210 Ga0495661_0091662 3300046665 Bacteria 1728
211 Ga0495646_0076354 3300046680 Bacteria 1962
212 Ga0495669_0163390 3300046684 Bacteria 1057
213 Ga0495671_0026761 3300046692 Bacteria 2986
214 Ga0495671_0038278 3300046692 Bacteria 2424
215 Ga0495649_0041217 3300046694 Bacteria 2526
216 Ga0495589_0083091 3300046794 Bacteria 1557
217 Ga0495604_0027318 3300047317 Bacteria 4540
218 Ga0495604_0195933 3300047317 Bacteria 1405
219 Ga0495636_0054098 3300047318 Bacteria 1686
220 Ga0495672_0152809 3300047320 Bacteria 1195
221 Ga0495676_0404093 3300047321 Bacteria 906
222 Ga0495680_0003782 3300047322 Bacteria 14717
223 Ga0495683_0070424 3300047323 Bacteria 1717
224 Ga0495687_014743 3300047443 Bacteria 4006
225 Ga0495675_0004343 3300047444 Bacteria 8576
226 Ga0495673_0005357 3300047469 Bacteria 7777
227 Ga0495686_0165170 3300047472 Bacteria 1291
228 Ga0495615_0031191 3300048090 Bacteria 1277
229 Ga0496100_0125678 3300048903 Bacteria 1800
230 Ga0496100_0181603 3300048903 Bacteria 1522
231 Ga0496101_0122065 3300048904 Bacteria 1970
232 Ga0496103_0010283 3300048906 Bacteria 5534
233 Ga0496104_0117241 3300048907 Bacteria 2555
234 Ga0496105_0115025 3300048908 Bacteria 2219
235 Ga0496105_0216287 3300048908 Bacteria 1561
236 Ga0496106_0033369 3300048909 Bacteria 3841
237 Ga0496107_0034747 3300048910 Bacteria 3612
238 Ga0496108_0086677 3300048911 Bacteria 2658
239 Ga0496109_0094817 3300048912 Bacteria 2762
240 Ga0496110_0165125 3300048913 Bacteria 2008
241 Ga0496113_0172695 3300048916 Bacteria 1712
242 Ga0496114_0126193 3300048917 Bacteria 2206
243 Ga0496116_0032014 3300048919 Bacteria 3754
244 Ga0496117_0035361 3300048920 Bacteria 3750
245 Ga0496117_0109698 3300048920 Bacteria 1722
246 Ga0496118_0023032 3300048921 Bacteria 5424
247 Ga0496118_0026693 3300048921 Bacteria 4911
248 Ga0496119_0112073 3300048922 Bacteria 1512
249 Ga0496120_0029858 3300048923 Bacteria 3323
250 Ga0496121_0007083 3300048924 Bacteria 13610
251 Ga0496121_0032160 3300048924 Bacteria 4775
252 Ga0496121_0036440 3300048924 Bacteria 4383
253 Ga0496121_0234529 3300048924 Bacteria 1283
254 Ga0496124_0050910 3300048927 Bacteria 3526
255 Ga0496125_0049775 3300048928 Bacteria 3477
256 Ga0496125_0061407 3300048928 Bacteria 3014
257 Ga0496126_0009620 3300048929 Bacteria 10250
258 Ga0496126_0039520 3300048929 Bacteria 4377
259 Ga0496126_0086988 3300048929 Bacteria 2754
260 Ga0496126_0163299 3300048929 Bacteria 1902
261 Ga0496126_0229874 3300048929 Bacteria 1554
262 Ga0495682_0025129 3300049460 Bacteria 2217
263 nmdc:mga03n38_1402_c1 3300050490 Bacteria 6863
264 nmdc:mga03n38_201_c1 3300050490 Bacteria 13648
265 nmdc:mga00v17_217206_c1 3300050491 Bacteria 1237
266 nmdc:mga0yw44_1054_c1 3300050492 Bacteria 10601
267 nmdc:mga0yw44_23972_c1 3300050492 Bacteria 3446
268 nmdc:mga0yw44_6667_c1 3300050492 Bacteria 5602
269 nmdc:mga0k408_147520_c1 3300050493 Bacteria 1400
270 nmdc:mga06z11_2404_c1 3300050494 Bacteria 7131
271 nmdc:mga04h51_29906_c1 3300050495 Bacteria 1711
272 nmdc:mga06r32_33066_c1 3300050510 Bacteria 4870
273 nmdc:mga0sz30_31692_c1 3300050516 Bacteria 2188
274 nmdc:mga0sz30_43491_c1 3300050516 Bacteria 1891
275 Ga0500635_0002499 3300053080 Bacteria 4566
276 Ga0500635_0079905 3300053080 Bacteria 1173
277 Ga0500578_0042648 3300053086 Bacteria 2914
278 Ga0500643_000058 3300053087 Bacteria 130051
279 Ga0500583_0036654 3300053092 Bacteria 2197
280 Ga0500651_0096977 3300053093 Bacteria 1812
281 Ga0500566_0003140 3300053094 Bacteria 9869
282 Ga0500555_002510 3300053103 Bacteria 5308
283 Ga0500569_004370 3300053109 Bacteria 2965
284 Ga0500572_015910 3300053111 Bacteria 1905
285 Ga0500594_0013891 3300053118 Bacteria 1921
286 Ga0500595_003308 3300053119 Bacteria 7584
287 Ga0500595_006440 3300053119 Bacteria 4980
288 Ga0500595_008852 3300053119 Bacteria 4091
289 Ga0500607_077120 3300053121 Bacteria 1707
290 Ga0500642_0000130 3300053130 Bacteria 33885
291 Ga0500564_019012 3300053138 Bacteria 3137
292 Ga0500603_000596 3300053150 Bacteria 8987
293 Ga0500636_0000683 3300053177 Bacteria 18200
294 Ga0500636_0011713 3300053177 Bacteria 5134
295 Ga0500609_002033 3300053731 Bacteria 2910
296 Ga0500601_000126 3300053737 Bacteria 15629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100060375 Ga0070665_1000603753 266
2 3300028379 Ga0268266_10120611 Ga0268266_101206111 266
3 3300046492 Ga0495585_0129071 Ga0495585_0129071_174_992 266
4 3300046519 Ga0495632_0178327 Ga0495632_0178327_52_870 266
5 3300047321 Ga0495676_0404093 Ga0495676_0404093_32_850 266
6 3300005985 Ga0081539_10000617 Ga0081539_1000061740 303
7 3300047469 Ga0495673_0005357 Ga0495673_0005357_2798_3727 303
8 3300053737 Ga0500601_000126 Ga0500601_000126_2009_2950 308
9 3300027296 Ga0209389_1000010 Ga0209389_100001060 313
10 3300027357 Ga0209589_1000016 Ga0209589_1000016154 313
11 3300027361 Ga0209489_100016 Ga0209489_10001660 313
12 3300006847 Ga0075431_100030381 Ga0075431_1000303814 315
13 3300050510 nmdc:mga06r32_33066_c1 nmdc:mga06r32_33066_c1_1885_2868 315
14 3300053094 Ga0500566_0003140 Ga0500566_0003140_811_1842 318
15 iso_pu_bacteria 3005710791 3005715435 318
16 3300031731 Ga0307405_10065945 Ga0307405_100659452 319
17 3300031903 Ga0307407_10065254 Ga0307407_100652542 319
18 3300031995 Ga0307409_100525745 Ga0307409_1005257451 319
19 iso_pu_bacteria 2513237092 2513622631 319
20 iso_pu_bacteria 2874612657 2874617324 319
21 iso_pu_bacteria 2881665667 2881667745 319
22 iso_pu_bacteria 2508501009 2508544568 320
23 iso_pu_bacteria 2508501042 2508697283 320
24 iso_pu_bacteria 2511231028 2511399220 320
25 iso_pu_bacteria 2513237094 2513639446 320
26 iso_pu_bacteria 2513237095 2513652623 320
27 iso_pu_bacteria 2513237102 2513699618 320
28 iso_pu_bacteria 2513237141 2513888154 320
29 iso_pu_bacteria 2515154112 2515628020 320
30 iso_pu_bacteria 2524023205 2524442575 320
31 iso_pu_bacteria 2528768022 2528851674 320
32 iso_pu_bacteria 2744054633 2745075540 320
33 iso_pu_bacteria 2816332527 2818243338 320
34 iso_pu_bacteria 2824600985 2824601843 320
35 iso_pu_bacteria 2824609381 2824612843 320
36 iso_pu_bacteria 2824617872 2824620323 320
37 iso_pu_bacteria 2824626560 2824629588 320
38 iso_pu_bacteria 2824635225 2824635908 320
39 iso_pu_bacteria 2824644064 2824645338 320
40 iso_pu_bacteria 2824653114 2824653262 320
41 iso_pu_bacteria 2824661429 2824665782 320
42 iso_pu_bacteria 2824704595 2824714230 320
43 iso_pu_bacteria 2824714736 2824716766 320
44 iso_pu_bacteria 2824723954 2824725255 320
45 iso_pu_bacteria 2824753945 2824755586 320
46 iso_pu_bacteria 2824763712 2824763870 320
47 iso_pu_bacteria 2841957949 2841960461 320
48 iso_pu_bacteria 2841983080 2841984128 320
49 iso_pu_bacteria 2847930680 2847933836 320
50 iso_pu_bacteria 2857509624 2857515516 320
51 iso_pu_bacteria 2874590934 2874592494 320
52 iso_pu_bacteria 2874620515 2874626557 320
53 iso_pu_bacteria 2874628541 2874634515 320
54 iso_pu_bacteria 2874645413 2874650115 320
55 iso_pu_bacteria 2876771140 2876775356 320
56 iso_pu_bacteria 2876818435 2876826291 320
57 iso_pu_bacteria 2879074833 2879079556 320
58 iso_pu_bacteria 2879083081 2879087365 320
59 iso_pu_bacteria 2879099564 2879105261 320
60 iso_pu_bacteria 2879127579 2879129305 320
61 iso_pu_bacteria 2879142872 2879150766 320
62 iso_pu_bacteria 2885366525 2885369543 320
63 iso_pu_bacteria 2888378607 2888381822 320
64 iso_pu_bacteria 2888419890 2888422446 320
65 iso_pu_bacteria 2904666416 2904671898 320
66 iso_pu_bacteria 2904711408 2904720545 320
67 iso_pu_bacteria 2906643746 2906643778 320
68 iso_pu_bacteria 2932784394 2932790600 320
69 iso_pu_bacteria 2932809354 2932811797 320
70 iso_pu_bacteria 2932818245 2932822717 320
71 iso_pu_bacteria 2932828146 2932835496 320
72 iso_pu_bacteria 2933577622 2933577837 320
73 iso_pu_bacteria 2935608549 2935616040 320
74 iso_pu_bacteria 2935616580 2935624837 320
75 iso_pu_bacteria 2935638405 2935646218 320
76 iso_pu_bacteria 2935648319 2935654931 320
77 iso_pu_bacteria 2935656913 2935663799 320
78 iso_pu_bacteria 2935665750 2935670787 320
79 iso_pu_bacteria 2935675223 2935679474 320
80 iso_pu_bacteria 2935684952 2935691510 320
81 iso_pu_bacteria 2935694250 2935701844 320
82 iso_pu_bacteria 2935703347 2935704459 320
83 iso_pu_bacteria 2935713505 2935719344 320
84 iso_pu_bacteria 2935722832 2935729056 320
85 iso_pu_bacteria 2935732158 2935737703 320
86 iso_pu_bacteria 2935741537 2935747079 320
87 iso_pu_bacteria 2935750917 2935758121 320
88 iso_pu_bacteria 2935760218 2935766757 320
89 iso_pu_bacteria 2935769743 2935770716 320
90 iso_pu_bacteria 2935777560 2935784436 320
91 iso_pu_bacteria 2935785616 2935786998 320
92 iso_pu_bacteria 2935793552 2935795046 320
93 iso_pu_bacteria 2935801545 2935809089 320
94 iso_pu_bacteria 2935810662 2935816555 320
95 iso_pu_bacteria 2935819856 2935819936 320
96 iso_pu_bacteria 2935827899 2935835404 320
97 iso_pu_bacteria 2935837841 2935845832 320
98 iso_pu_bacteria 2935847175 2935850054 320
99 iso_pu_bacteria 2935855204 2935863468 320
100 iso_pu_bacteria 2935864058 2935872672 320
101 iso_pu_bacteria 2935873716 2935882597 320
102 iso_pu_bacteria 2935908558 2935915205 320
103 iso_pu_bacteria 2935916978 2935923931 320
104 iso_pu_bacteria 2935926038 2935932702 320
105 iso_pu_bacteria 2935934488 2935941214 320
106 iso_pu_bacteria 2935942939 2935949372 320
107 iso_pu_bacteria 2935951376 2935958067 320
108 iso_pu_bacteria 2935967501 2935974291 320
109 iso_pu_bacteria 2935975950 2935979492 320
110 iso_pu_bacteria 2935984226 2935990832 320
111 iso_pu_bacteria 2935992306 2936000683 320
112 iso_pu_bacteria 2936002035 2936009634 320
113 iso_pu_bacteria 2936011229 2936017955 320
114 iso_pu_bacteria 2936019824 2936026458 320
115 iso_pu_bacteria 2936028420 2936035135 320
116 iso_pu_bacteria 2936037263 2936042493 320
117 iso_pu_bacteria 2936046547 2936053285 320
118 iso_pu_bacteria 2936055302 2936059268 320
119 iso_pu_bacteria 2940556831 2940563968 320
120 iso_pu_bacteria 2941531003 2941536720 320
121 iso_pu_bacteria 2941538514 2941546005 320
122 iso_pu_bacteria 3005718088 3005722816 320
123 iso_pu_bacteria 8016511872 8016515987 320
124 iso_pu_bacteria 8016522445 8016523449 320
125 iso_pu_bacteria 8016530956 8016536953 320
126 iso_pu_bacteria 8016539877 8016541219 320
127 iso_pu_bacteria 8016548790 8016552035 320
128 iso_pu_bacteria 8016566248 8016566609 320
129 iso_pu_bacteria 8016575299 8016579353 320
130 iso_pu_bacteria 8016595262 8016598315 320
131 iso_pu_bacteria 8016603502 8016604409 320
132 iso_pu_bacteria 8016622563 8016629015 320
133 iso_pu_bacteria 8016630954 8016633591 320
134 iso_pu_bacteria 8017057580 8017060527 320
135 iso_pu_bacteria 8019530166 8019536653 320
136 iso_pu_bacteria 8019538911 8019542807 320
137 iso_pu_bacteria 8019576017 8019580008 320
138 iso_pu_bacteria 8019586578 8019587719 320
139 iso_pu_bacteria 8019638758 8019642920 320
140 iso_pu_bacteria 8019659431 8019664506 320
141 iso_pu_bacteria 8019668869 8019674092 320
142 iso_pu_bacteria 8019678201 8019682029 320
143 iso_pu_bacteria 8019687851 8019693577 320
144 iso_pu_bacteria 8055742211 8055748527 320
145 iso_pu_bacteria 8056967851 8056968676 320
146 3300005844 Ga0068862_100160335 Ga0068862_1001603352 321
147 3300028380 Ga0268265_10389677 Ga0268265_103896771 321
148 3300047320 Ga0495672_0152809 Ga0495672_0152809_60_1040 321
149 3300048920 Ga0496117_0035361 Ga0496117_0035361_2353_3339 322
150 3300048924 Ga0496121_0007083 Ga0496121_0007083_3247_4233 322
151 3300053119 Ga0500595_006440 Ga0500595_006440_2914_3900 322
152 3300003214 JGI25165J46597_1006370 JGI25165J46597_10063702 323
153 3300003214 JGI25165J46597_1007661 JGI25165J46597_10076612 323
154 3300005347 Ga0070668_100030939 Ga0070668_1000309394 323
155 3300005844 Ga0068862_100060386 Ga0068862_1000603861 323
156 3300006048 Ga0075363_100000244 Ga0075363_1000002447 323
157 3300006051 Ga0075364_10226287 Ga0075364_102262872 323
158 3300006178 Ga0075367_10084691 Ga0075367_100846911 323
159 3300006195 Ga0075366_10123785 Ga0075366_101237852 323
160 3300006353 Ga0075370_10004834 Ga0075370_100048344 323
161 3300014968 Ga0157379_10031564 Ga0157379_100315643 323
162 3300025261 Ga0209233_1005995 Ga0209233_10059952 323
163 3300025297 Ga0209758_1000838 Ga0209758_100083827 323
164 3300026067 Ga0207678_10002589 Ga0207678_1000258916 323
165 3300028379 Ga0268266_10002697 Ga0268266_1000269713 323
166 3300028666 Ga0265336_10001436 Ga0265336_100014369 323
167 3300028800 Ga0265338_10000572 Ga0265338_1000057260 323
168 3300031507 Ga0307509_10012675 Ga0307509_100126756 323
169 3300048922 Ga0496119_0112073 Ga0496119_0112073_21_1010 323
170 3300048929 Ga0496126_0229874 Ga0496126_0229874_238_1227 323
171 3300003203 JGI25406J46586_10001773 JGI25406J46586_100017734 324
172 3300003203 JGI25406J46586_10003971 JGI25406J46586_100039715 324
173 3300003215 JGI25153J46596_10000150 JGI25153J46596_1000015029 324
174 3300003215 JGI25153J46596_10000497 JGI25153J46596_1000049712 324
175 3300003215 JGI25153J46596_10003816 JGI25153J46596_100038162 324
176 3300003215 JGI25153J46596_10010067 JGI25153J46596_100100672 324
177 3300003215 JGI25153J46596_10020260 JGI25153J46596_100202602 324
178 3300003320 rootH2_10076667 rootH2_100766671 324
179 3300003322 rootL2_10022965 rootL2_100229652 324
180 3300003354 JGI25160J50197_1001650 JGI25160J50197_10016502 324
181 3300003354 JGI25160J50197_1024676 JGI25160J50197_10246762 324
182 3300003659 JGI25404J52841_10005949 JGI25404J52841_100059493 324
183 3300003762 Ga0055542_1003559 Ga0055542_10035592 324
184 3300003794 Ga0055531_10001974 Ga0055531_100019744 324
185 3300005262 Ga0065165_1004424 Ga0065165_10044243 324
186 3300005328 Ga0070676_10236878 Ga0070676_102368781 324
187 3300005344 Ga0070661_100125415 Ga0070661_1001254152 324
188 3300005367 Ga0070667_100006154 Ga0070667_1000061544 324
189 3300005455 Ga0070663_100044601 Ga0070663_1000446012 324
190 3300005455 Ga0070663_100183426 Ga0070663_1001834261 324
191 3300005518 Ga0070699_100021851 Ga0070699_1000218513 324
192 3300005546 Ga0070696_100158428 Ga0070696_1001584282 324
193 3300005548 Ga0070665_100051969 Ga0070665_1000519692 324
194 3300005549 Ga0070704_100028377 Ga0070704_1000283772 324
195 3300005614 Ga0068856_100048725 Ga0068856_1000487252 324
196 3300005614 Ga0068856_100194017 Ga0068856_1001940172 324
197 3300005618 Ga0068864_100088602 Ga0068864_1000886023 324
198 3300005718 Ga0068866_10159095 Ga0068866_101590952 324
199 3300005842 Ga0068858_100094215 Ga0068858_1000942152 324
200 3300005844 Ga0068862_100108954 Ga0068862_1001089542 324
201 3300005937 Ga0081455_10036897 Ga0081455_100368972 324
202 3300005983 Ga0081540_1003799 Ga0081540_100379914 324
203 3300005983 Ga0081540_1010745 Ga0081540_10107453 324
204 3300005983 Ga0081540_1021748 Ga0081540_10217483 324
205 3300006038 Ga0075365_10004736 Ga0075365_100047363 324
206 3300006038 Ga0075365_10006706 Ga0075365_100067065 324
207 3300006038 Ga0075365_10025020 Ga0075365_100250202 324
208 3300006042 Ga0075368_10014730 Ga0075368_100147302 324
209 3300006048 Ga0075363_100024250 Ga0075363_1000242502 324
210 3300006051 Ga0075364_10090757 Ga0075364_100907572 324
211 3300006177 Ga0075362_10136725 Ga0075362_101367251 324
212 3300006178 Ga0075367_10243544 Ga0075367_102435441 324
213 3300006195 Ga0075366_10037230 Ga0075366_100372302 324
214 3300006353 Ga0075370_10080179 Ga0075370_100801792 324
215 3300009092 Ga0105250_10018582 Ga0105250_100185822 324
216 3300009545 Ga0105237_10034784 Ga0105237_100347842 324
217 3300009545 Ga0105237_10262691 Ga0105237_102626912 324
218 3300009551 Ga0105238_10093716 Ga0105238_100937163 324
219 3300009553 Ga0105249_10118613 Ga0105249_101186132 324
220 3300009553 Ga0105249_10141747 Ga0105249_101417472 324
221 3300010375 Ga0105239_10011841 Ga0105239_100118417 324
222 3300010375 Ga0105239_10036949 Ga0105239_100369493 324
223 3300010375 Ga0105239_10043507 Ga0105239_100435074 324
224 3300013104 Ga0157370_10283178 Ga0157370_102831782 324
225 3300013306 Ga0163162_10008330 Ga0163162_100083304 324
226 3300025230 Ga0209563_100831 Ga0209563_1008315 324
227 3300025253 Ga0209677_101532 Ga0209677_1015323 324
228 3300025254 Ga0209148_1000647 Ga0209148_100064720 324
229 3300025261 Ga0209233_1001062 Ga0209233_10010622 324
230 3300025272 Ga0209455_1003432 Ga0209455_10034322 324
231 3300025272 Ga0209455_1008405 Ga0209455_10084052 324
232 3300025273 Ga0209673_1045631 Ga0209673_10456312 324
233 3300025295 Ga0209564_1006455 Ga0209564_10064553 324
234 3300025297 Ga0209758_1000068 Ga0209758_1000068262 324
235 3300025297 Ga0209758_1003537 Ga0209758_10035372 324
236 3300025297 Ga0209758_1005297 Ga0209758_10052976 324
237 3300025297 Ga0209758_1035174 Ga0209758_10351742 324
238 3300025297 Ga0209758_1058622 Ga0209758_10586222 324
239 3300025302 Ga0207426_1000225 Ga0207426_100022553 324
240 3300025302 Ga0207426_1000273 Ga0207426_100027363 324
241 3300025304 Ga0209257_1021499 Ga0209257_10214992 324
242 3300025711 Ga0207696_1024887 Ga0207696_10248872 324
243 3300025904 Ga0207647_10012234 Ga0207647_100122342 324
244 3300025909 Ga0207705_10017473 Ga0207705_100174733 324
245 3300025911 Ga0207654_10016073 Ga0207654_100160733 324
246 3300025919 Ga0207657_10112857 Ga0207657_101128572 324
247 3300025925 Ga0207650_10035416 Ga0207650_100354162 324
248 3300025931 Ga0207644_10029985 Ga0207644_100299852 324
249 3300025932 Ga0207690_10045130 Ga0207690_100451302 324
250 3300025933 Ga0207706_10010266 Ga0207706_100102662 324
251 3300025942 Ga0207689_10003593 Ga0207689_1000359310 324
252 3300025961 Ga0207712_10133098 Ga0207712_101330982 324
253 3300026035 Ga0207703_10083437 Ga0207703_100834372 324
254 3300026067 Ga0207678_10012159 Ga0207678_100121596 324
255 3300026067 Ga0207678_10016351 Ga0207678_100163515 324
256 3300026067 Ga0207678_10185070 Ga0207678_101850701 324
257 3300026075 Ga0207708_10013899 Ga0207708_100138991 324
258 3300026078 Ga0207702_10515058 Ga0207702_105150581 324
259 3300026116 Ga0207674_10138913 Ga0207674_101389132 324
260 3300026118 Ga0207675_100011368 Ga0207675_1000113683 324
261 3300026118 Ga0207675_100319103 Ga0207675_1003191032 324
262 3300027296 Ga0209389_1000162 Ga0209389_100016251 324
263 3300027361 Ga0209489_115959 Ga0209489_1159592 324
264 3300027363 Ga0209700_100509 Ga0209700_10050921 324
265 3300028379 Ga0268266_10007171 Ga0268266_100071716 324
266 3300028379 Ga0268266_10120136 Ga0268266_101201362 324
267 3300028380 Ga0268265_10006979 Ga0268265_100069792 324
268 3300028380 Ga0268265_10058376 Ga0268265_100583762 324
269 3300028381 Ga0268264_10149389 Ga0268264_101493892 324
270 3300031711 Ga0265314_10108734 Ga0265314_101087342 324
271 3300037471 Ga0395905_0002655 Ga0395905_0002655_9479_10474 324
272 3300041453 Ga0451797_0079688 Ga0451797_0079688_124_1113 324
273 3300044658 Ga0466972_0039433 Ga0466972_0039433_275_1264 324
274 3300046455 Ga0495603_0086981 Ga0495603_0086981_322_1314 324
275 3300046471 Ga0495650_0058164 Ga0495650_0058164_300_1289 324
276 3300046474 Ga0495605_0063419 Ga0495605_0063419_310_1299 324
277 3300046477 Ga0495664_0217357 Ga0495664_0217357_130_1119 324
278 3300046492 Ga0495585_0094099 Ga0495585_0094099_612_1601 324
279 3300046507 Ga0495606_0042470 Ga0495606_0042470_1950_2942 324
280 3300046515 Ga0495620_0032702 Ga0495620_0032702_878_1870 324
281 3300046518 Ga0495631_0076954 Ga0495631_0076954_72_1061 324
282 3300046519 Ga0495632_0037797 Ga0495632_0037797_607_1599 324
283 3300046523 Ga0495644_0089587 Ga0495644_0089587_70_1062 324
284 3300046524 Ga0495648_0033537 Ga0495648_0033537_385_1374 324
285 3300046529 Ga0495652_0018953 Ga0495652_0018953_198_1187 324
286 3300046543 Ga0495645_0038304 Ga0495645_0038304_135_1124 324
287 3300046557 Ga0495622_0024896 Ga0495622_0024896_1107_2096 324
288 3300046615 Ga0495656_0046880 Ga0495656_0046880_487_1479 324
289 3300046615 Ga0495656_0075830 Ga0495656_0075830_477_1469 324
290 3300046660 Ga0495625_0022539 Ga0495625_0022539_696_1685 324
291 3300046660 Ga0495625_0046776 Ga0495625_0046776_589_1581 324
292 3300046680 Ga0495646_0076354 Ga0495646_0076354_22_1011 324
293 3300046684 Ga0495669_0163390 Ga0495669_0163390_51_1043 324
294 3300046692 Ga0495671_0026761 Ga0495671_0026761_735_1727 324
295 3300046692 Ga0495671_0038278 Ga0495671_0038278_1076_2068 324
296 3300046794 Ga0495589_0083091 Ga0495589_0083091_83_1075 324
297 3300047317 Ga0495604_0027318 Ga0495604_0027318_70_1059 324
298 3300047317 Ga0495604_0195933 Ga0495604_0195933_316_1308 324
299 3300047322 Ga0495680_0003782 Ga0495680_0003782_1233_2222 324
300 3300047444 Ga0495675_0004343 Ga0495675_0004343_7439_8428 324
301 3300047472 Ga0495686_0165170 Ga0495686_0165170_48_1040 324
302 3300048908 Ga0496105_0115025 Ga0496105_0115025_164_1153 324
303 3300048910 Ga0496107_0034747 Ga0496107_0034747_1717_2706 324
304 3300048913 Ga0496110_0165125 Ga0496110_0165125_249_1238 324
305 3300048916 Ga0496113_0172695 Ga0496113_0172695_81_1070 324
306 3300048917 Ga0496114_0126193 Ga0496114_0126193_1045_2034 324
307 3300048919 Ga0496116_0032014 Ga0496116_0032014_2665_3654 324
308 3300048921 Ga0496118_0026693 Ga0496118_0026693_1986_2981 324
309 3300048923 Ga0496120_0029858 Ga0496120_0029858_431_1420 324
310 3300048924 Ga0496121_0032160 Ga0496121_0032160_2553_3542 324
311 3300048924 Ga0496121_0036440 Ga0496121_0036440_3036_4025 324
312 3300048924 Ga0496121_0234529 Ga0496121_0234529_41_1036 324
313 3300048928 Ga0496125_0049775 Ga0496125_0049775_2256_3245 324
314 3300048929 Ga0496126_0039520 Ga0496126_0039520_2475_3467 324
315 3300048929 Ga0496126_0086988 Ga0496126_0086988_1722_2711 324
316 3300048929 Ga0496126_0163299 Ga0496126_0163299_892_1887 324
317 3300049460 Ga0495682_0025129 Ga0495682_0025129_480_1469 324
318 3300050492 nmdc:mga0yw44_1054_c1 nmdc:mga0yw44_1054_c1_4585_5574 324
319 3300050492 nmdc:mga0yw44_6667_c1 nmdc:mga0yw44_6667_c1_2184_3173 324
320 3300050516 nmdc:mga0sz30_31692_c1 nmdc:mga0sz30_31692_c1_499_1488 324
321 3300053080 Ga0500635_0079905 Ga0500635_0079905_33_1025 324
322 3300053086 Ga0500578_0042648 Ga0500578_0042648_31_1020 324
323 3300053087 Ga0500643_000058 Ga0500643_000058_15542_16531 324
324 3300053092 Ga0500583_0036654 Ga0500583_0036654_741_1730 324
325 3300053093 Ga0500651_0096977 Ga0500651_0096977_204_1193 324
326 3300053103 Ga0500555_002510 Ga0500555_002510_3419_4408 324
327 3300053109 Ga0500569_004370 Ga0500569_004370_1794_2783 324
328 3300053111 Ga0500572_015910 Ga0500572_015910_70_1059 324
329 3300053118 Ga0500594_0013891 Ga0500594_0013891_171_1160 324
330 3300053119 Ga0500595_003308 Ga0500595_003308_4101_5096 324
331 3300053119 Ga0500595_008852 Ga0500595_008852_2568_3557 324
332 3300053121 Ga0500607_077120 Ga0500607_077120_298_1287 324
333 3300053138 Ga0500564_019012 Ga0500564_019012_761_1750 324
334 3300053177 Ga0500636_0000683 Ga0500636_0000683_9293_10282 324
335 3300053177 Ga0500636_0011713 Ga0500636_0011713_1753_2745 324
336 3300053731 Ga0500609_002033 Ga0500609_002033_1404_2393 324
337 iso_pu_bacteria 2513237139 2513877685 329
338 iso_pu_bacteria 2617270735 2617346396 329
339 iso_pu_bacteria 2802429603 2805918301 329
340 3300005444 Ga0070694_100203661 Ga0070694_1002036612 331
341 3300005459 Ga0068867_100392755 Ga0068867_1003927551 331
342 3300014325 Ga0163163_10054978 Ga0163163_100549782 331
343 3300046474 Ga0495605_0030635 Ga0495605_0030635_571_1587 331
344 3300046491 Ga0495584_0065596 Ga0495584_0065596_240_1256 331
345 3300046506 Ga0495583_0062983 Ga0495583_0062983_325_1341 331
346 3300046513 Ga0495616_0060809 Ga0495616_0060809_367_1383 331
347 3300046520 Ga0495637_0032859 Ga0495637_0032859_436_1452 331
348 3300046525 Ga0495663_0007741 Ga0495663_0007741_1863_2879 331
349 3300046539 Ga0495621_0048480 Ga0495621_0048480_302_1318 331
350 3300046558 Ga0495633_0073013 Ga0495633_0073013_198_1214 331
351 3300046660 Ga0495625_0126634 Ga0495625_0126634_494_1510 331
352 3300047318 Ga0495636_0054098 Ga0495636_0054098_160_1176 331
353 3300047323 Ga0495683_0070424 Ga0495683_0070424_323_1339 331
354 3300048090 Ga0495615_0031191 Ga0495615_0031191_179_1195 331
355 3300048903 Ga0496100_0181603 Ga0496100_0181603_370_1386 331
356 3300048908 Ga0496105_0216287 Ga0496105_0216287_496_1512 331
357 3300050490 nmdc:mga03n38_201_c1 nmdc:mga03n38_201_c1_3149_4165 331
358 3300050491 nmdc:mga00v17_217206_c1 nmdc:mga00v17_217206_c1_99_1115 331
359 3300050493 nmdc:mga0k408_147520_c1 nmdc:mga0k408_147520_c1_292_1308 331
360 3300053080 Ga0500635_0002499 Ga0500635_0002499_2276_3301 331
361 3300053150 Ga0500603_000596 Ga0500603_000596_1806_2831 331
362 3300005262 Ga0065165_1009264 Ga0065165_10092645 333
363 3300009177 Ga0105248_10035481 Ga0105248_100354811 333
364 3300009545 Ga0105237_10088065 Ga0105237_100880652 333
365 3300010375 Ga0105239_10080709 Ga0105239_100807092 333
366 3300011119 Ga0105246_10024813 Ga0105246_100248132 333
367 3300013296 Ga0157374_10094383 Ga0157374_100943832 333
368 3300014968 Ga0157379_10209440 Ga0157379_102094401 333
369 3300025297 Ga0209758_1000024 Ga0209758_1000024495 333
370 3300025299 Ga0209256_1001511 Ga0209256_100151112 333
371 3300025304 Ga0209257_1000972 Ga0209257_10009723 333
372 3300046474 Ga0495605_0031479 Ga0495605_0031479_455_1471 333
373 3300046507 Ga0495606_0042050 Ga0495606_0042050_631_1647 333
374 3300046513 Ga0495616_0040797 Ga0495616_0040797_1002_2018 333
375 3300046515 Ga0495620_0026965 Ga0495620_0026965_287_1303 333
376 3300046522 Ga0495643_0002684 Ga0495643_0002684_7358_8374 333
377 3300046542 Ga0495597_0023212 Ga0495597_0023212_1420_2436 333
378 3300046616 Ga0495668_0045264 Ga0495668_0045264_23_1039 333
379 3300046694 Ga0495649_0041217 Ga0495649_0041217_1270_2286 333
380 3300047443 Ga0495687_014743 Ga0495687_014743_1517_2533 333
381 3300048903 Ga0496100_0125678 Ga0496100_0125678_707_1723 333
382 3300048904 Ga0496101_0122065 Ga0496101_0122065_220_1236 333
383 3300048906 Ga0496103_0010283 Ga0496103_0010283_1456_2472 333
384 3300048907 Ga0496104_0117241 Ga0496104_0117241_1462_2478 333
385 3300048909 Ga0496106_0033369 Ga0496106_0033369_1443_2459 333
386 3300048911 Ga0496108_0086677 Ga0496108_0086677_254_1270 333
387 3300048912 Ga0496109_0094817 Ga0496109_0094817_519_1535 333
388 3300048920 Ga0496117_0109698 Ga0496117_0109698_470_1486 333
389 3300048921 Ga0496118_0023032 Ga0496118_0023032_2938_3954 333
390 3300048927 Ga0496124_0050910 Ga0496124_0050910_1118_2134 333
391 3300048928 Ga0496125_0061407 Ga0496125_0061407_97_1113 333
392 3300050490 nmdc:mga03n38_1402_c1 nmdc:mga03n38_1402_c1_86_1102 333
393 3300050492 nmdc:mga0yw44_23972_c1 nmdc:mga0yw44_23972_c1_488_1504 333
394 3300050494 nmdc:mga06z11_2404_c1 nmdc:mga06z11_2404_c1_1332_2348 333
395 3300050495 nmdc:mga04h51_29906_c1 nmdc:mga04h51_29906_c1_456_1472 333
396 3300050516 nmdc:mga0sz30_43491_c1 nmdc:mga0sz30_43491_c1_284_1300 333
397 3300053130 Ga0500642_0000130 Ga0500642_0000130_1753_2769 333
398 3300046512 Ga0495610_0081783 Ga0495610_0081783_287_1321 337
399 3300046665 Ga0495661_0091662 Ga0495661_0091662_576_1610 337
400 iso_pu_bacteria 2824696289 2824697812 341
401 3300003322 rootL2_10168568 rootL2_101685685 344
402 3300005262 Ga0065165_1000297 Ga0065165_100029723 344
403 3300046516 Ga0495628_0165224 Ga0495628_0165224_119_1231 357
404 3300005616 Ga0068852_100001332 Ga0068852_1000013322 359
405 3300009093 Ga0105240_10005643 Ga0105240_100056433 359
406 3300009545 Ga0105237_10001927 Ga0105237_100019277 359
407 3300009545 Ga0105237_10137658 Ga0105237_101376582 359
408 3300010375 Ga0105239_10320946 Ga0105239_103209461 359
409 3300025913 Ga0207695_10000008 Ga0207695_10000008465 359
410 iso_pu_bacteria 2517093001 2517105062 361
411 3300005539 Ga0068853_100038354 Ga0068853_1000383542 365
412 3300001989 JGI24739J22299_10035972 JGI24739J22299_100359722 366
413 3300005331 Ga0070670_100049323 Ga0070670_1000493232 366
414 3300005339 Ga0070660_100081277 Ga0070660_1000812772 366
415 3300005347 Ga0070668_100144228 Ga0070668_1001442282 366
416 3300005353 Ga0070669_100247902 Ga0070669_1002479021 366
417 3300005366 Ga0070659_100144046 Ga0070659_1001440462 366
418 3300005367 Ga0070667_100068805 Ga0070667_1000688052 366
419 3300005455 Ga0070663_100064211 Ga0070663_1000642112 366
420 3300005457 Ga0070662_100184630 Ga0070662_1001846302 366
421 3300006178 Ga0075367_10105568 Ga0075367_101055682 366
422 3300006353 Ga0075370_10068338 Ga0075370_100683382 366
423 3300025913 Ga0207695_10135476 Ga0207695_101354762 366
424 3300025923 Ga0207681_10237887 Ga0207681_102378871 366
425 3300025941 Ga0207711_10180705 Ga0207711_101807051 366
426 3300025972 Ga0207668_10144342 Ga0207668_101443422 366
427 3300026088 Ga0207641_10225487 Ga0207641_102254872 366
428 3300026095 Ga0207676_10169407 Ga0207676_101694072 366
429 3300048929 Ga0496126_0009620 Ga0496126_0009620_2328_3521 366

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

117

394

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9355 72 362
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9286 76 364
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9181 73 366
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9085 72 362
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9063 73 358
ID Description Score Start End Superfamily
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.892 166 290 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8909 166 290 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8899 167 290 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8804 166 290 3.40.190.10
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8783 166 290 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537RWR7-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9721 143 364
AF-A0A096HBL5-F1-model_v4 TctC 0.9584 101 364
AF-A0A4Q7NH98-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.9577 70 366
AF-A0A537RWR7-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9553 143 364
AF-A0A0L8ENA5-F1-model_v4 deleted 0.9497 120 364

Feature Viewer

pLDDT pTM Quality
81.56 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map